BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS158G07

Length=476
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006451102.1|  hypothetical protein CICLE_v100107081mg            158   2e-45   
emb|CDP03355.1|  unnamed protein product                                162   2e-43   Coffea canephora [robusta coffee]
gb|KDP32304.1|  hypothetical protein JCGZ_13229                         160   9e-43   Jatropha curcas
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...    160   1e-42   Solanum lycopersicum
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...    159   3e-42   Solanum tuberosum [potatoes]
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...    156   5e-42   
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...    157   6e-42   Solanum tuberosum [potatoes]
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...    157   6e-42   Nicotiana tomentosiformis
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...    158   7e-42   Nicotiana sylvestris
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...    156   8e-42   Sesamum indicum [beniseed]
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...    156   1e-41   
gb|KJB06895.1|  hypothetical protein B456_001G004000                    155   1e-41   Gossypium raimondii
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...    156   2e-41   
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    156   2e-41   
ref|XP_007013226.1|  Leucine-rich repeat family protein                 156   2e-41   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                       156   4e-41   Cucumis sativus [cucumbers]
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4           154   4e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB54162.1|  hypothetical protein B456_009G023700                    154   4e-41   Gossypium raimondii
gb|KJB06894.1|  hypothetical protein B456_001G004000                    154   5e-41   Gossypium raimondii
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...    154   5e-41   Nicotiana tomentosiformis
gb|KJB06897.1|  hypothetical protein B456_001G004000                    155   5e-41   Gossypium raimondii
emb|CDX93014.1|  BnaA03g37360D                                          153   9e-41   
gb|KJB06896.1|  hypothetical protein B456_001G004000                    154   9e-41   Gossypium raimondii
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g             154   1e-40   Phaseolus vulgaris [French bean]
ref|XP_008361263.1|  PREDICTED: leucine-rich repeat extensin-like...    148   2e-40   
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    153   2e-40   Populus euphratica
gb|KJB54163.1|  hypothetical protein B456_009G023700                    154   3e-40   Gossypium raimondii
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...    153   4e-40   Fragaria vesca subsp. vesca
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4        154   4e-40   Morus notabilis
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    152   4e-40   Tarenaya hassleriana [spider flower]
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g             151   4e-40   
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...    153   5e-40   Vitis vinifera
ref|XP_003532491.1|  PREDICTED: leucine-rich repeat extensin-like...    153   5e-40   Glycine max [soybeans]
ref|XP_002885650.1|  predicted protein                                  151   6e-40   
emb|CDX94809.1|  BnaC03g43790D                                          151   7e-40   
ref|XP_010532845.1|  PREDICTED: leucine-rich repeat extensin-like...    152   7e-40   Tarenaya hassleriana [spider flower]
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg             152   1e-39   
ref|XP_009132101.1|  PREDICTED: leucine-rich repeat extensin-like...    152   1e-39   Brassica rapa
ref|XP_010050506.1|  PREDICTED: leucine-rich repeat extensin-like...    148   2e-39   Eucalyptus grandis [rose gum]
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...    152   2e-39   Brassica rapa
ref|XP_004148723.1|  PREDICTED: leucine-rich repeat extensin-like...    150   5e-39   
gb|KGN65364.1|  hypothetical protein Csa_1G383520                       150   7e-39   Cucumis sativus [cucumbers]
ref|XP_004170319.1|  PREDICTED: leucine-rich repeat extensin-like...    150   7e-39   
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g             148   8e-39   Populus trichocarpa [western balsam poplar]
ref|XP_008463374.1|  PREDICTED: leucine-rich repeat extensin-like...    150   8e-39   Cucumis melo [Oriental melon]
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...    146   2e-38   
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...    148   3e-38   
ref|XP_010688564.1|  PREDICTED: leucine-rich repeat extensin-like...    146   5e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...    147   1e-37   
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg             146   1e-37   Capsella rubella
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...    146   2e-37   Cicer arietinum [garbanzo]
emb|CAB37452.1|  extensin-like protein                                  145   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...    145   4e-37   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...    144   4e-37   Prunus mume [ume]
ref|NP_193602.4|  leucine-rich repeat extensin-like protein 5           145   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...    143   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_010434501.1|  PREDICTED: leucine-rich repeat extensin-like...    145   6e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010434500.1|  PREDICTED: leucine-rich repeat extensin-like...    144   7e-37   
gb|KEH27082.1|  LRR extensin-like protein                               144   9e-37   Medicago truncatula
ref|XP_003620502.1|  Extensin-like protein                              144   9e-37   
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    142   1e-36   
