BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS160F12

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57289.1|  ATP-dependent Lon protease                             352   2e-112   Ipomoea nil [qian niu]
emb|CDP13424.1|  unnamed protein product                                310   5e-96    Coffea canephora [robusta coffee]
ref|XP_002282657.1|  PREDICTED: lon protease homolog 2, peroxisomal     304   4e-94    Vitis vinifera
ref|XP_010110520.1|  Lon protease-2-like protein                        300   2e-92    
ref|XP_009615530.1|  PREDICTED: lon protease homolog 2, peroxisom...    298   2e-91    Nicotiana tomentosiformis
ref|XP_009371862.1|  PREDICTED: lon protease homolog 2, peroxisomal     297   2e-91    
ref|XP_008373622.1|  PREDICTED: lon protease homolog 2, peroxisomal     297   2e-91    Malus domestica [apple tree]
ref|XP_007210904.1|  hypothetical protein PRUPE_ppa001173mg             295   2e-90    Prunus persica
ref|XP_008348469.1|  PREDICTED: lon protease homolog 2, peroxisom...    294   4e-90    Malus domestica [apple tree]
emb|CAN75012.1|  hypothetical protein VITISV_034238                     294   4e-90    Vitis vinifera
ref|XP_009341221.1|  PREDICTED: lon protease homolog 2, peroxisom...    293   7e-90    Pyrus x bretschneideri [bai li]
ref|XP_009341220.1|  PREDICTED: lon protease homolog 2, peroxisom...    293   1e-89    Pyrus x bretschneideri [bai li]
ref|XP_009615537.1|  PREDICTED: lon protease homolog 2, peroxisom...    291   4e-89    Nicotiana tomentosiformis
ref|XP_009765598.1|  PREDICTED: lon protease homolog 2, peroxisom...    290   2e-88    Nicotiana sylvestris
ref|XP_010274558.1|  PREDICTED: lon protease homolog 2, peroxisomal     290   2e-88    Nelumbo nucifera [Indian lotus]
ref|XP_007155737.1|  hypothetical protein PHAVU_003G2274001g            279   2e-88    Phaseolus vulgaris [French bean]
gb|KDP45972.1|  hypothetical protein JCGZ_11875                         288   7e-88    Jatropha curcas
ref|XP_011070270.1|  PREDICTED: lon protease homolog 2, peroxisomal     288   7e-88    Sesamum indicum [beniseed]
ref|XP_009765597.1|  PREDICTED: lon protease homolog 2, peroxisom...    284   2e-86    Nicotiana sylvestris
ref|XP_004300290.1|  PREDICTED: lon protease homolog 2, peroxisomal     283   6e-86    Fragaria vesca subsp. vesca
ref|XP_006440121.1|  hypothetical protein CICLE_v10018797mg             281   1e-85    
ref|XP_006440122.1|  hypothetical protein CICLE_v10018797mg             281   2e-85    Citrus clementina [clementine]
ref|XP_010055388.1|  PREDICTED: lon protease homolog 2, peroxisomal     281   2e-85    Eucalyptus grandis [rose gum]
gb|EYU33045.1|  hypothetical protein MIMGU_mgv1a001102mg                281   2e-85    Erythranthe guttata [common monkey flower]
gb|EYU17852.1|  hypothetical protein MIMGU_mgv1a0010891mg               275   2e-84    Erythranthe guttata [common monkey flower]
gb|KHN42642.1|  Lon protease like 2, peroxisomal                        278   2e-84    Glycine soja [wild soybean]
ref|XP_003517387.1|  PREDICTED: lon protease homolog 2, peroxisom...    278   2e-84    Glycine max [soybeans]
ref|XP_007156608.1|  hypothetical protein PHAVU_002G002900g             275   4e-84    Phaseolus vulgaris [French bean]
ref|XP_007039619.1|  Lon protease 2                                     277   6e-84    
ref|XP_008788653.1|  PREDICTED: LOW QUALITY PROTEIN: lon protease...    277   8e-84    Phoenix dactylifera
gb|EPS62878.1|  hypothetical protein M569_11910                         276   2e-83    Genlisea aurea
ref|XP_007156607.1|  hypothetical protein PHAVU_002G002900g             275   3e-83    Phaseolus vulgaris [French bean]
gb|KJB25416.1|  hypothetical protein B456_004G190200                    274   4e-83    Gossypium raimondii
ref|XP_004150167.1|  PREDICTED: lon protease homolog 2, peroxisom...    275   4e-83    Cucumis sativus [cucumbers]
ref|XP_008448748.1|  PREDICTED: lon protease homolog 2, peroxisom...    275   5e-83    Cucumis melo [Oriental melon]
gb|KJB39795.1|  hypothetical protein B456_007G030900                    274   7e-83    Gossypium raimondii
ref|XP_010325534.1|  PREDICTED: lon protease homolog 2, peroxisom...    274   7e-83    Solanum lycopersicum
gb|KHG28341.1|  Lon protease, peroxisomal -like protein                 274   1e-82    Gossypium arboreum [tree cotton]
gb|KJB25415.1|  hypothetical protein B456_004G190200                    274   1e-82    Gossypium raimondii
gb|KJB39796.1|  hypothetical protein B456_007G030900                    274   1e-82    Gossypium raimondii
gb|KJB39792.1|  hypothetical protein B456_007G030900                    274   1e-82    Gossypium raimondii
ref|XP_010677210.1|  PREDICTED: lon protease homolog 2, peroxisomal     273   2e-82    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAA20482.1|  ATP-dependent protease Lon                             273   2e-82    Spinacia oleracea
ref|XP_006358613.1|  PREDICTED: lon protease homolog 2, peroxisom...    273   2e-82    Solanum tuberosum [potatoes]
sp|O04979.2|LONP2_SPIOL  RecName: Full=Lon protease homolog 2, pe...    273   3e-82    Spinacia oleracea
ref|XP_010941248.1|  PREDICTED: lon protease homolog 2, peroxisom...    272   4e-82    Elaeis guineensis
ref|XP_010935031.1|  PREDICTED: lon protease homolog 2, peroxisomal     272   4e-82    Elaeis guineensis
ref|XP_008229504.1|  PREDICTED: LOW QUALITY PROTEIN: lon protease...    272   4e-82    
ref|XP_010941245.1|  PREDICTED: lon protease homolog 2, peroxisom...    272   5e-82    Elaeis guineensis
ref|XP_010941244.1|  PREDICTED: lon protease homolog 2, peroxisom...    272   6e-82    Elaeis guineensis
ref|XP_010941247.1|  PREDICTED: lon protease homolog 2, peroxisom...    272   6e-82    Elaeis guineensis
ref|XP_002528799.1|  ATP-dependent protease La, putative                271   1e-81    Ricinus communis
ref|XP_011032006.1|  PREDICTED: lon protease homolog 2, peroxisom...    271   2e-81    Populus euphratica
ref|XP_003524333.1|  PREDICTED: lon protease homolog 2, peroxisom...    269   7e-81    Glycine max [soybeans]
ref|XP_008799399.1|  PREDICTED: lon protease homolog 2, peroxisom...    268   2e-80    Phoenix dactylifera
ref|XP_003549964.1|  PREDICTED: lon protease homolog 2, peroxisom...    268   2e-80    Glycine max [soybeans]
gb|KHN01656.1|  Lon protease like 2, peroxisomal                        268   2e-80    Glycine soja [wild soybean]
ref|XP_004511756.1|  PREDICTED: lon protease homolog 2, peroxisom...    267   3e-80    Cicer arietinum [garbanzo]
gb|KJB39794.1|  hypothetical protein B456_007G030900                    265   4e-79    Gossypium raimondii
gb|KHG09410.1|  Lon protease, peroxisomal -like protein                 265   5e-79    Gossypium arboreum [tree cotton]
gb|KEH31576.1|  lon-related ATP-dependent protease, putative            264   7e-79    Medicago truncatula
ref|XP_009393749.1|  PREDICTED: lon protease homolog 2, peroxisomal     262   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006368476.1|  Lon protease 1 family protein                      262   2e-78    Populus trichocarpa [western balsam poplar]
gb|KHN21044.1|  Lon protease like 2, peroxisomal                        262   4e-78    Glycine soja [wild soybean]
ref|XP_004508987.1|  PREDICTED: lon protease homolog 2, peroxisom...    261   6e-78    Cicer arietinum [garbanzo]
ref|XP_002304362.2|  Lon protease 1 family protein                      261   8e-78    
ref|XP_003611421.1|  Lon protease-like protein                          260   9e-78    Medicago truncatula
gb|ACF78488.1|  unknown                                                 252   2e-77    Zea mays [maize]
ref|XP_004957462.1|  PREDICTED: lon protease homolog 2, peroxisom...    253   4e-77    
ref|XP_011018661.1|  PREDICTED: lon protease homolog 2, peroxisomal     259   5e-77    Populus euphratica
ref|XP_006398398.1|  hypothetical protein EUTSA_v10000767mg             258   9e-77    Eutrema salsugineum [saltwater cress]
ref|XP_006854015.1|  hypothetical protein AMTR_s00048p00009570          257   2e-76    Amborella trichopoda
ref|XP_009383286.1|  PREDICTED: lon protease homolog 2, peroxisom...    256   2e-76    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK31410.1|  hypothetical protein AALP_AA6G108400                    256   4e-76    Arabis alpina [alpine rockcress]
gb|AAK62365.1|AF385580_1  Lon protease                                  256   6e-76    Dichanthelium lanuginosum
ref|XP_010530002.1|  PREDICTED: lon protease homolog 2, peroxisom...    252   6e-75    Tarenaya hassleriana [spider flower]
ref|XP_010530001.1|  PREDICTED: lon protease homolog 2, peroxisom...    252   9e-75    Tarenaya hassleriana [spider flower]
emb|CDX77732.1|  BnaC07g19860D                                          252   1e-74    
ref|XP_010530000.1|  PREDICTED: lon protease homolog 2, peroxisom...    252   1e-74    Tarenaya hassleriana [spider flower]
ref|XP_009101454.1|  PREDICTED: lon protease homolog 2, peroxisomal     252   1e-74    Brassica rapa
emb|CDY33510.1|  BnaA06g35630D                                          252   1e-74    Brassica napus [oilseed rape]
ref|XP_010529999.1|  PREDICTED: lon protease homolog 2, peroxisom...    252   2e-74    Tarenaya hassleriana [spider flower]
ref|NP_001105903.1|  lon protease homolog 2, peroxisomal                251   2e-74    Zea mays [maize]
ref|XP_010495794.1|  PREDICTED: lon protease homolog 2, peroxisom...    248   4e-74    
ref|XP_010441513.1|  PREDICTED: lon protease homolog 2, peroxisomal     250   5e-74    Camelina sativa [gold-of-pleasure]
ref|XP_004970472.1|  PREDICTED: lon protease homolog 2, peroxisom...    250   5e-74    Setaria italica
ref|NP_568675.1|  lon protease-like 2                                   250   6e-74    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD33324.1|  putative Lon protease                                  249   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063769.1|  Os09g0533400                                       249   2e-73    
sp|B8BDV1.1|LONP2_ORYSI  RecName: Full=Lon protease homolog 2, pe...    249   2e-73    Oryza sativa Indica Group [Indian rice]
gb|AAM95459.1|  Lon protease                                            249   2e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_006279987.1|  hypothetical protein CARUB_v10025858mg             248   3e-73    Capsella rubella
ref|XP_002462726.1|  hypothetical protein SORBIDRAFT_02g030960          247   1e-72    Sorghum bicolor [broomcorn]
ref|XP_002863374.1|  hypothetical protein ARALYDRAFT_494276             246   2e-72    
ref|XP_010518860.1|  PREDICTED: lon protease homolog 2, peroxisomal     243   2e-71    
ref|XP_010481381.1|  PREDICTED: lon protease homolog 2, peroxisomal     241   9e-71    Camelina sativa [gold-of-pleasure]
dbj|BAJ95084.1|  predicted protein                                      241   1e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661475.1|  PREDICTED: lon protease homolog 2, peroxisom...    239   4e-70    
ref|XP_008670352.1|  PREDICTED: lon protease homolog 2, peroxisom...    222   1e-69    
ref|XP_003578503.1|  PREDICTED: lon protease homolog 2, peroxisomal     236   1e-68    Brachypodium distachyon [annual false brome]
gb|AAS19619.1|  LON1 protease                                           233   8e-68    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002974838.1|  hypothetical protein SELMODRAFT_150045             203   3e-57    
gb|EMS60327.1|  Lon protease-like protein 2, peroxisomal                195   3e-54    Triticum urartu
gb|EMT28056.1|  Lon protease-like protein, mitochondrial                181   5e-50    
ref|XP_002963756.1|  hypothetical protein SELMODRAFT_141788             179   2e-48    
gb|KDO52684.1|  hypothetical protein CISIN_1g003349mg                   163   1e-42    Citrus sinensis [apfelsine]
ref|XP_004163979.1|  PREDICTED: lon protease homolog 2, peroxisom...    160   1e-41    
ref|XP_001757793.1|  predicted protein                                  159   4e-41    
ref|XP_010325536.1|  PREDICTED: lon protease homolog 2, peroxisom...    158   4e-41    Solanum lycopersicum
ref|XP_011032007.1|  PREDICTED: lon protease homolog 2, peroxisom...    154   2e-39    Populus euphratica
gb|KEH31578.1|  lon-related ATP-dependent protease, putative            142   2e-35    Medicago truncatula
gb|KEH31577.1|  lon-related ATP-dependent protease, putative            142   3e-35    Medicago truncatula
ref|XP_002980173.1|  hypothetical protein SELMODRAFT_444435             139   4e-35    
ref|XP_002963350.1|  hypothetical protein SELMODRAFT_405160           97.4    2e-20    
ref|XP_002501871.1|  lon protease                                     73.6    1e-11    Micromonas commoda
ref|XP_003057661.1|  predicted protein                                70.5    1e-10    Micromonas pusilla CCMP1545
ref|XP_008364428.1|  PREDICTED: uncharacterized protein LOC103428108  57.0    2e-06    
gb|KIG14657.1|  ATP-dependent protease La                             55.1    9e-06    Enhygromyxa salina
ref|XP_001633523.1|  predicted protein                                53.9    2e-05    Nematostella vectensis
gb|ERZ96146.1|  hypothetical protein GLOINDRAFT_334534                53.1    4e-05    
gb|KDE02405.1|  hypothetical protein, variant                         50.4    3e-04    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_008309291.1|  PREDICTED: lon protease homolog 2, peroxisomal   50.4    3e-04    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005795858.1|  PREDICTED: lon protease homolog 2, peroxisom...  50.4    3e-04    
gb|KDE02404.1|  hypothetical protein MVLG_07037                       50.4    3e-04    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_002446246.1|  hypothetical protein SORBIDRAFT_06g009066        43.9    4e-04    