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...    144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010439825.1|  PREDICTED: leucine-rich repeat extensin-like...    144   2e-36   
ref|XP_002867981.1|  hypothetical protein ARALYDRAFT_492992             143   3e-36   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g             140   6e-36   
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...    139   1e-35   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    140   3e-35   Elaeis guineensis
ref|XP_008786172.1|  PREDICTED: leucine-rich repeat extensin-like...    139   4e-35   
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...    138   5e-35   Phoenix dactylifera
ref|XP_008365636.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    137   6e-35   
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg            132   1e-33   
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...    135   2e-33   Nelumbo nucifera [Indian lotus]
emb|CDY42885.1|  BnaC08g46890D                                          132   2e-33   Brassica napus [oilseed rape]
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg            132   4e-33   
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3           134   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003524389.2|  PREDICTED: leucine-rich repeat extensin-like...    132   7e-33   
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg            130   9e-33   
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...    130   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925096.1|  PREDICTED: leucine-rich repeat extensin-like...    130   1e-32   
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                    132   2e-32   Arabis alpina [alpine rockcress]
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...    130   3e-32   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051             130   3e-32   
ref|XP_007013716.1|  Leucine-rich repeat family protein                 130   3e-32   
gb|KHN21547.1|  Leucine-rich repeat extensin-like protein 5             129   1e-31   Glycine soja [wild soybean]
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...    129   2e-31   Camelina sativa [gold-of-pleasure]
emb|CBI28097.3|  unnamed protein product                                122   2e-31   Vitis vinifera
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...    129   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...    129   3e-31   
ref|XP_007160348.1|  hypothetical protein PHAVU_002G314200g             128   5e-31   Phaseolus vulgaris [French bean]
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...    127   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...    125   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS61338.1|  hypothetical protein M569_13456                         124   9e-31   Genlisea aurea
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...    127   9e-31   Camelina sativa [gold-of-pleasure]
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                   125   1e-30   Citrus sinensis [apfelsine]
ref|XP_009377376.1|  PREDICTED: leucine-rich repeat extensin-like...    127   1e-30   
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg             124   2e-30   Citrus clementina [clementine]
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...    124   3e-30   Citrus sinensis [apfelsine]
ref|XP_008378297.1|  PREDICTED: leucine-rich repeat extensin-like...    124   6e-30   
ref|XP_008357497.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    124   6e-30   
ref|XP_008337109.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    120   4e-29   
ref|XP_009348443.1|  PREDICTED: leucine-rich repeat extensin-like...    122   7e-29   Pyrus x bretschneideri [bai li]
ref|XP_008347715.1|  PREDICTED: leucine-rich repeat extensin-like...    119   8e-29   
ref|XP_010049719.1|  PREDICTED: leucine-rich repeat extensin-like...    120   3e-28   Eucalyptus grandis [rose gum]
ref|XP_006842252.1|  hypothetical protein AMTR_s00078p00197410          120   3e-28   
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                    117   3e-27   Arabis alpina [alpine rockcress]
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...    114   1e-26   Prunus mume [ume]
ref|XP_004292960.1|  PREDICTED: leucine-rich repeat extensin-like...    113   3e-26   Fragaria vesca subsp. vesca
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g           109   4e-25   
ref|XP_011026539.1|  PREDICTED: leucine-rich repeat extensin-like...    108   1e-24   Populus euphratica
ref|XP_011026538.1|  PREDICTED: leucine-rich repeat extensin-like...    108   2e-24   Populus euphratica
gb|KJB27056.1|  hypothetical protein B456_004G274900                    106   5e-24   Gossypium raimondii
ref|XP_002324259.1|  hypothetical protein POPTR_0018s01010g             105   1e-23   
ref|XP_009613983.1|  PREDICTED: leucine-rich repeat extensin-like...    105   2e-23   Nicotiana tomentosiformis
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...    106   2e-23   
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...    104   3e-23   Populus euphratica
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...    104   3e-23   Populus euphratica
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...    104   3e-23   Populus euphratica
ref|XP_008366033.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    104   2e-22   
ref|XP_008776836.1|  PREDICTED: leucine-rich repeat extensin-like...    103   2e-22   
ref|XP_011081863.1|  PREDICTED: leucine-rich repeat extensin-like...    100   1e-21   Sesamum indicum [beniseed]
ref|XP_002455880.1|  hypothetical protein SORBIDRAFT_03g026730          100   1e-21   Sorghum bicolor [broomcorn]
ref|XP_009798822.1|  PREDICTED: leucine-rich repeat extensin-like...    100   2e-21   Nicotiana sylvestris
ref|XP_008458675.1|  PREDICTED: pollen-specific leucine-rich repe...    100   2e-21   Cucumis melo [Oriental melon]
ref|XP_008225431.1|  PREDICTED: pollen-specific leucine-rich repe...    100   3e-21   
ref|XP_011005677.1|  PREDICTED: pollen-specific leucine-rich repe...    100   4e-21   Populus euphratica
ref|XP_011001177.1|  PREDICTED: pollen-specific leucine-rich repe...    100   5e-21   Populus euphratica
ref|XP_006361150.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    5e-21   Solanum tuberosum [potatoes]
ref|XP_006384469.1|  hypothetical protein POPTR_0004s153601g          98.6    8e-21   
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...  99.0    8e-21   Cicer arietinum [garbanzo]
ref|XP_006848210.1|  hypothetical protein AMTR_s00029p00242610        95.9    9e-21   
ref|XP_008458676.1|  PREDICTED: pollen-specific leucine-rich repe...  98.6    9e-21   
ref|XP_004173261.1|  PREDICTED: pollen-specific leucine-rich repe...  97.1    2e-20   
tpg|DAA58808.1|  TPA: leucine-rich repeat (LRR) family protein        97.8    2e-20   
emb|CDO97126.1|  unnamed protein product                              97.1    3e-20   Coffea canephora [robusta coffee]
ref|XP_010107567.1|  Leucine-rich repeat extensin-like protein 2      96.7    6e-20   Morus notabilis
gb|KFK40046.1|  hypothetical protein AALP_AA3G322800                  96.7    7e-20   Arabis alpina [alpine rockcress]
gb|KGN45680.1|  hypothetical protein Csa_6G006180                     95.9    1e-19   Cucumis sativus [cucumbers]
gb|KGN45681.1|  hypothetical protein Csa_6G006190                     96.3    1e-19   Cucumis sativus [cucumbers]
ref|XP_009119384.1|  PREDICTED: pollen-specific leucine-rich repe...  96.3    1e-19   Brassica rapa
ref|XP_010466040.1|  PREDICTED: pollen-specific leucine-rich repe...  95.9    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002519151.1|  protein binding protein, putative                95.5    2e-19   Ricinus communis
ref|XP_004173016.1|  PREDICTED: pollen-specific leucine-rich repe...  92.4    2e-19   
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg              93.6    2e-19   Erythranthe guttata [common monkey flower]
ref|NP_179188.1|  pollen-specific leucine-rich repeat extensin-li...  95.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79255.1|  hypothetical protein B456_013G040300                  94.4    2e-19   Gossypium raimondii
ref|XP_010251729.1|  PREDICTED: pollen-specific leucine-rich repe...  95.1    2e-19   
ref|XP_006480071.1|  PREDICTED: pollen-specific leucine-rich repe...  95.1    3e-19   Citrus sinensis [apfelsine]
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg              93.2    3e-19   Erythranthe guttata [common monkey flower]
gb|KJB74832.1|  hypothetical protein B456_012G009700                  94.7    3e-19   Gossypium raimondii
ref|XP_007200697.1|  hypothetical protein PRUPE_ppa000722m2g          94.4    3e-19   
ref|XP_008458201.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...  94.4    3e-19   
ref|XP_006406541.1|  hypothetical protein EUTSA_v10022433mg           92.0    4e-19   
ref|XP_006409498.1|  hypothetical protein EUTSA_v10023190mg           93.6    4e-19   
ref|XP_004242113.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    4e-19   Solanum lycopersicum
ref|XP_010467332.1|  PREDICTED: pollen-specific leucine-rich repe...  94.0    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    5e-19   
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    6e-19   
ref|XP_004138582.1|  PREDICTED: pollen-specific leucine-rich repe...  93.6    6e-19   
ref|XP_006417273.1|  hypothetical protein EUTSA_v10006975mg           93.6    8e-19   Eutrema salsugineum [saltwater cress]
ref|XP_010461787.1|  PREDICTED: pollen-specific leucine-rich repe...  94.0    8e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002885986.1|  predicted protein                                93.6    8e-19   
emb|CDY54073.1|  BnaA07g36350D                                        93.2    9e-19   Brassica napus [oilseed rape]
ref|XP_010064140.1|  PREDICTED: pollen-specific leucine-rich repe...  92.8    9e-19   Eucalyptus grandis [rose gum]
ref|XP_009136284.1|  PREDICTED: pollen-specific leucine-rich repe...  93.2    1e-18   
ref|XP_006372265.1|  hypothetical protein POPTR_0018s14790g           91.7    1e-18   
ref|XP_010999749.1|  PREDICTED: pollen-specific leucine-rich repe...  93.2    1e-18   Populus euphratica
ref|XP_010520859.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_010507380.1|  PREDICTED: pollen-specific leucine-rich repe...  93.2    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010507385.1|  PREDICTED: pollen-specific leucine-rich repe...  93.2    1e-18   
ref|XP_006379216.1|  hypothetical protein POPTR_0009s11130g           93.2    2e-18   
ref|XP_011018198.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  92.0    2e-18   Populus euphratica
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...  92.8    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487832.1|  PREDICTED: pollen-specific leucine-rich repe...  92.8    2e-18   Camelina sativa [gold-of-pleasure]
ref|NP_175372.1|  Leucine-rich repeat family protein                  92.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2         92.4    2e-18   
ref|XP_004290381.1|  PREDICTED: pollen-specific leucine-rich repe...  91.7    2e-18   Fragaria vesca subsp. vesca
ref|XP_004138583.1|  PREDICTED: pollen-specific leucine-rich repe...  91.3    3e-18   
gb|KJB74831.1|  hypothetical protein B456_012G009700                  91.3    3e-18   Gossypium raimondii
emb|CDY26536.1|  BnaA09g47410D                                        91.7    3e-18   Brassica napus [oilseed rape]
ref|XP_007017392.1|  Leucine-rich repeat family protein               92.0    3e-18   
emb|CDX89681.1|  BnaC03g45950D                                        92.0    3e-18   
ref|XP_009118084.1|  PREDICTED: pollen-specific leucine-rich repe...  91.7    3e-18   Brassica rapa
gb|AID60115.1|  leucine-rich repeat (LRR) family protein              91.7    3e-18   Brassica napus [oilseed rape]
ref|XP_006300291.1|  hypothetical protein CARUB_v100136950mg          89.7    4e-18   