>dbj|BAO57289.1| ATP-dependent Lon protease [Ipomoea nil]
Length=886

 Score =   352 bits (904),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            SAETTTVAPTLSPGV TDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETTTVAPTLSPGVATDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  171



>emb|CDP13424.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   310 bits (793),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            SAET TVAP+LS G+ TDS +R  K+Q G S++HKH+ KN QEVIHWHNRGVAARALHLS
Sbjct  61   SAETATVAPSLSQGLGTDSVERNSKSQVGVSDAHKHESKNAQEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKTEMEQV  171



>ref|XP_002282657.1| PREDICTED: lon protease homolog 2, peroxisomal [Vitis vinifera]
 emb|CBI33970.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   304 bits (779),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE TTV P LS GV TDS +R+ K Q  TSES+K DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   TAEMTTVGPLLSQGVGTDSGERSSKIQVATSESNKPDGKNQQEVIHWHTRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+SLDM K EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLDMNKTEMEQV  171



>ref|XP_010110520.1| Lon protease-2-like protein [Morus notabilis]
 gb|EXC26738.1| Lon protease-2-like protein [Morus notabilis]
Length=865

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPARLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AETTTV P LS GV +DS +R  + Q GTS+SHK DGKNQQE IHWH RGVAARALHLS
Sbjct  61   AAETTTVGPVLSQGVGSDSGERNSRVQVGTSDSHKLDGKNQQEAIHWHTRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYY+ARI+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFTVQELSTRGTYYSARISPLEMTKAEMEQV  171



>ref|XP_009615530.1| PREDICTED: lon protease homolog 2, peroxisomal {ECO:0000255|HAMAP-Rule:MF_03121} 
isoform X1 [Nicotiana tomentosiformis]
Length=888

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            SAET T     S G   +SA+R  KNQAG S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETATSGTATSSGGGVESAERGLKNQAGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDM+K EME +
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMSKAEMELI  171



>ref|XP_009371862.1| PREDICTED: lon protease homolog 2, peroxisomal [Pyrus x bretschneideri]
Length=888

 Score =   297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE  TVAP LS GV +DS +R+ + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAATVAPVLSQGVGSDSGERSSRVQVGTSDSHRPDGKNQQEVIHWHTRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARISPLEMTKSEMEQV  171



>ref|XP_008373622.1| PREDICTED: lon protease homolog 2, peroxisomal [Malus domestica]
Length=888

 Score =   297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE  TVAP LS GV +DS +R+ + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAATVAPVLSQGVGSDSGERSSRVQVGTSDSHRPDGKNQQEVIHWHTRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARISPLEMTKSEMEQV  171



>ref|XP_007210904.1| hypothetical protein PRUPE_ppa001173mg [Prunus persica]
 gb|EMJ12103.1| hypothetical protein PRUPE_ppa001173mg [Prunus persica]
Length=888

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE  +V P LS GV ++S +R  + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAASVGPVLSQGVGSESGERGSRVQVGTSDSHRLDGKNQQEVIHWHTRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARISPLEMTKAEMEQV  171



>ref|XP_008348469.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Malus domestica]
Length=888

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AAEAATVGPVVSQGVGTDSGERSSRVQVGVSDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRF++QELSTRGTYYTARI+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNIQELSTRGTYYTARISPLEMTKTEMEQV  171



>emb|CAN75012.1| hypothetical protein VITISV_034238 [Vitis vinifera]
Length=904

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 155/187 (83%), Gaps = 16/187 (9%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLS----------------PGVVTDSADRTPKNQAGTSESHKHDGKNQQEV  390
            +AE TTV P LS                 GV TDS +R+ K Q  TSES+K DGKNQQEV
Sbjct  61   TAEMTTVXPLLSQVSFIACFEGNAFYLSAGVGTDSGERSSKIQVATSESNKPDGKNQQEV  120

Query  391  IHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMT  570
            IHWH RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+SLDM 
Sbjct  121  IHWHTRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLDMN  180

Query  571  KPEMEQV  591
            K EMEQV
Sbjct  181  KTEMEQV  187



>ref|XP_009341221.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Pyrus x bretschneideri]
Length=888

 Score =   293 bits (750),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +A+  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AADAATVDPVVSQGVGTDSGERSSRVQVGASDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARISPLEMTKTEMEQV  171



>ref|XP_009341220.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Pyrus x bretschneideri]
Length=900

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +A+  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AADAATVDPVVSQGVGTDSGERSSRVQVGASDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARISPLEMTKTEMEQV  171



>ref|XP_009615537.1| PREDICTED: lon protease homolog 2, peroxisomal {ECO:0000255|HAMAP-Rule:MF_03121} 
isoform X2 [Nicotiana tomentosiformis]
Length=882

 Score =   291 bits (745),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 151/171 (88%), Gaps = 6/171 (4%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            SAET T       G   +SA+R  KNQAG S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETAT------SGGGVESAERGLKNQAGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  114

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDM+K EME +
Sbjct  115  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMSKAEMELI  165



>ref|XP_009765598.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X2 [Nicotiana 
sylvestris]
Length=882

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 149/171 (87%), Gaps = 6/171 (4%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            SA T T       G   +SA+R  KNQ G S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAATAT------SGAGVESAERGLKNQTGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  114

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK EME +
Sbjct  115  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKAEMELI  165



>ref|XP_010274558.1| PREDICTED: lon protease homolog 2, peroxisomal [Nelumbo nucifera]
Length=888

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M E VELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MVEPVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AETT+V   LSPGV T+S D+  K    TS+SHK D KNQQE+IHWH RGVAARALHLS
Sbjct  61   AAETTSVGSILSPGVGTESGDQGVKEPVSTSDSHKQDSKNQQELIHWHTRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTY+VVLEGLCRFSVQELS RGTYYTARI+ LD+TK EMEQ
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFSVQELSARGTYYTARISRLDITKAEMEQ  170



>ref|XP_007155737.1| hypothetical protein PHAVU_003G2274001g, partial [Phaseolus vulgaris]
 gb|ESW27731.1| hypothetical protein PHAVU_003G2274001g, partial [Phaseolus vulgaris]
Length=462

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFKNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE   V PT+S G  TDSA++  + Q G+S+SHK D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   AAEIKAVGPTVSEG--TDSANQNTRVQGGSSDSHKLDTKRQNDVVHWHNRGVAARPLHLS  118

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITSL+MTK E+EQV
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITSLEMTKTELEQV  169



>gb|KDP45972.1| hypothetical protein JCGZ_11875 [Jatropha curcas]
Length=895

 Score =   288 bits (737),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 153/174 (88%), Gaps = 3/174 (2%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAE---TTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  429
            +A    T +V PTLS GV +DS +R+ K Q G +E+ K DGKNQQEVI WHNRGVAARAL
Sbjct  61   AAAEETTASVGPTLSQGVGSDSGERSSKIQVGNAENLKLDGKNQQEVIRWHNRGVAARAL  120

Query  430  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            HLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YYTARI+SL+MTK EMEQV
Sbjct  121  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSKRGMYYTARISSLEMTKAEMEQV  174



>ref|XP_011070270.1| PREDICTED: lon protease homolog 2, peroxisomal [Sesamum indicum]
Length=889

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAP-TLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            +A  +  A  TL+PG  T+  +R+ KNQ  TS+SHKH GKNQQEVIHWHN+GVAARALHL
Sbjct  61   AAAESQSAASTLAPGGGTNLGERSSKNQEETSDSHKHGGKNQQEVIHWHNKGVAARALHL  120

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI  LDMTK EM+QV
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIIPLDMTKVEMDQV  172



>ref|XP_009765597.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Nicotiana 
sylvestris]
Length=888

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            SA T T     S G   +SA+R  KNQ G S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAATATSGTATSSGAGVESAERGLKNQTGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK EME +
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKAEMELI  171



>ref|XP_004300290.1| PREDICTED: lon protease homolog 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=887

 Score =   283 bits (723),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE   V P LS G+ +DS +R+ K Q GTS+  + DGKNQQ+ IHWH RGVAARALHLS
Sbjct  61   AAEAAAVGPMLSQGMGSDSGERSSKVQVGTSDPQRLDGKNQQD-IHWHTRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+ L+MTK EMEQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARISPLEMTKSEMEQV  170



>ref|XP_006440121.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
 gb|ESR53361.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
Length=863

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 150/172 (87%), Gaps = 6/172 (3%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MTESVELPNRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVT-DSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            +A  T+V PT+S G V  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAADTSVGPTVSQGGVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHL  115

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+SL+MTK EMEQV
Sbjct  116  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQV  167



>ref|XP_006440122.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
 ref|XP_006477041.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Citrus sinensis]
 gb|ESR53362.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
Length=886

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 150/172 (87%), Gaps = 6/172 (3%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MTESVELPNRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVT-DSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            +A  T+V PT+S G V  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAADTSVGPTVSQGGVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHL  115

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+SL+MTK EMEQV
Sbjct  116  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQV  167



>ref|XP_010055388.1| PREDICTED: lon protease homolog 2, peroxisomal [Eucalyptus grandis]
 gb|KCW71845.1| hypothetical protein EUGRSUZ_E00326 [Eucalyptus grandis]
Length=888

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET +V+P +S GV TD  +R+ K QA +++SHK +GKN QEVIHWH RGVAARALHLS
Sbjct  61   AEETPSVSPVISHGVGTDLTERSSKTQASSTDSHKLNGKNPQEVIHWHARGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRFSVQEL TRGTYY ARIT L+MTK EME V
Sbjct  121  RGVEKPSGRVTYMVVLEGLCRFSVQELGTRGTYYIARITPLEMTKAEMEHV  171



>gb|EYU33045.1| hypothetical protein MIMGU_mgv1a001102mg [Erythranthe guttata]
Length=889

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGIIGILPVRD  60

Query  259  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            +A E  +   T S G  T+  +R+ K Q  TS+SHK  GKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAVEAPSAGSTSSAGGGTNLGERSSKTQEETSDSHKLGGKNQQEVIHWHNRGVAARALHL  120

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT L+M K EM+QV
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITPLEMAKAEMDQV  172



>gb|EYU17852.1| hypothetical protein MIMGU_mgv1a0010891mg, partial [Erythranthe 
guttata]
Length=685

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 150/179 (84%), Gaps = 8/179 (4%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGIIGILPVRD  60

Query  259  SA-ETTTVAPTLSPGVV-------TDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGV  414
            +A E  +   T S G         T+  +R+ K Q  TS+SHK  GKNQQEVIHWHNRGV
Sbjct  61   AAVEAPSAGSTSSAGNRCTLSRGGTNLGERSSKTQEETSDSHKLGGKNQQEVIHWHNRGV  120

Query  415  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT L+M K EM+QV
Sbjct  121  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITPLEMAKAEMDQV  179



>gb|KHN42642.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=889

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAES ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESFELPNRLAILPFRNKVLLPGAIIRIRCTSPISVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            +A E     P +S G  TDS D+  K Q G+S+S K D KNQ +V+HWHNRGVAARALHL
Sbjct  61   AAAEIQPAGPVISHGKGTDSLDQNSKVQGGSSDSQKLDVKNQHDVVHWHNRGVAARALHL  120

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY+TARI+SL+MTK EMEQV
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYHTARISSLEMTKTEMEQV  172



>ref|XP_003517387.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Glycine max]
Length=889

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAES ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESFELPNRLAILPFRNKVLLPGAIIRIRCTSPISVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            +A E     P +S G  TDS D+  K Q G+S+S K D KNQ +V+HWHNRGVAARALHL
Sbjct  61   AAAEIQPAGPVISHGKGTDSLDQNSKVQGGSSDSQKLDVKNQHDVVHWHNRGVAARALHL  120

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY+TARI+SL+MTK EMEQV
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYHTARISSLEMTKTEMEQV  172



>ref|XP_007156608.1| hypothetical protein PHAVU_002G002900g [Phaseolus vulgaris]
 gb|ESW28602.1| hypothetical protein PHAVU_002G002900g [Phaseolus vulgaris]
Length=722

 Score =   275 bits (702),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAES+ELP RLAILPFRNKVLLPGAIIRI CTSP SVKLVEQELWQRE+KGLIG+LPVRD
Sbjct  1    MAESIELPSRLAILPFRNKVLLPGAIIRIYCTSPTSVKLVEQELWQREDKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +A+  T AP +  GV TDS D++ K Q G+  SH+ D  +Q +V+HWH RGVAARALHLS
Sbjct  61   AAQLKTAAPVVPHGVGTDSLDKSSKVQGGSPNSHELDANSQHDVVHWHKRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY+TARI+SL+MT+ EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSMRGTYHTARISSLEMTRTEMEQV  171



>ref|XP_007039619.1| Lon protease 2 [Theobroma cacao]
 gb|EOY24120.1| Lon protease 2 [Theobroma cacao]
Length=888

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MA+SVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAQSVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +A+ T++   LS GV ++S +R+ K +A TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AADMTSMDSVLSQGVGSESGERSSKVKASTSDAHKVDGKNHPEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+SL+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISSLEMTKAEMEQV  171



>ref|XP_008788653.1| PREDICTED: LOW QUALITY PROTEIN: lon protease homolog 2, peroxisomal-like 
[Phoenix dactylifera]
Length=888

 Score =   277 bits (708),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 145/171 (85%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE VELPGRL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAELVELPGRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  435
            S E  TV   LSPGV  DS +R+ K  A    +S K DGKNQQE+IHWHNRGVAARALHL
Sbjct  61   S-EAATVGSMLSPGVGNDSGERSLKGPADVLGDSQKQDGKNQQELIHWHNRGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YY AR++ LDMTK E+EQ
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGNYYIARVSRLDMTKVELEQ  170



>gb|EPS62878.1| hypothetical protein M569_11910 [Genlisea aurea]
Length=886

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 148/171 (87%), Gaps = 5/171 (3%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP R+AILPFRNKVLLPG+IIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRIAILPFRNKVLLPGSIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +A +       S G+ T+  +R PK+Q   S+SHKH GKNQQE+IHWHNRGVAARALHLS
Sbjct  61   AAGSLQ-----SSGLGTNVMERNPKSQDDASDSHKHGGKNQQEIIHWHNRGVAARALHLS  115

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEG+CRF VQ+L  RGTYYTARIT+LDM+K EM+QV
Sbjct  116  RGVEKPSGRVTYIVVLEGMCRFGVQDLINRGTYYTARITTLDMSKAEMDQV  166



>ref|XP_007156607.1| hypothetical protein PHAVU_002G002900g, partial [Phaseolus vulgaris]
 gb|ESW28601.1| hypothetical protein PHAVU_002G002900g, partial [Phaseolus vulgaris]
Length=828

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAES+ELP RLAILPFRNKVLLPGAIIRI CTSP SVKLVEQELWQRE+KGLIG+LPVRD
Sbjct  1    MAESIELPSRLAILPFRNKVLLPGAIIRIYCTSPTSVKLVEQELWQREDKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +A+  T AP +  GV TDS D++ K Q G+  SH+ D  +Q +V+HWH RGVAARALHLS
Sbjct  61   AAQLKTAAPVVPHGVGTDSLDKSSKVQGGSPNSHELDANSQHDVVHWHKRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY+TARI+SL+MT+ EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSMRGTYHTARISSLEMTRTEMEQV  171



>gb|KJB25416.1| hypothetical protein B456_004G190200 [Gossypium raimondii]
Length=832