ref|XP_007014601.1|  Leucine-rich repeat/extensin 2                   91.7    4e-18   
ref|XP_009108764.1|  PREDICTED: pollen-specific leucine-rich repe...  91.3    4e-18   Brassica rapa
emb|CDY51948.1|  BnaA08g11700D                                        91.3    4e-18   Brassica napus [oilseed rape]
ref|XP_007042323.1|  Leucine-rich repeat family protein               91.3    5e-18   
ref|XP_006494306.1|  PREDICTED: pollen-specific leucine-rich repe...  91.7    5e-18   Citrus sinensis [apfelsine]
ref|XP_006303848.1|  hypothetical protein CARUB_v10012584mg           91.3    5e-18   Capsella rubella
emb|CDY53352.1|  BnaA06g38270D                                        90.9    6e-18   Brassica napus [oilseed rape]
gb|KDP43798.1|  hypothetical protein JCGZ_23006                       91.3    6e-18   Jatropha curcas
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg           91.3    6e-18   
emb|CDY12948.1|  BnaA09g13260D                                        90.9    6e-18   Brassica napus [oilseed rape]
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010040127.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    7e-18   Eucalyptus grandis [rose gum]
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    7e-18   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...  90.9    7e-18   Brassica rapa
ref|XP_009350755.1|  PREDICTED: pollen-specific leucine-rich repe...  90.5    7e-18   
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g           89.7    7e-18   
emb|CDY02276.1|  BnaA03g38910D                                        90.5    7e-18   
gb|EPS72402.1|  hypothetical protein M569_02357                       88.6    8e-18   Genlisea aurea
emb|CDY51859.1|  BnaC03g77110D                                        90.5    8e-18   Brassica napus [oilseed rape]
ref|XP_003629650.1|  Receptor-like protein kinase                     90.5    8e-18   
emb|CDY18563.1|  BnaA01g26320D                                        90.1    9e-18   Brassica napus [oilseed rape]
ref|XP_009345516.1|  PREDICTED: pollen-specific leucine-rich repe...  90.5    9e-18   
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099           90.5    9e-18   
ref|XP_002885290.1|  hypothetical protein ARALYDRAFT_479420           90.9    9e-18   
ref|XP_010669462.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    9e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010647882.1|  PREDICTED: pollen-specific leucine-rich repe...  90.5    1e-17   Vitis vinifera
emb|CBI32495.3|  unnamed protein product                              90.5    1e-17   Vitis vinifera
gb|KJB77687.1|  hypothetical protein B456_012G150700                  89.7    1e-17   Gossypium raimondii
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg              88.2    1e-17   Erythranthe guttata [common monkey flower]
gb|AGT16383.1|  hypothetical protein SHCRBa_052_I12_F_230             90.1    1e-17   Saccharum hybrid cultivar R570
ref|XP_010530870.1|  PREDICTED: pollen-specific leucine-rich repe...  90.1    1e-17   Tarenaya hassleriana [spider flower]
ref|NP_001043463.1|  Os01g0594300                                     89.7    1e-17   
emb|CDX95474.1|  BnaC01g33660D                                        90.1    1e-17   
gb|KJB47441.1|  hypothetical protein B456_008G026700                  89.7    1e-17   Gossypium raimondii
ref|XP_010533784.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    1e-17   Tarenaya hassleriana [spider flower]
dbj|BAB91812.1|  extensin precursor-like                              89.7    1e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CDY19550.1|  BnaC09g13530D                                        90.1    1e-17   Brassica napus [oilseed rape]
ref|XP_008225416.1|  PREDICTED: pollen-specific leucine-rich repe...  90.1    1e-17   
ref|XP_010533785.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    1e-17   Tarenaya hassleriana [spider flower]
gb|AAM13864.1|  unknown protein                                       90.1    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342607.1|  PREDICTED: pollen-specific leucine-rich repe...  89.7    1e-17   Solanum tuberosum [potatoes]
ref|NP_195123.1|  pollen-specific leucine-rich repeat extensin-li...  89.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118117.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    1e-17   Brassica rapa
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610        89.0    1e-17   
ref|XP_010423784.1|  PREDICTED: pollen-specific leucine-rich repe...  89.7    2e-17   
ref|XP_002867142.1|  hypothetical protein ARALYDRAFT_491276           89.4    2e-17   
ref|XP_006300262.1|  hypothetical protein CARUB_v100151920mg          89.4    2e-17   
ref|XP_003630813.1|  Extensin-like protein                            89.4    2e-17   Medicago truncatula
ref|XP_011460368.1|  PREDICTED: pollen-specific leucine-rich repe...  88.6    2e-17   Fragaria vesca subsp. vesca
ref|XP_002516600.1|  serine-threonine protein kinase, plant-type,...  88.6    2e-17   Ricinus communis
ref|XP_010664614.1|  PREDICTED: pollen-specific leucine-rich repe...  88.6    2e-17   Vitis vinifera
ref|XP_008361641.1|  PREDICTED: pollen-specific leucine-rich repe...  89.4    2e-17   
ref|XP_006285576.1|  hypothetical protein CARUB_v10007020mg           89.0    3e-17   Capsella rubella
ref|XP_011019927.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    3e-17   Populus euphratica
emb|CDY15964.1|  BnaC08g41590D                                        88.6    3e-17   Brassica napus [oilseed rape]
ref|XP_004501605.1|  PREDICTED: pollen-specific leucine-rich repe...  89.4    3e-17   Cicer arietinum [garbanzo]
ref|XP_010489184.1|  PREDICTED: pollen-specific leucine-rich repe...  89.0    3e-17   
ref|XP_010104364.1|  Pollen-specific leucine-rich repeat extensin...  89.0    3e-17   
gb|KDO52192.1|  hypothetical protein CISIN_1g035831mg                 87.4    3e-17   Citrus sinensis [apfelsine]