 Score =   274 bits (701),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDAHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+SL+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISSLEMTKAEMEQV  171



>ref|XP_004150167.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN55802.1| hypothetical protein Csa_3G016960 [Cucumis sativus]
Length=886

 Score =   275 bits (703),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLGILPFRNKVLLPGAIIRIRCTSSSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             A+   + P LS GV +DS DR+ + Q+GTS+S + DGKN QEVI WH+RGVAARAL LS
Sbjct  61   DADAPAIVPVLSQGVGSDSGDRSSRVQSGTSDSQRVDGKNHQEVIQWHSRGVAARALQLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY VVLEGLCRF+VQELSTRGTYYTARI+  +MTK EMEQV
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFTVQELSTRGTYYTARISPSEMTKAEMEQV  171



>ref|XP_008448748.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Cucumis 
melo]
Length=886

 Score =   275 bits (702),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLGILPFRNKVLLPGAIIRIRCTSSSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             A+   + P LS GV +DS DR+ + Q+GTS+S + DGKN QEVI WH+RGVAARAL LS
Sbjct  61   DADAPAIVPVLSQGVGSDSGDRSSRVQSGTSDSQRVDGKNHQEVIQWHSRGVAARALQLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY VVLEGLCRF+VQELSTRGTYYTARI+  +MTK EMEQV
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFTVQELSTRGTYYTARISPSEMTKAEMEQV  171



>gb|KJB39795.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=875

 Score =   274 bits (701),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTKSEMEQV  171



>ref|XP_010325534.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Solanum 
lycopersicum]
Length=877

 Score =   274 bits (701),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 146/171 (85%), Gaps = 11/171 (6%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            SAE+ T    +S G+  +           TS+SHK D KNQQEVIHWH+RGVAARALHLS
Sbjct  61   SAESATSGTAVSSGMGGE-----------TSDSHKLDSKNQQEVIHWHDRGVAARALHLS  109

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK EME +
Sbjct  110  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKGEMELI  160



>gb|KHG28341.1| Lon protease, peroxisomal -like protein [Gossypium arboreum]
Length=888

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDNHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+SL+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISSLEMTKAEMEQV  171



>gb|KJB25415.1| hypothetical protein B456_004G190200 [Gossypium raimondii]
Length=888

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDAHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+SL+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISSLEMTKAEMEQV  171



>gb|KJB39796.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=881

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTKSEMEQV  171



>gb|KJB39792.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
 gb|KJB39793.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
 gb|KJB39797.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=890

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK EMEQV
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTKSEMEQV  171



>ref|XP_010677210.1| PREDICTED: lon protease homolog 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=888

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEPVELPNRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE+ +V   L PG  +DS +R  KNQ+G S+S K D K+QQE +HWHNRGVAARALHLS
Sbjct  61   AAESASVGSVLYPGGGSDSGERNLKNQSGLSDSRKTDAKSQQEAVHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTY VVLEGLCRFSV EL++RGTYYTARI+ LD+TK +MEQ
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFSVLELNSRGTYYTARISPLDITKADMEQ  170



>dbj|BAA20482.1| ATP-dependent protease Lon [Spinacia oleracea]
Length=875

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEAVELPSRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            ++E+ +VAP L PG  TDS +R  K+Q G S+S K DGK+QQE +HWH RGVAARALHLS
Sbjct  61   ASESASVAPVLYPGGGTDSGERNVKSQPGLSDSRKADGKSQQEAVHWHTRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTY VVLEGLCRF V EL++RG YYTARI+ LD+TK +MEQ
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFRVMELNSRGNYYTARISPLDITKADMEQ  170



>ref|XP_006358613.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Solanum 
tuberosum]
Length=877

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 146/171 (85%), Gaps = 11/171 (6%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            SAE+ T    +S G+  +           TS+SHK D KNQQEVIHWH+RGVAARALHLS
Sbjct  61   SAESATSGTAVSSGMGGE-----------TSDSHKLDSKNQQEVIHWHDRGVAARALHLS  109

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK E+E +
Sbjct  110  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKGELELI  160



>sp|O04979.2|LONP2_SPIOL RecName: Full=Lon protease homolog 2, peroxisomal [Spinacia oleracea]
Length=887

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEAVELPSRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            ++E+ +VAP L PG  TDS +R  K+Q G S+S K DGK+QQE +HWH RGVAARALHLS
Sbjct  61   ASESASVAPVLYPGGGTDSGERNVKSQPGLSDSRKADGKSQQEAVHWHTRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTY VVLEGLCRF V EL++RG YYTARI+ LD+TK +MEQ
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFRVMELNSRGNYYTARISPLDITKADMEQ  170



>ref|XP_010941248.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X4 
[Elaeis guineensis]
Length=880

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  8    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  67

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHLS
Sbjct  68   T-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHLS  126

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++ LDMTK E+EQ
Sbjct  127  RGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVSRLDMTKAELEQ  176



>ref|XP_010935031.1| PREDICTED: lon protease homolog 2, peroxisomal [Elaeis guineensis]
Length=886

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE VELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAELVELPSRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  435
            + E   V   LSPGV  DS +R+ K  A    +S K DGKNQQE+IHWHNRGVAARALHL
Sbjct  61   T-EAAAVGSMLSPGVGNDSGERSLKGPADVLGDSQKQDGKNQQELIHWHNRGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YY AR++ LDMTK E+EQ
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGNYYIARVSRLDMTKAELEQ  170



>ref|XP_008229504.1| PREDICTED: LOW QUALITY PROTEIN: lon protease homolog 2, peroxisomal 
[Prunus mume]
Length=886

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE  +V P LS GV ++S +R  + Q GTS+SHK D       IHWH RGVAARALHLS
Sbjct  61   AAEAASVGPVLSQGVGSESGERGSRVQVGTSDSHKLD-XXXXXXIHWHTRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+ L+MTK EMEQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARISPLEMTKSEMEQV  170



>ref|XP_010941245.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Elaeis guineensis]
 ref|XP_010941246.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Elaeis guineensis]
Length=891

 Score =   272 bits (696),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  8    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  67

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHLS
Sbjct  68   T-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHLS  126

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++ LDMTK E+EQ
Sbjct  127  RGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVSRLDMTKAELEQ  176



>ref|XP_010941244.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Elaeis guineensis]
Length=894

 Score =   272 bits (695),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  8    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  67

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHLS
Sbjct  68   T-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHLS  126

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++ LDMTK E+EQ
Sbjct  127  RGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVSRLDMTKAELEQ  176



>ref|XP_010941247.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X3 
[Elaeis guineensis]
Length=889

 Score =   272 bits (695),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  8    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  67

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHLS
Sbjct  68   T-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHLS  126

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++ LDMTK E+EQ
Sbjct  127  RGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVSRLDMTKAELEQ  176



>ref|XP_002528799.1| ATP-dependent protease La, putative [Ricinus communis]
 gb|EEF33621.1| ATP-dependent protease La, putative [Ricinus communis]
Length=890

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 150/177 (85%), Gaps = 10/177 (6%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPNSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SA--ETTTVA---PTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAA  420
            SA  ETTT     P LS GV  DS     K Q   S+++ K DGK+QQEVI WHNRGVAA
Sbjct  61   SAAEETTTSVGPPPVLSQGVGNDSG----KIQVNNSDNNLKLDGKSQQEVIRWHNRGVAA  116

Query  421  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YYTARI+SL+MTK EMEQV
Sbjct  117  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSKRGMYYTARISSLEMTKAEMEQV  173



>ref|XP_011032006.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Populus euphratica]
Length=895

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 151/178 (85%), Gaps = 7/178 (4%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTT------VAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVA  417
            +A   +      V PTLS GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVA
Sbjct  61   AAAAASSSETASVGPTLSQGVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVA  120

Query  418  ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            ARALHLSRGVEKPSGRVTYIVVLEGLCRF++ EL TRGTYYTARI+ L+MT  E+EQV
Sbjct  121  ARALHLSRGVEKPSGRVTYIVVLEGLCRFNLNELVTRGTYYTARISPLEMTNAELEQV  178



>ref|XP_003524333.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Glycine 
max]
Length=885

 Score =   269 bits (687),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 147/171 (86%), Gaps = 3/171 (2%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AE   V PT+S G   DS ++  K Q+G+S+SHK D K Q +V HWHNRGVAAR LHLS
Sbjct  61   AAEIKPVGPTVSEG--ADSTNQNSKVQSGSSDSHKLDTKKQNDV-HWHNRGVAARPLHLS  117

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY VVLEGLCRFSVQELS RG Y+TARITSL+MTK E+EQV
Sbjct  118  RGVEKPSGRVTYTVVLEGLCRFSVQELSMRGIYHTARITSLEMTKTELEQV  168



>ref|XP_008799399.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Phoenix 
dactylifera]
Length=887

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  1    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + E   V   LSPGV  DS +R+ K  A   +S K DGKNQQ++IHWHNRGVAARALHLS
Sbjct  61   T-EAAAVGSMLSPGVGNDSGERSLKGPADVLDSQKQDGKNQQKLIHWHNRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY  AR++ LDMTK E+EQ
Sbjct  120  RGVEKPSGRVTYIVVLEGLCRFSVQELSARGTYRMARVSRLDMTKAELEQ  169



>ref|XP_003549964.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Glycine max]
Length=886

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
              E   V PT+S G   DS ++  K Q G+ +S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   VVEIKPVGPTVSEG--ADSTNQNSKVQGGSLDSRKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITSL+MTK E+EQV
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITSLEMTKTELEQV  169



>gb|KHN01656.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=886

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
              E   V PT+S G   DS ++  K Q G+ +S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   VVEIKPVGPTVSEG--ADSTNQNSKVQGGSLDSRKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITSL+MTK E+EQV
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITSLEMTKTELEQV  169



>ref|XP_004511756.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cicer arietinum]
Length=888

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 148/175 (85%), Gaps = 9/175 (5%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MA+SVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MADSVELPNRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTT----VAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARA  426
            SA        + PTLS GV  DS D++ K   G+S+SH    K Q +V+HWHNRGVAARA
Sbjct  61   SASAAETKPPLGPTLSQGV--DSLDQSSKTHGGSSDSH---AKIQHDVVHWHNRGVAARA  115

Query  427  LHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            LHLSRGVEKPSGRVTYIVVLEGLCRFSV+ELSTRG Y+TARI+SL+MTK EMEQV
Sbjct  116  LHLSRGVEKPSGRVTYIVVLEGLCRFSVEELSTRGAYHTARISSLEMTKTEMEQV  170



>gb|KJB39794.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=904

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTK  573
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTK  165



>gb|KHG09410.1| Lon protease, peroxisomal -like protein [Gossypium arboreum]
Length=934

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESCERSSNAQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTK  573
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTK  165



>gb|KEH31576.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=888

 Score =   264 bits (674),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 145/171 (85%), Gaps = 0/171 (0%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP R+AILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAESVELPSRIAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + E  +  PT S G  TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLS
Sbjct  61   ALEINSAGPTASQGAGTDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLS  120

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY VVLEGLCRFSV ELSTRG Y+TA+I+SL+MTK EMEQ+
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFSVLELSTRGIYHTAKISSLEMTKIEMEQL  171



>ref|XP_009393749.1| PREDICTED: lon protease homolog 2, peroxisomal [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE VELP RLAILPFRN+VLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIGVLPVRD
Sbjct  1    MAEPVELPSRLAILPFRNQVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGVLPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  435
            + E T V   ++PG+ +DS+ R  K  A    +S K D KN QEVIHWHNRGVAARALHL
Sbjct  61   T-EATGVGSMIAPGMGSDSSGRGLKGVADVVGDSQKQDAKNPQEVIHWHNRGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYY AR+  LD+TK E+EQ
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYVARVNRLDLTKAELEQ  170



>ref|XP_006368476.1| Lon protease 1 family protein [Populus trichocarpa]
 gb|ERP65045.1| Lon protease 1 family protein [Populus trichocarpa]
Length=893

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 5/176 (3%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SV+LVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVQLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETT----TVAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAAR  423
            +A  T    +V PTLS    +D+++++ +  A TS  + K DGK+QQEV HWHNRGVAAR
Sbjct  61   AAAATAETASVGPTLSHSAGSDTSEKSSRTPASTSSDNVKLDGKHQQEVFHWHNRGVAAR  120

Query  424  ALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            ALHLSRGVEKPSGRVTYIVVLEGLCRF++ ELSTRG YYTARI+ L+MTK E+EQV
Sbjct  121  ALHLSRGVEKPSGRVTYIVVLEGLCRFNLHELSTRGAYYTARISPLEMTKAELEQV  176



>gb|KHN21044.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=893

 Score =   262 bits (669),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 147/179 (82%), Gaps = 11/179 (6%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNR--------GV  414
            +AE   V PT+S G   DS ++  K Q+G+S+SHK D K Q +V HWHNR        GV
Sbjct  61   AAEIKPVGPTVSEG--ADSTNQNSKVQSGSSDSHKLDTKKQNDV-HWHNRHSSREYLLGV  117

Query  415  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            AAR LHLSRGVEKPSGRVTY VVLEGLCRFSVQELS RG Y+TARITSL+MTK E+EQV
Sbjct  118  AARPLHLSRGVEKPSGRVTYTVVLEGLCRFSVQELSMRGIYHTARITSLEMTKTELEQV  176



>ref|XP_004508987.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cicer arietinum]
Length=886

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M+ESV+LP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MSESVDLPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + E  +  PT S G  TD  D++ K Q  +S+S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   ALEIKSAGPTASQG--TDFLDQSSKLQDSSSDSLKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY VVLEGLCRFSV ELSTRG Y+TARI+SL+MTK EMEQ+
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVLELSTRGIYHTARISSLEMTKTEMEQI  169



>ref|XP_002304362.2| Lon protease 1 family protein [Populus trichocarpa]
 gb|EEE79341.2| Lon protease 1 family protein [Populus trichocarpa]
Length=893

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 148/176 (84%), Gaps = 5/176 (3%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETTTV----APTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAAR  423
            +A  ++        +  GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVAAR
Sbjct  61   AAAASSSETASGNMICLGVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVAAR  120

Query  424  ALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            ALHLSRGVEKPSGRVTYIVVLEGLCRF++ EL TRGTYYTARI+ L+MT  E+EQV
Sbjct  121  ALHLSRGVEKPSGRVTYIVVLEGLCRFNLNELITRGTYYTARISPLEMTNAELEQV  176



>ref|XP_003611421.1| Lon protease-like protein [Medicago truncatula]
 gb|AES94379.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=883

 Score =   260 bits (665),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 148/174 (85%), Gaps = 11/174 (6%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MA+SVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MADSVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGMIGILPVRD  60

Query  259  ---SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  429
               SAET  +  T     V+DS D+T K   G+S+S   + K Q +V+HWHNRGVAARAL
Sbjct  61   TAASAETKQLGST-----VSDSIDQTSKVHGGSSDS---NAKVQNDVVHWHNRGVAARAL  112

Query  430  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            HLSRGVEKPSGRVTYIVVLEGLCRF+VQEL+TRGTY+TARI+SL+MTK EMEQV
Sbjct  113  HLSRGVEKPSGRVTYIVVLEGLCRFNVQELNTRGTYHTARISSLEMTKTEMEQV  166



>gb|ACF78488.1| unknown [Zea mays]
 tpg|DAA62468.1| TPA: hypothetical protein ZEAMMB73_586377 [Zea mays]
Length=514

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            M++S VELP RLA+LPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MSDSPVELPSRLAVLPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            DS E T V   LSPGV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKVGGSAVESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG Y+ AR++ LDMTK E+EQ
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGPYHVARVSRLDMTKTELEQ  170



>ref|XP_004957462.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Setaria 
italica]
Length=563

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            DS E   V   LS GV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAGAVGSLLSAGVGSDSGEGGSKAGGSAGESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+EQ
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEQ  170



>ref|XP_011018661.1| PREDICTED: lon protease homolog 2, peroxisomal [Populus euphratica]
Length=896

 Score =   259 bits (661),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 150/179 (84%), Gaps = 8/179 (4%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SV+LVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVQLVEQELWQREEKGLIGILPVRD  60

Query  259  SAETT----TVAPTLSPGVV---TDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGV  414
            +A  T    +V PTLS       +D+++++ K  A TS  + K DGK+QQEV HWHNRGV
Sbjct  61   AAAATTETASVGPTLSDDKTRAESDTSEKSSKTPASTSSDNVKPDGKHQQEVFHWHNRGV  120

Query  415  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            AARALHLSRGVEKPSGRVTYIVVLEGLCRF++ ELSTRG YYTARI+ L+MTK E+EQV
Sbjct  121  AARALHLSRGVEKPSGRVTYIVVLEGLCRFNLHELSTRGAYYTARISPLEMTKAELEQV  179



>ref|XP_006398398.1| hypothetical protein EUTSA_v10000767mg [Eutrema salsugineum]
 gb|ESQ39851.1| hypothetical protein EUTSA_v10000767mg [Eutrema salsugineum]
Length=887

 Score =   258 bits (658),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWHNRGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHNRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQV  170



>ref|XP_006854015.1| hypothetical protein AMTR_s00048p00009570 [Amborella trichopoda]
 gb|ERN15482.1| hypothetical protein AMTR_s00048p00009570 [Amborella trichopoda]
Length=888

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE VELPGRLAILPFRNKVLLPG+I+RIRCTSP SVKLVEQELWQREEKGLIGVLPV D
Sbjct  1    MAEMVELPGRLAILPFRNKVLLPGSIVRIRCTSPTSVKLVEQELWQREEKGLIGVLPVHD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            +   ++ A T   G   DS D    N A  +ESHK DGKNQ ++I+WH RGVAARALHLS
Sbjct  61   AGAESS-ASTSPSGATNDSRDHGSNNSASPTESHKQDGKNQHDLINWHKRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTY V+LEGLCRFSVQELS RGTYY ARI+ LD+++ EM Q
Sbjct  120  RGVEKPSGRVTYSVILEGLCRFSVQELSARGTYYVARISRLDLSQIEMGQ  169



>ref|XP_009383286.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M E  ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELW +EEKGLIGVLPVRD
Sbjct  1    MVELAELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWHKEEKGLIGVLPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + E   V   ++PG+ +DS +++ K +A   E    D  N+QE++HWH+RGVAARALHLS
Sbjct  61   T-EAAAVGSMIAPGMGSDSGEQSLKAKADVGEFQNQDANNEQELMHWHHRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            RGVEKPSGRVTYIVVLEGLCR SVQELSTRGTYY ARI+ LD+TK E+EQ
Sbjct  120  RGVEKPSGRVTYIVVLEGLCRISVQELSTRGTYYVARISRLDLTKSELEQ  169



>gb|KFK31410.1| hypothetical protein AALP_AA6G108400 [Arabis alpina]
Length=889

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE + +   ++PG  +D+ +R+ K   GT+++ K D K+QQEV HWHNRGVAARALHLS
Sbjct  61   DAEGSAIGTMINPGAGSDTGERSLKFLVGTTDAQKSDAKDQQEV-HWHNRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RFSVQ+L  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQDLGKRGPYSVARITSLEMTKAELEQV  170



>gb|AAK62365.1|AF385580_1 Lon protease [Dichanthelium lanuginosum]
Length=884

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            DS E   V   LSPGV +DS +   K   G+ ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAAAVGSLLSPGVGSDSGEGGSK-AGGSGESSKQDTKNGKEPIHWHSKGVAARALHL  118

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+EQ
Sbjct  119  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEQ  169



>ref|XP_010530002.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X4 
[Tarenaya hassleriana]
Length=838

 Score =   252 bits (644),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITSLEMTKTELEQV  170



>ref|XP_010530001.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X3 
[Tarenaya hassleriana]
Length=876

 Score =   252 bits (644),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITSLEMTKTELEQV  170



>emb|CDX77732.1| BnaC07g19860D [Brassica napus]
Length=887

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADTVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKGELEQV  170



>ref|XP_010530000.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Tarenaya hassleriana]
Length=889

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITSLEMTKTELEQV  170



>ref|XP_009101454.1| PREDICTED: lon protease homolog 2, peroxisomal [Brassica rapa]
Length=887