ref|XP_006393251.1|  hypothetical protein EUTSA_v10012214mg           89.0    3e-17   
ref|XP_009402787.1|  PREDICTED: pollen-specific leucine-rich repe...  89.0    4e-17   
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1         88.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27830.1|  hypothetical protein AALP_AA8G435400                  87.4    4e-17   Arabis alpina [alpine rockcress]
gb|ADA62506.1|  c-myc tagged LRX1                                     88.6    4e-17   synthetic construct
ref|XP_010437689.1|  PREDICTED: pollen-specific leucine-rich repe...  88.6    5e-17   
gb|ABA99464.2|  extensin-like domain containing protein, putative...  87.8    5e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010437692.1|  PREDICTED: pollen-specific leucine-rich repe...  88.2    6e-17   
ref|XP_004151743.1|  PREDICTED: pollen-specific leucine-rich repe...  84.7    6e-17   
ref|XP_010437693.1|  PREDICTED: pollen-specific leucine-rich repe...  87.8    6e-17   
ref|XP_006304470.1|  hypothetical protein CARUB_v10011166mg           87.8    7e-17   Capsella rubella
ref|XP_006394807.1|  hypothetical protein EUTSA_v10004209mg           86.7    7e-17   Eutrema salsugineum [saltwater cress]
ref|XP_008224557.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    7e-17   Prunus mume [ume]
ref|XP_006473926.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    7e-17   Citrus sinensis [apfelsine]
emb|CDX69018.1|  BnaC01g04350D                                        87.4    8e-17   
ref|XP_002875655.1|  hypothetical protein ARALYDRAFT_347509           87.0    8e-17   
ref|XP_006375015.1|  hypothetical protein POPTR_0014s03600g           86.7    8e-17   
ref|XP_006453735.1|  hypothetical protein CICLE_v10010678mg           87.4    8e-17   
ref|XP_010251730.1|  PREDICTED: pollen-specific leucine-rich repe...  87.4    8e-17   Nelumbo nucifera [Indian lotus]
gb|KEH40754.1|  pollen-specific LRR extensin-like protein             87.4    9e-17   Medicago truncatula
ref|XP_007214112.1|  hypothetical protein PRUPE_ppa017121mg           87.4    9e-17   
emb|CDY53036.1|  BnaC03g73850D                                        87.8    1e-16   Brassica napus [oilseed rape]
ref|XP_010256147.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    1e-16   Nelumbo nucifera [Indian lotus]
ref|NP_188532.2|  pollen-specific leucine-rich repeat extensin-li...  87.4    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009342422.1|  PREDICTED: pollen-specific leucine-rich repe...  87.4    1e-16   
ref|XP_010479383.1|  PREDICTED: pollen-specific leucine-rich repe...  87.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010927122.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    1e-16   Elaeis guineensis
ref|XP_006412291.1|  hypothetical protein EUTSA_v100245901mg          87.0    1e-16   
ref|XP_007136648.1|  hypothetical protein PHAVU_009G062000g           87.0    1e-16   Phaseolus vulgaris [French bean]
gb|KDP27758.1|  hypothetical protein JCGZ_19787                       87.0    1e-16   Jatropha curcas
emb|CDY31235.1|  BnaC08g15300D                                        87.0    1e-16   Brassica napus [oilseed rape]
ref|XP_010655031.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    1e-16   
ref|NP_197937.1|  leucine-rich repeat extensin-like protein 7         85.9    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889910.1|  hypothetical protein ARALYDRAFT_312231           86.7    1e-16   
ref|XP_010096273.1|  Pollen-specific leucine-rich repeat extensin...  87.0    2e-16   Morus notabilis
ref|XP_009419628.1|  PREDICTED: pollen-specific leucine-rich repe...  86.7    2e-16   
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    2e-16   
ref|NP_001150408.1|  receptor-like protein kinase precursor           85.1    2e-16   
gb|EYU28282.1|  hypothetical protein MIMGU_mgv1a024954mg              82.4    2e-16   
gb|ACL53978.1|  unknown                                               85.1    2e-16   
ref|XP_002443305.1|  hypothetical protein SORBIDRAFT_08g017290        85.9    2e-16   
ref|XP_004964077.1|  PREDICTED: pollen-specific leucine-rich repe...  86.7    2e-16   
emb|CDY16503.1|  BnaA08g02640D                                        86.7    2e-16   
ref|XP_010500490.1|  PREDICTED: pollen-specific leucine-rich repe...  86.7    2e-16   
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    2e-16   
ref|XP_008796915.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    2e-16   
emb|CDY64248.1|  BnaCnng43540D                                        86.3    2e-16   
ref|NP_001131493.1|  leucine-rich repeat (LRR) family protein pre...  85.1    2e-16   
ref|XP_010432489.1|  PREDICTED: pollen-specific leucine-rich repe...  86.3    2e-16   
ref|XP_007225572.1|  hypothetical protein PRUPE_ppa019759m1g          85.5    2e-16   
ref|XP_009107296.1|  PREDICTED: pollen-specific leucine-rich repe...  86.3    2e-16   
ref|XP_006289956.1|  hypothetical protein CARUB_v10003584mg           85.1    3e-16   
ref|XP_009136040.1|  PREDICTED: pollen-specific leucine-rich repe...  86.3    3e-16   
ref|XP_008802123.1|  PREDICTED: pollen-specific leucine-rich repe...  85.5    3e-16   
ref|XP_010424321.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    3e-16   
ref|XP_010554947.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    4e-16   
gb|KFK39231.1|  hypothetical protein AALP_AA3G216900                  85.9    4e-16   
ref|XP_009385321.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    5e-16   
ref|XP_006489595.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    5e-16   
ref|XP_009622388.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  83.6    6e-16   
gb|KDO74484.1|  hypothetical protein CISIN_1g045950mg                 83.6    6e-16   
gb|KFK36007.1|  hypothetical protein AALP_AA4G065700                  85.1    6e-16   
ref|XP_004968426.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    7e-16   
ref|XP_002872172.1|  leucine-rich repeat family protein               84.0    7e-16   