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADTVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKGELEQV  170



>emb|CDY33510.1| BnaA06g35630D [Brassica napus]
Length=887

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADNVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKGELEQV  170



>ref|XP_010529999.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Tarenaya hassleriana]
Length=905

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITSLEMTKTELEQV  170



>ref|NP_001105903.1| lon protease homolog 2, peroxisomal [Zea mays]
 sp|P93647.1|LONP2_MAIZE RecName: Full=Lon protease homolog 2, peroxisomal [Zea mays]
 gb|AAC50011.1| LON1 protease [Zea mays]
 tpg|DAA62469.1| TPA: lon protease-like protein 2, peroxisomal [Zea mays]
Length=885

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            M++S VELP RLA+LPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MSDSPVELPSRLAVLPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            DS E T V   LSPGV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKVGGSAVESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG Y+ AR++ LDMTK E+EQ
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGPYHVARVSRLDMTKTELEQ  170



>ref|XP_010495794.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Camelina 
sativa]
Length=726

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+Q E   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQHEA-QWHTRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E++QV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELDQV  170



>ref|XP_010441513.1| PREDICTED: lon protease homolog 2, peroxisomal [Camelina sativa]
Length=888

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQE   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSVERSLKFLVGTTDAQKSDAKDQQEA-QWHTRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQV  170



>ref|XP_004970472.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Setaria 
italica]
Length=885

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            DS E   V   LS GV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAGAVGSLLSAGVGSDSGEGGSKAGGSAGESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+EQ
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEQ  170



>ref|NP_568675.1| lon protease-like 2 [Arabidopsis thaliana]
 sp|O64948.1|LONP2_ARATH RecName: Full=Lon protease homolog 2, peroxisomal [Arabidopsis 
thaliana]
 gb|AAC05085.1| Lon protease [Arabidopsis thaliana]
 dbj|BAB10243.1| mitochondrial Lon protease homolog 1 precursor [Arabidopsis thaliana]
 gb|AED95460.1| lon protease-like 2 [Arabidopsis thaliana]
Length=888

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQ+ + WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQD-LQWHTRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQV  170



>dbj|BAD33324.1| putative Lon protease [Oryza sativa Japonica Group]
 dbj|BAD46033.1| putative Lon protease [Oryza sativa Japonica Group]
Length=880

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = +1

Query  88   SVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAE  267
            +VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV DS  
Sbjct  5    AVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVHDSEA  64

Query  268  TTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALHLSRG  444
              ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALHLSRG
Sbjct  65   AGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALHLSRG  121

Query  445  VEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            VEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E 
Sbjct  122  VEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEH  169



>ref|NP_001063769.1| Os09g0533400 [Oryza sativa Japonica Group]
 sp|Q0J032.1|LONP2_ORYSJ RecName: Full=Lon protease homolog 2, peroxisomal [Oryza sativa 
Japonica Group]
 dbj|BAF25683.1| Os09g0533400 [Oryza sativa Japonica Group]
 gb|EEE70111.1| hypothetical protein OsJ_30122 [Oryza sativa Japonica Group]
Length=884

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = +1

Query  88   SVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAE  267
            +VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV DS  
Sbjct  5    AVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVHDSEA  64

Query  268  TTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALHLSRG  444
              ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALHLSRG
Sbjct  65   AGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALHLSRG  121

Query  445  VEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            VEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E 
Sbjct  122  VEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEH  169



>sp|B8BDV1.1|LONP2_ORYSI RecName: Full=Lon protease homolog 2, peroxisomal [Oryza sativa 
Indica Group]
 gb|EEC84943.1| hypothetical protein OsI_32159 [Oryza sativa Indica Group]
Length=884

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = +1

Query  88   SVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAE  267
            +VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV DS  
Sbjct  5    AVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVHDSEA  64

Query  268  TTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALHLSRG  444
              ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALHLSRG
Sbjct  65   AGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALHLSRG  121

Query  445  VEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            VEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E 
Sbjct  122  VEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEH  169



>gb|AAM95459.1| Lon protease [Oryza sativa Indica Group]
Length=884

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = +1

Query  88   SVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAE  267
            +VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV DS  
Sbjct  5    AVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVHDSEA  64

Query  268  TTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALHLSRG  444
              ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALHLSRG
Sbjct  65   AGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALHLSRG  121

Query  445  VEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            VEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E 
Sbjct  122  VEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEH  169



>ref|XP_006279987.1| hypothetical protein CARUB_v10025858mg [Capsella rubella]
 gb|EOA12885.1| hypothetical protein CARUB_v10025858mg [Capsella rubella]
Length=888

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV  WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQEV-QWHTRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQE   RG Y  AR+TSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQEHGKRGPYSVARVTSLEMTKAELEQV  170



>ref|XP_002462726.1| hypothetical protein SORBIDRAFT_02g030960 [Sorghum bicolor]
 gb|EER99247.1| hypothetical protein SORBIDRAFT_02g030960 [Sorghum bicolor]
Length=885

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            MA++ VELP RLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADAPVELPSRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            DS E T V   LSPGV +DS +   K      ES + D KN ++ IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKAGGSAGESSRQDTKNGKDPIHWHSKGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RG Y+ AR++ LDMTK E++Q
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGPYHVARVSRLDMTKIELDQ  170



>ref|XP_002863374.1| hypothetical protein ARALYDRAFT_494276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39633.1| hypothetical protein ARALYDRAFT_494276 [Arabidopsis lyrata subsp. 
lyrata]
Length=888

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++ G  +DS +R+ K   GT+++ K D K+QQ+ + WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINHGAGSDSGERSLKFLVGTTDAQKSDAKDQQD-LQWHTRGVAARALHLS  119

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQV  170



>ref|XP_010518860.1| PREDICTED: lon protease homolog 2, peroxisomal [Tarenaya hassleriana]
Length=875

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 140/167 (84%), Gaps = 1/167 (1%)
 Frame = +1

Query  91   VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAET  270
            +ELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD+AE 
Sbjct  1    MELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRDAAEG  60

Query  271  TTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVE  450
            T+++  +SPGV +DS +   K+Q GT+++ K + ++QQ+V  WH+RGVAARALHLSRGVE
Sbjct  61   TSISTMISPGVGSDSGENGMKHQVGTADAQKSEARDQQDV-DWHHRGVAARALHLSRGVE  119

Query  451  KPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            KPSGRVTY+VVLEGL RFSV EL  RG Y  A+ITSLDMT  E+EQV
Sbjct  120  KPSGRVTYVVVLEGLSRFSVHELGKRGPYSVAKITSLDMTNTELEQV  166



>ref|XP_010481381.1| PREDICTED: lon protease homolog 2, peroxisomal [Camelina sativa]
Length=883

 Score =   241 bits (616),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 138/171 (81%), Gaps = 6/171 (4%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
             AE +++   ++PG  +DS +R+ K   GT+     D K+QQE   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTT-----DAKDQQEA-QWHTRGVAARALHLS  114

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV
Sbjct  115  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQV  165



>dbj|BAJ95084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=886

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 145/175 (83%), Gaps = 7/175 (4%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQRE+KGLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTTPSSVKLVEQELWQREDKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSAD---RTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARA  426
            DS E   V   LSPGV  DS +   R+P    G  ES K D K+ +E IHWH+RGVAARA
Sbjct  61   DS-EAAAVGSILSPGVGGDSGEGGRRSPGASGG--ESSKQDAKSGKEPIHWHSRGVAARA  117

Query  427  LHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            LHLSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y+ AR++ LDMTK E+EQV
Sbjct  118  LHLSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSYHVARVSRLDMTKTELEQV  172



>ref|XP_006661475.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Oryza brachyantha]
Length=894

 Score =   239 bits (611),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 138/177 (78%), Gaps = 14/177 (8%)
 Frame = +1

Query  91   VELPGRLAILPFRNKVLLPGAIIRIRCTSPR----------SVKLVEQELWQREEKGLIG  240
            VELPGRLAILPFRNKVLLPGAI+RIRCT+P           SVKLVEQELWQREEKGLIG
Sbjct  6    VELPGRLAILPFRNKVLLPGAIVRIRCTNPILLYQCNCFACSVKLVEQELWQREEKGLIG  65

Query  241  VLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVA  417
            VLPV DS    ++   LSPGV +DS +   K   GT  ES K D KN +E IHWH+RGVA
Sbjct  66   VLPVHDSEAAGSL---LSPGVGSDSGEGGSKAPGGTGGESTKQDTKNGKETIHWHSRGVA  122

Query  418  ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E 
Sbjct  123  ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEH  179



>ref|XP_008670352.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Zea mays]
Length=188

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            MA+S VELP RLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+E+KGLIGVLPVR
Sbjct  1    MADSPVELPNRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEDKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  435
            DS E T +   LSPGV +DS     K      ES K   KN +E I WH +GVAARALHL
Sbjct  61   DS-EATAIGSLLSPGVGSDSGGGGSKAVGSAGESSKQHLKNGKEPIQWHTKGVAARALHL  119

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTK  573
            SRGVEKPSGRVTYIVVLEGLCRFSVQEL+ RG Y+ AR++ LDMTK
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELNARGPYHFARVSRLDMTK  165



>ref|XP_003578503.1| PREDICTED: lon protease homolog 2, peroxisomal [Brachypodium 
distachyon]
Length=886

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 142/172 (83%), Gaps = 3/172 (2%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQRE+KGLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREDKGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAARALH  432
            DS E  +V   LSPGV  DS +   K+  G+     K D KN +E IHWHNRGVAARALH
Sbjct  61   DS-EAASVGSILSPGVGGDSGEGGSKSPGGSGGESTKQDAKNGKEPIHWHNRGVAARALH  119

Query  433  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            LSRGVEKPSGRVTY VVLEGLCRFSVQEL+ RG+Y+ AR++ LDMTK E+EQ
Sbjct  120  LSRGVEKPSGRVTYTVVLEGLCRFSVQELNARGSYHVARVSRLDMTKTELEQ  171



>gb|AAS19619.1| LON1 protease [Triticum aestivum]
Length=886

 Score =   233 bits (594),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 144/172 (84%), Gaps = 3/172 (2%)
 Frame = +1

Query  79   MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  255
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT P SVKLVEQELWQRE++GLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTYPSSVKLVEQELWQREDRGLIGVLPVR  60

Query  256  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  432
            DS E   V   LSPGV +DS D   ++  G+  ES K D K+ +E IHWH+RGVAARALH
Sbjct  61   DS-EAAAVGSILSPGVGSDSGDGGRRSPGGSGGESTKQDAKSGKEPIHWHSRGVAARALH  119

Query  433  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            LSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y+ AR++ LDMTK E+EQ
Sbjct  120  LSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSYHVARVSRLDMTKTELEQ  171



>ref|XP_002974838.1| hypothetical protein SELMODRAFT_150045 [Selaginella moellendorffii]
 gb|EFJ24358.1| hypothetical protein SELMODRAFT_150045 [Selaginella moellendorffii]
Length=888

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 128/171 (75%), Gaps = 10/171 (6%)
 Frame = +1

Query  82   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDS  261
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD 
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDL  65

Query  262  AETTTVAPTLSPGVVTDSADRTPKNQAGTS--ESHKHDGKNQQEVIHWHNRGVAARALHL  435
             +T           VT     +P ++ GT+  +  +  GK  QE++ WH RGVAARALHL
Sbjct  66   QQTVLG--------VTCVLIASPGDRGGTALPDFQQCLGKQNQELVQWHPRGVAARALHL  117

Query  436  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            SRG+EKPSGRVTY VVLEG CRFS+++++ RG+Y TARI  LDMTK EMEQ
Sbjct  118  SRGMEKPSGRVTYTVVLEGWCRFSLKDMNARGSYNTARIGQLDMTKAEMEQ  168



>gb|EMS60327.1| Lon protease-like protein 2, peroxisomal [Triticum urartu]
Length=838

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 116/144 (81%), Gaps = 2/144 (1%)
 Frame = +1

Query  160  RIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQ  339
            R RC +P SVKLVEQELWQRE+KGLIGVLPVRDS E   V   LSPGV +DS +   ++ 
Sbjct  3    RSRCPTPSSVKLVEQELWQREDKGLIGVLPVRDS-EAAAVGSILSPGVGSDSGEGGRRSP  61

Query  340  AGTS-ESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQE  516
             G+  ES K D K+ +E IHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSV+E
Sbjct  62   GGSGGESTKQDAKSGKEPIHWHSRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVEE  121

Query  517  LSTRGTYYTARITSLDMTKPEMEQ  588
            L+ RG+Y+ AR++ LDMTK E+EQ
Sbjct  122  LNARGSYHVARVSRLDMTKTELEQ  145



>gb|EMT28056.1| Lon protease-like protein, mitochondrial [Aegilops tauschii]
Length=597

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = +1

Query  181  RSVKLVEQELWQREEKGLIGVLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ES  357
            +SVKLVEQELWQRE+KGLIGVLPVRDS E   V   LSPGV +DS +   ++  G+  ES
Sbjct  28   KSVKLVEQELWQREDKGLIGVLPVRDS-EAAAVGSILSPGVGSDSGEGGRRSPGGSGGES  86

Query  358  HKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY  537
             K D K+ +E IHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y
Sbjct  87   TKQDAKSGKEPIHWHSRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSY  146

Query  538  YTARITSLDMTKPEM  582
            + AR++ LDMTK ++
Sbjct  147  HVARVSRLDMTKTDI  161



>ref|XP_002963756.1| hypothetical protein SELMODRAFT_141788 [Selaginella moellendorffii]
 gb|EFJ35627.1| hypothetical protein SELMODRAFT_141788 [Selaginella moellendorffii]
Length=879

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 15/169 (9%)
 Frame = +1

Query  82   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDS  261
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD 
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDL  65

Query  262  AETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSR  441
              +   +       +  S +  P    G +     DG  +        RGVAARALHLSR
Sbjct  66   QHSAWESK------IKSSCNGIP----GKNSRVFPDGSRKNVC-----RGVAARALHLSR  110

Query  442  GVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
            G+EKPSGRVTY VVLEG CRFS+++++ RG+Y TARI  LDMTK EMEQ
Sbjct  111  GMEKPSGRVTYTVVLEGWCRFSLKDMNARGSYNTARIGQLDMTKAEMEQ  159



>gb|KDO52684.1| hypothetical protein CISIN_1g003349mg [Citrus sinensis]
Length=828

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 85/98 (87%), Gaps = 5/98 (5%)
 Frame = +1

Query  298  GVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  477
            GV  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI
Sbjct  17   GVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  71

Query  478  VVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            VVLEGLCRFSVQELSTRGTYYTARI+SL+MTK EMEQV
Sbjct  72   VVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQV  109



>ref|XP_004163979.1| PREDICTED: lon protease homolog 2, peroxisomal-like, partial 
[Cucumis sativus]
Length=816

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +1

Query  289  LSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRV  468
            LS GV +DS DR+ + Q+GTS+S + DGKN QEVI WH+RGVAARAL LSRGVEKPSGRV
Sbjct  1    LSQGVGSDSGDRSSRVQSGTSDSQRVDGKNHQEVIQWHSRGVAARALQLSRGVEKPSGRV  60

Query  469  TYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            TY VVLEGLCRF+VQELSTRGTYYTARI+  +MTK EMEQV
Sbjct  61   TYTVVLEGLCRFTVQELSTRGTYYTARISPSEMTKAEMEQV  101



>ref|XP_001757793.1| predicted protein [Physcomitrella patens]
 gb|EDQ77433.1| predicted protein [Physcomitrella patens]
Length=893

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 112/173 (65%), Gaps = 9/173 (5%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKG-LIGVLPVR  255
            + ++  LP  LAILPFRNKVLLPGAI++IR   P SV+L+EQELWQ+E KG  IGVLP+ 
Sbjct  6    VGDTSALPPVLAILPFRNKVLLPGAIVKIRVNVPASVRLIEQELWQKENKGRFIGVLPLH  65

Query  256  DSAETTT--VAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  429
            D     +  V P    G V  +     + +   S    H  KN  ++I WH RGVAARAL
Sbjct  66   DLHRVISHKVKPA---GTVIKAPGEKERGEIILS---LHSNKNGDDLIQWHPRGVAARAL  119

Query  430  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQ  588
             L + +EK +GRV+YIV+LEG CRF VQEL +  +Y +ARIT LD  + E+EQ
Sbjct  120  ELEQKIEKYTGRVSYIVMLEGWCRFGVQELISTSSYKSARITQLDRNEAEIEQ  172



>ref|XP_010325536.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X2 [Solanum 
lycopersicum]
Length=803

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +1

Query  346  TSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELST  525
            TS+SHK D KNQQEVIHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRF+VQELST
Sbjct  5    TSDSHKLDSKNQQEVIHWHDRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFNVQELST  64

Query  526  RGTYYTARITSLDMTKPEMEQV  591
            RGTYYTARITSLDMTK EME +
Sbjct  65   RGTYYTARITSLDMTKGEMELI  86



>ref|XP_011032007.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Populus euphratica]
Length=842

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +1

Query  298  GVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTY  474
            GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVAARALHLSRGVEKPSGRVTY
Sbjct  27   GVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVAARALHLSRGVEKPSGRVTY  86

Query  475  IVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            IVVLEGLCRF++ EL TRGTYYTARI+ L+MT  E+EQV
Sbjct  87   IVVLEGLCRFNLNELVTRGTYYTARISPLEMTNAELEQV  125



>gb|KEH31578.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=821

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +1

Query  298  GVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  477
            G  TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLSRGVEKPSGRVTY 
Sbjct  7    GAGTDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLSRGVEKPSGRVTYT  66

Query  478  VVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            VVLEGLCRFSV ELSTRG Y+TA+I+SL+MTK EMEQ+
Sbjct  67   VVLEGLCRFSVLELSTRGIYHTAKISSLEMTKIEMEQL  104



>gb|KEH31577.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=825

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +1

Query  307  TDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVL  486
            TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLSRGVEKPSGRVTY VVL
Sbjct  14   TDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLSRGVEKPSGRVTYTVVL  73

Query  487  EGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQV  591
            EGLCRFSV ELSTRG Y+TA+I+SL+MTK EMEQ+
Sbjct  74   EGLCRFSVLELSTRGIYHTAKISSLEMTKIEMEQL  108



>ref|XP_002980173.1| hypothetical protein SELMODRAFT_444435, partial [Selaginella 
moellendorffii]
 gb|EFJ18433.1| hypothetical protein SELMODRAFT_444435, partial [Selaginella 
moellendorffii]
Length=432

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 92/125 (74%), Gaps = 8/125 (6%)
 Frame = +1

Query  94   ELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAETT  273
            ELP RL+I+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD  ++ 
Sbjct  10   ELPPRLSIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDLQQSD  69

Query  274  TVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEK  453
              +P   P   + S  R         ++ K  GK  QE++ WH RGVAARALHLSRG+EK
Sbjct  70   PASPPPPPPPSSSSLPRL--------KARKGLGKQNQELVQWHPRGVAARALHLSRGMEK  121

Query  454  PSGRV  468
            PSGR+
Sbjct  122  PSGRM  126



>ref|XP_002963350.1| hypothetical protein SELMODRAFT_405160 [Selaginella moellendorffii]
 gb|EFJ35221.1| hypothetical protein SELMODRAFT_405160 [Selaginella moellendorffii]
Length=432

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  82   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  258
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRD  64



>ref|XP_002501871.1| lon protease [Micromonas sp. RCC299]
 gb|ACO63129.1| lon protease [Micromonas sp. RCC299]
Length=904

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 78/162 (48%), Gaps = 16/162 (10%)
 Frame = +1

Query  97   LPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQ------REEKGLIGVLPVRD  258
            LP  L+ILP +N++LLP + +++  TSPRSV LV+  L              +GV+P R 
Sbjct  12   LPSTLSILPLKNRILLPSSAMKLLLTSPRSVALVDAILSSTSAGSGHHHSLYVGVVPTRR  71