ref|XP_009390486.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    7e-16   
ref|XP_006420010.1|  hypothetical protein CICLE_v10005037mg           83.6    7e-16   
ref|XP_003565428.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    7e-16   
ref|XP_002451219.1|  hypothetical protein SORBIDRAFT_05g025950        84.7    7e-16   
ref|XP_006851043.1|  hypothetical protein AMTR_s00025p00231840        81.3    8e-16   
ref|XP_002440709.1|  hypothetical protein SORBIDRAFT_09g005520        83.6    8e-16   
dbj|BAJ85515.1|  predicted protein                                    83.2    8e-16   
ref|XP_010527734.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    9e-16   
gb|KFK40601.1|  hypothetical protein AALP_AA2G016700                  84.7    9e-16   
gb|EEE53361.1|  hypothetical protein OsJ_36396                        84.3    1e-15   
ref|XP_002279192.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    1e-15   
ref|XP_010493816.1|  PREDICTED: leucine-rich repeat extensin-like...  83.2    1e-15   
ref|XP_008663867.1|  PREDICTED: pollen-specific leucine-rich repe...  84.3    1e-15   
ref|XP_010454895.1|  PREDICTED: leucine-rich repeat extensin-like...  83.2    1e-15   
ref|XP_004498175.1|  PREDICTED: pollen-specific leucine-rich repe...  84.3    1e-15   
ref|XP_008371522.1|  PREDICTED: pollen-specific leucine-rich repe...  83.6    1e-15   
ref|XP_009385615.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    1e-15   
ref|XP_006584319.1|  PREDICTED: pollen-specific leucine-rich repe...  84.0    1e-15   
ref|XP_003568808.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    1e-15   
emb|CDM81891.1|  unnamed protein product                              83.6    1e-15   
gb|AAD55979.1|AF159296_1  extensin-like protein                       84.0    1e-15   
gb|KJB14547.1|  hypothetical protein B456_002G130500                  83.6    2e-15   
ref|XP_004230831.1|  PREDICTED: pollen-specific leucine-rich repe...  84.0    2e-15   
ref|XP_004960846.1|  PREDICTED: leucine-rich repeat extensin-like...  82.4    2e-15   
gb|KFK30023.1|  hypothetical protein AALP_AA7G207900                  83.6    2e-15   
ref|XP_009773829.1|  PREDICTED: leucine-rich repeat extensin-like...  82.0    2e-15   
ref|XP_010921838.1|  PREDICTED: pollen-specific leucine-rich repe...  82.8    2e-15   
gb|AFW56506.1|  leucine-rich repeat (LRR) family protein              84.0    2e-15   
ref|XP_009616761.1|  PREDICTED: pollen-specific leucine-rich repe...  83.2    2e-15   
ref|XP_006346494.1|  PREDICTED: pollen-specific leucine-rich repe...  83.6    2e-15   
ref|XP_003562088.1|  PREDICTED: leucine-rich repeat extensin-like...  82.0    2e-15   
ref|XP_006582471.1|  PREDICTED: pollen-specific leucine-rich repe...  82.8    2e-15   
ref|XP_009110677.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    2e-15   
gb|EMS47614.1|  Leucine-rich repeat extensin-like protein 4           81.3    2e-15   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...  83.6    2e-15   
ref|NP_001066960.1|  Os12g0542200                                     83.6    2e-15   
emb|CDY21028.1|  BnaA08g24970D                                        83.2    3e-15   
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...  83.2    3e-15   
ref|XP_009376329.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    3e-15   
ref|XP_010938335.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  81.6    3e-15   
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...  83.2    3e-15   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...  83.2    3e-15   
emb|CDY49264.1|  BnaA03g50770D                                        82.8    3e-15   
ref|XP_010525682.1|  PREDICTED: pollen-specific leucine-rich repe...  83.2    3e-15   
ref|XP_008236716.1|  PREDICTED: pollen-specific leucine-rich repe...  83.2    3e-15   
gb|KHN37158.1|  Pollen-specific leucine-rich repeat extensin-like...  82.8    4e-15   
gb|AGT17388.1|  hypothetical protein SHCRBa_176_L06_F_110             82.4    4e-15   
gb|AGT16299.1|  hypothetical protein SHCRBa_026_P08_R_80              82.4    4e-15   
ref|XP_008380620.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  82.8    4e-15   
ref|XP_002514492.1|  LRX2, putative                                   82.8    4e-15   
emb|CDY49265.1|  BnaA03g50780D                                        82.4    4e-15   
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g           80.5    5e-15   
ref|XP_009415697.1|  PREDICTED: leucine-rich repeat extensin-like...  82.4    5e-15   
ref|XP_009801066.1|  PREDICTED: pollen-specific leucine-rich repe...  81.6    5e-15   
dbj|BAK06060.1|  predicted protein                                    82.4    6e-15   
ref|XP_011030760.1|  PREDICTED: pollen-specific leucine-rich repe...  81.6    7e-15   
emb|CDP14813.1|  unnamed protein product                              80.5    8e-15   
ref|XP_009800281.1|  PREDICTED: pollen-specific leucine-rich repe...  81.6    8e-15   
ref|XP_006360809.1|  PREDICTED: leucine-rich repeat extensin-like...  80.1    8e-15   
ref|XP_011030644.1|  PREDICTED: leucine-rich repeat extensin-like...  80.5    8e-15   
ref|XP_004247590.1|  PREDICTED: leucine-rich repeat extensin-like...  80.5    8e-15   
gb|KEH43815.1|  LRR amino-terminal domain protein                     78.6    9e-15   
ref|XP_009408506.1|  PREDICTED: leucine-rich repeat extensin-like...  80.1    1e-14   
ref|XP_002455064.1|  hypothetical protein SORBIDRAFT_03g003730        80.9    1e-14   
gb|AGT16233.1|  hypothetical protein SHCRBa_161_O13_R_110             81.6    1e-14   
ref|XP_008677910.1|  PREDICTED: pollen-specific leucine-rich repe...  81.6    1e-14   
gb|AAD55980.2|AF159297_1  extensin-like protein                       81.6    1e-14   
ref|XP_009775306.1|  PREDICTED: pollen-specific leucine-rich repe...  81.6    1e-14   
gb|KDP40220.1|  hypothetical protein JCGZ_02218                       79.7    1e-14   
emb|CDX88190.1|  BnaA06g27810D                                        80.1    1e-14   
ref|XP_010447169.1|  PREDICTED: pollen-specific leucine-rich repe...  81.3    1e-14   
ref|XP_009151086.1|  PREDICTED: leucine-rich repeat extensin-like...  80.1    1e-14   
gb|KJB79256.1|  hypothetical protein B456_013G040400                  80.5    1e-14   
ref|XP_010437688.1|  PREDICTED: pollen-specific leucine-rich repe...  81.3    1e-14   
ref|NP_001170555.1|  uncharacterized protein LOC100384576 precursor   80.1    2e-14   
ref|XP_009138254.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    2e-14   
ref|XP_009389012.1|  PREDICTED: leucine-rich repeat extensin-like...  79.3    2e-14   
gb|KJB72347.1|  hypothetical protein B456_011G172700                  79.3    2e-14   
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...  80.5    2e-14   
ref|XP_009112175.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    2e-14   
ref|XP_009351253.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    2e-14   
ref|XP_010024229.1|  PREDICTED: leucine-rich repeat extensin-like...  79.0    2e-14   
ref|XP_004979883.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    3e-14   
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...  80.1    3e-14   
ref|XP_009606354.1|  PREDICTED: pollen-specific leucine-rich repe...  80.1    3e-14   
ref|XP_009413897.1|  PREDICTED: leucine-rich repeat extensin-like...  78.6    3e-14   
ref|XP_008458674.1|  PREDICTED: pollen-specific leucine-rich repe...  77.8    3e-14   
ref|XP_006849391.1|  hypothetical protein AMTR_s00160p00027170        78.6    3e-14   
ref|XP_006356596.1|  PREDICTED: pollen-specific leucine-rich repe...  80.1    3e-14   
ref|XP_003523588.1|  PREDICTED: pollen-specific leucine-rich repe...  79.3    4e-14   
ref|XP_009351868.1|  PREDICTED: pollen-specific leucine-rich repe...  79.7    4e-14   
emb|CDP14269.1|  unnamed protein product                              79.7    4e-14   
ref|XP_006480069.1|  PREDICTED: pollen-specific leucine-rich repe...  79.7    5e-14   
gb|KDP40221.1|  hypothetical protein JCGZ_02219                       78.6    5e-14   
ref|XP_008665106.1|  PREDICTED: leucine-rich repeat extensin-like...  78.2    5e-14   
ref|XP_002517082.1|  serine-threonine protein kinase, plant-type,...  77.8    5e-14   
ref|XP_010447991.1|  PREDICTED: pollen-specific leucine-rich repe...  78.2    5e-14   
ref|XP_004982365.1|  PREDICTED: leucine-rich repeat extensin-like...  77.8    6e-14   
ref|XP_011091034.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  77.4    6e-14   
ref|NP_001054807.1|  Os05g0180300                                     78.2    7e-14   
ref|XP_004243365.1|  PREDICTED: leucine-rich repeat extensin-like...  77.4    7e-14   
ref|XP_007043626.1|  Leucine-rich repeat family protein               77.8    7e-14   
ref|XP_006367488.1|  PREDICTED: leucine-rich repeat extensin-like...  77.4    7e-14   
ref|XP_006651620.1|  PREDICTED: leucine-rich repeat extensin-like...  77.8    7e-14   
ref|XP_002464196.1|  hypothetical protein SORBIDRAFT_01g013940        77.4    9e-14   
ref|XP_004248904.1|  PREDICTED: pollen-specific leucine-rich repe...  78.6    9e-14   
gb|KHN01115.1|  Pollen-specific leucine-rich repeat extensin-like...  77.4    1e-13   
ref|XP_003526272.1|  PREDICTED: leucine-rich repeat extensin-like...  77.4    1e-13   
gb|EYU41450.1|  hypothetical protein MIMGU_mgv1a002668mg              78.6    1e-13   
dbj|BAK04234.1|  predicted protein                                    78.6    1e-13   
ref|XP_011092901.1|  PREDICTED: pollen-specific leucine-rich repe...  78.6    1e-13   
ref|XP_007143301.1|  hypothetical protein PHAVU_007G060800g           77.0    1e-13   
gb|EMT04692.1|  hypothetical protein F775_21578                       77.0    1e-13   
ref|XP_004505561.1|  PREDICTED: leucine-rich repeat extensin-like...  77.0    1e-13   
ref|XP_010092426.1|  Leucine-rich repeat extensin-like protein 6      77.0    1e-13   
ref|XP_010252148.1|  PREDICTED: leucine-rich repeat extensin-like...  78.2    1e-13   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg           76.6    2e-13   
ref|XP_002517083.1|  serine-threonine protein kinase, plant-type,...  76.3    2e-13   
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...  77.8    2e-13   
gb|KHN22289.1|  Pollen-specific leucine-rich repeat extensin-like...  77.8    2e-13   
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...  77.8    2e-13   
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg           77.4    2e-13   
ref|XP_010438472.1|  PREDICTED: pollen-specific leucine-rich repe...  76.6    2e-13   
gb|EPS58069.1|  hypothetical protein M569_16746                       75.9    2e-13   
gb|EMS66895.1|  Leucine-rich repeat extensin-like protein 6           76.3    2e-13   
ref|XP_003566833.2|  PREDICTED: leucine-rich repeat extensin-like...  77.0    2e-13   
gb|KCW60691.1|  hypothetical protein EUGRSUZ_H03422                   75.5    2e-13   
ref|XP_004496690.1|  PREDICTED: leucine-rich repeat extensin-like...  76.3    3e-13   
gb|EPS67208.1|  hypothetical protein M569_07569                       75.1    3e-13   
ref|XP_004297998.1|  PREDICTED: leucine-rich repeat extensin-like...  77.4    3e-13   
ref|XP_010035772.1|  PREDICTED: leucine-rich repeat extensin-like...  76.3    3e-13   
gb|EAY91133.1|  hypothetical protein OsI_12740                        76.3    3e-13   
ref|XP_009405471.1|  PREDICTED: pollen-specific leucine-rich repe...  76.6    3e-13   
ref|XP_008438627.1|  PREDICTED: leucine-rich repeat extensin-like...  75.9    3e-13   
ref|NP_001050725.1|  Os03g0637600                                     75.9    3e-13   
gb|EPS67596.1|  hypothetical protein M569_07180                       75.9    3e-13   
ref|XP_009606917.1|  PREDICTED: leucine-rich repeat extensin-like...  75.9    3e-13   
gb|KEH43816.1|  LRR/extensin 2                                        75.5    4e-13   
ref|XP_007034837.1|  Leucine-rich repeat (LRR) family protein, pu...  75.5    4e-13   
gb|KEH30699.1|  LRR/extensin                                          75.9    4e-13   