Query  259  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  438
                 + A   + G++ D+ D            H   G ++ E    H+ G AAR + +S
Sbjct  72   DPRANSNAFAAANGMLDDTDD-------NEDAPHHAGGDHEDERARLHDVGTAARIVQIS  124

Query  439  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLD  564
            R   K S   +Y ++LEG CRF + +L+    +    +  LD
Sbjct  125  R---KDSPVRSYTLLLEGRCRFGLDKLTAVHPFIVGEVRQLD  163



>ref|XP_003057661.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57612.1| predicted protein [Micromonas pusilla CCMP1545]
Length=917

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 85/174 (49%), Gaps = 27/174 (16%)
 Frame = +1

Query  82   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQEL---WQREEKGLIGVLPV  252
            AE   LP  L+ILP ++++LLP + +++  T+P ++ LV+  L   + +     +GV+PV
Sbjct  9    AEPRGLPSTLSILPLKDRILLPSSAMKLVLTTPSALALVDDILGAAYVKPGTLYVGVVPV  68

Query  253  RDSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALH  432
            R  A         S G VT  A +        +ES   +        H H+ G AAR + 
Sbjct  69   RRDAPP-------SAGGVTSGASQL------DAESFDAEDDADDVRAHLHDVGTAARIIQ  115

Query  433  LSRGVEKPSGRV----------TYIVVLEGLCRFSVQELSTRGTYYTARITSLD  564
            ++RG ++P  +           +Y ++LEG CRF + +LS+   +  A +  LD
Sbjct  116  IARG-DRPGMKARSIHWSPYDRSYTLLLEGRCRFELNQLSSTSPFLVAHVRQLD  168



>ref|XP_008364428.1| PREDICTED: uncharacterized protein LOC103428108 [Malus domestica]
Length=452

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +1

Query  76   SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPR  183
            +M ESVELP  L ILPFRNKVLL  AII IRCTSP 
Sbjct  416  NMTESVELPTSLNILPFRNKVLLLSAIIXIRCTSPN  451



>gb|KIG14657.1| ATP-dependent protease La [Enhygromyxa salina]
Length=789

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 71/164 (43%), Gaps = 47/164 (29%)
 Frame = +1

Query  94   ELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAETT  273
            +LP  +++LP RN VL PG+II I    P+SVKL+E+ +    E+ +IG++  R+S    
Sbjct  13   DLPEVVSLLPLRNSVLFPGSIIPIDVGRPKSVKLIEEAIAS--ERPVIGIVMQRESR---  67

Query  274  TVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEK  453
                                    T E    D          H  G A R L + +    
Sbjct  68   ------------------------TEEPGAED---------LHEVGCAVRILKVIK----  90

Query  454  PSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEME  585
               R  Y V+L+G+ R  + +L +   +  AR+T L    PE+E
Sbjct  91   -LARDNYSVILQGVMRIKIDQLVSNEPFLQARVTEL----PEIE  129



>ref|XP_001633523.1| predicted protein [Nematostella vectensis]
 gb|EDO41460.1| predicted protein, partial [Nematostella vectensis]
Length=343

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 81/172 (47%), Gaps = 34/172 (20%)
 Frame = +1

Query  79   MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREE--KGLIGVLPV  252
            MA   +LP ++ +L   +KVLLPG+ +RI      S+++++  L +R+     LIGV+P 
Sbjct  1    MAAKADLPRKIPLLILDDKVLLPGSSMRIAVRDAASIRMIDSRLLRRDSLRSVLIGVVPR  60

Query  253  RDSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALH  432
            +  +ET +                       + + ++  G +  + +     G AA  + 
Sbjct  61   KSKSETLS-----------------------SLDYYQDSGSSFLKTV-----GTAAVVIQ  92

Query  433  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDM-TKPEME  585
            ++ G   P  +  Y +++ GLCRFS+  +     Y  A +T LD+ +K E E
Sbjct  93   VT-GTNWP--KPLYTLLVTGLCRFSIDGIVQAEPYLLADVTQLDLPSKQEAE  141



>gb|ERZ96146.1| hypothetical protein GLOINDRAFT_334534 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78515.1| Pim1p [Rhizophagus irregularis DAOM 197198w]
Length=850

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 76/165 (46%), Gaps = 27/165 (16%)
 Frame = +1

Query  94   ELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELW----QREEKGLIGVLPVR--  255
            ++P  L I+P RNKVLLP A + ++  S  SV+L+ Q ++     +E K +IG +PV   
Sbjct  7    DVPKILPIIPIRNKVLLPSASLVLQVVSKDSVQLL-QRIYRSAENKESKYIIGCVPVHPP  65

Query  256  -----DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAA  420
                 +S +TTT     +P  +T + +R    +    E+     +        H  G AA
Sbjct  66   SYNKLESKDTTT-----APFTLTRNGNRNSTPKKTIEETFNQSIQPSD----LHKFGCAA  116

Query  421  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  555
            R + L R V        +IV +EG+ R  + +      Y  A +T
Sbjct  117  RIVKLERTVN------GFIVRIEGVIRIRIDKYVLERPYLEAEVT  155



>gb|KDE02405.1| hypothetical protein, variant [Microbotryum violaceum p1A1 Lamole]
Length=955

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 29/163 (18%)
 Frame = +1

Query  88   SVELPGRLAILPFRNK-VLLPGAIIRIRCTSPRSVKLVEQELWQREEKG-----LIGVLP  249
            S  +P  L ILP   K VL P  ++ I+  S  SV L++  L + E+       +IGV+P
Sbjct  5    SYNIPTHLPILPLPEKQVLYPSLVLSIQFVSKHSVALLQSVLREAEQNSGNKPLIIGVVP  64

Query  250  VRDSAETTTVAPTL-SPGVVTDSAD--RTPKNQAGTSESHK--HDGKNQQEVIH------  396
            ++D++  TT  P   +P   ++  D  RTP      S++    +  K++  V+H      
Sbjct  65   LKDTSSPTTGPPARPTPNPTSNRRDPYRTPPQSDDESDNQNKSNSAKSRAVVLHKSSAAQ  124

Query  397  -------WHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRF  504
                       GVAAR + L R     SG   +IVVLEGL R 
Sbjct  125  GKPPIADLFEYGVAARIVRLER---LSSG--GFIVVLEGLARI  162



>ref|XP_008309291.1| PREDICTED: lon protease homolog 2, peroxisomal [Cynoglossus semilaevis]
Length=839

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 73/168 (43%), Gaps = 40/168 (24%)
 Frame = +1

Query  76   SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQRE--EKGLIGVLP  249
            S A  +++P RL +L     VLLPG+ +R    SPR+++LV Q L +    +  +IGV+P
Sbjct  2    SSAGGIQIPSRLPLLLTHEGVLLPGSTVRFSVNSPRNMQLVIQRLLRGTSLKSTIIGVIP  61

Query  250  VRDSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  429
                   TT               R P+N             +  E+   H  G A  A+
Sbjct  62   -------TT---------------RDPEN-------------DSDELPTLHKIGTAGIAV  86

Query  430  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTK  573
             +  G   P  +  Y +++ GLCRFSV  +     +  A +  LD T+
Sbjct  87   QVV-GSNWP--KPNYTLLITGLCRFSVSTVLKERPFVLAEVEQLDKTE  131



>ref|XP_005795858.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Xiphophorus 
maculatus]
Length=848

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 71/164 (43%), Gaps = 42/164 (26%)
 Frame = +1

Query  82   AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQRE--EKGLIGVLP-V  252
            A  +++P RL +L     VLLPG+ +R    SPR+++LV Q L +    +  +IGV+P  
Sbjct  4    AGGIQIPNRLPLLLTHEGVLLPGSTVRFSVDSPRNMQLVGQRLLKGTSLKSTIIGVIPNT  63

Query  253  RDSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALH  432
            RD  +              DS    P +Q GT+                   G+A + + 
Sbjct  64   RDPEQ--------------DSDPLPPLHQIGTA-------------------GIAVQVV-  89

Query  433  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLD  564
               G   P  +  Y +++ GLCRF V  L T   +  A +  LD
Sbjct  90   ---GSNWP--KPHYTLLITGLCRFRVSSLLTERPFVLAEVEQLD  128



>gb|KDE02404.1| hypothetical protein MVLG_07037 [Microbotryum violaceum p1A1 
Lamole]
Length=1013

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 29/163 (18%)
 Frame = +1

Query  88   SVELPGRLAILPFRNK-VLLPGAIIRIRCTSPRSVKLVEQELWQREEKG-----LIGVLP  249
            S  +P  L ILP   K VL P  ++ I+  S  SV L++  L + E+       +IGV+P
Sbjct  5    SYNIPTHLPILPLPEKQVLYPSLVLSIQFVSKHSVALLQSVLREAEQNSGNKPLIIGVVP  64

Query  250  VRDSAETTTVAPTL-SPGVVTDSAD--RTPKNQAGTSESHK--HDGKNQQEVIH------  396
            ++D++  TT  P   +P   ++  D  RTP      S++    +  K++  V+H      
Sbjct  65   LKDTSSPTTGPPARPTPNPTSNRRDPYRTPPQSDDESDNQNKSNSAKSRAVVLHKSSAAQ  124

Query  397  -------WHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRF  504
                       GVAAR + L R     SG   +IVVLEGL R 
Sbjct  125  GKPPIADLFEYGVAARIVRLER---LSSG--GFIVVLEGLARI  162



>ref|XP_002446246.1| hypothetical protein SORBIDRAFT_06g009066 [Sorghum bicolor]
 gb|EES10574.1| hypothetical protein SORBIDRAFT_06g009066 [Sorghum bicolor]
Length=90

 Score = 43.9 bits (102),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  493  LCRFSVQELSTRGTYYTARITSLDMTK  573
            LCRF+++ELS RG Y+ AR++ LDMTK
Sbjct  63   LCRFNIEELSARGPYHVARVSRLDMTK  89


 Score = 26.9 bits (58),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (55%), Gaps = 0/31 (0%)
 Frame = +2

Query  374  KISRKLFTGITEELLLGLCISQEEWKNQVGG  466
            K  +  FTGI  ELL  L    E W++QV G
Sbjct  26   KKGKDPFTGIAGELLPELYTFPEGWRSQVEG  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160