ref|XP_009383792.1|  PREDICTED: pollen-specific leucine-rich repe...  76.6    5e-13   
ref|XP_008224262.1|  PREDICTED: leucine-rich repeat extensin-like...  75.1    5e-13   
ref|XP_010694037.1|  PREDICTED: leucine-rich repeat extensin-like...  75.5    5e-13   
ref|XP_010689048.1|  PREDICTED: leucine-rich repeat extensin-like...  75.5    5e-13   
ref|XP_006420005.1|  hypothetical protein CICLE_v10004988mg           75.5    6e-13   
ref|XP_006489442.1|  PREDICTED: leucine-rich repeat extensin-like...  75.5    6e-13   
gb|KHN28116.1|  Leucine-rich repeat extensin-like protein 3           75.1    7e-13   
ref|XP_010433232.1|  PREDICTED: pollen-specific leucine-rich repe...  74.7    7e-13   
ref|NP_001042204.1|  Os01g0180000                                     75.5    7e-13   
ref|XP_008798454.1|  PREDICTED: leucine-rich repeat extensin-like...  74.7    7e-13   
ref|XP_007132678.1|  hypothetical protein PHAVU_011G115300g           75.1    7e-13   
gb|EEC70051.1|  hypothetical protein OsI_00647                        75.5    8e-13   
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg           74.7    8e-13   
ref|XP_004249854.1|  PREDICTED: leucine-rich repeat extensin-like...  75.9    8e-13   
ref|XP_003540926.1|  PREDICTED: leucine-rich repeat extensin-like...  74.7    9e-13   
dbj|BAJ89804.1|  predicted protein                                    75.9    9e-13   
ref|NP_194567.1|  leucine-rich repeat (LRR) family protein            74.7    9e-13   
ref|XP_008670898.1|  PREDICTED: pollen-specific leucine-rich repe...  75.9    1e-12   
ref|XP_008229070.1|  PREDICTED: leucine-rich repeat extensin-like...  74.7    1e-12   
ref|XP_009781630.1|  PREDICTED: leucine-rich repeat extensin-like...  74.3    1e-12   
ref|NP_001045834.1|  Os02g0138000                                     75.1    1e-12   
gb|AAG23713.1|  extensin-like protein                                 70.9    2e-12   
emb|CAA84230.1|  extensin-like protein                                75.5    2e-12   
ref|XP_006406127.1|  hypothetical protein EUTSA_v10022219mg           73.9    2e-12   
ref|XP_002314670.2|  hypothetical protein POPTR_0010s09320g           73.6    2e-12   
emb|CDO99097.1|  unnamed protein product                              73.9    2e-12   
ref|XP_009371969.1|  PREDICTED: leucine-rich repeat extensin-like...  73.6    2e-12   
emb|CDY72552.1|  BnaCnng78240D                                        73.6    2e-12   
emb|CDY18974.1|  BnaC01g20940D                                        73.6    2e-12   
gb|EAY81724.1|  hypothetical protein OsI_36898                        74.7    2e-12   
emb|CDX80525.1|  BnaC07g29190D                                        73.6    2e-12   
ref|XP_008455274.1|  PREDICTED: leucine-rich repeat extensin-like...  73.6    3e-12   
ref|XP_006469927.1|  PREDICTED: pollen-specific leucine-rich repe...  73.6    3e-12   
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                 73.2    3e-12   
ref|XP_006447273.1|  hypothetical protein CICLE_v10018109mg           73.2    3e-12   
gb|KDP24107.1|  hypothetical protein JCGZ_25764                       73.2    3e-12   
emb|CDY49661.1|  BnaC09g41390D                                        73.2    3e-12   
gb|ACU18125.1|  unknown                                               73.2    3e-12   
ref|XP_006351117.1|  PREDICTED: leucine-rich repeat extensin-like...  73.9    3e-12   
ref|XP_004137033.1|  PREDICTED: leucine-rich repeat extensin-like...  73.2    3e-12   
ref|XP_003575453.1|  PREDICTED: pollen-specific leucine-rich repe...  73.9    3e-12   
ref|XP_010259122.1|  PREDICTED: leucine-rich repeat extensin-like...  72.8    4e-12   
ref|XP_010690992.1|  PREDICTED: pollen-specific leucine-rich repe...  73.9    4e-12   
ref|NP_001130107.1|  uncharacterized protein LOC100191200 precursor   72.8    4e-12   
tpg|DAA51888.1|  TPA: leucine-rich repeat (LRR) family protein        72.8    4e-12   
ref|XP_002463746.1|  hypothetical protein SORBIDRAFT_01g005300        72.8    4e-12   
ref|NP_001152233.1|  systemin receptor SR160 precursor                72.8    4e-12   
ref|XP_006299744.1|  hypothetical protein CARUB_v10015937mg           73.2    4e-12   
emb|CDP07600.1|  unnamed protein product                              73.6    5e-12   
ref|NP_188919.1|  leucine-rich repeat extensin-like protein 6         73.2    5e-12   
ref|XP_010466571.1|  PREDICTED: leucine-rich repeat extensin-like...  73.2    5e-12   
ref|XP_002972291.1|  hypothetical protein SELMODRAFT_412903           72.4    5e-12   



>ref|XP_006451102.1| hypothetical protein CICLE_v100107081mg, partial [Citrus clementina]
 gb|ESR64342.1| hypothetical protein CICLE_v100107081mg, partial [Citrus clementina]
Length=190

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D+E HYI++RQLLYYRDEFGDRGE VTVDPSL FEN RIRNAYIALQAWKQAI+S
Sbjct  7    HGGLTDAEAHYIRQRQLLYYRDEFGDRGENVTVDPSLVFENPRIRNAYIALQAWKQAILS  66

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T+DWVGS VC+YTGVFCAPAPDN
Sbjct  67   DPYNLTADWVGSAVCSYTGVFCAPAPDN  94



>emb|CDP03355.1| unnamed protein product [Coffea canephora]
Length=782

 Score =   162 bits (411),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 72/89 (81%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +GPL+D+E HYI++RQLL YRDEFGDRGE VTVDP+LTFEN R+RNAYIALQAWK+AI+S
Sbjct  35   HGPLTDAEAHYIRQRQLLSYRDEFGDRGELVTVDPTLTFENPRLRNAYIALQAWKEAILS  94

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T DWVGSDVC YTGVFCAPAPDNP
Sbjct  95   DPSNFTGDWVGSDVCKYTGVFCAPAPDNP  123



>gb|KDP32304.1| hypothetical protein JCGZ_13229 [Jatropha curcas]
Length=713

 Score =   160 bits (405),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 70/88 (80%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG LSD+E  YI++RQLLYYRDE+GDRGE+VTVDPSL FEN R++NAYIALQAWKQAI+S
Sbjct  34   NGRLSDAEAMYIKKRQLLYYRDEYGDRGEKVTVDPSLVFENPRLKNAYIALQAWKQAILS  93

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP+N TSDWVG +VC+YTGVFCAPAPDN
Sbjct  94   DPQNLTSDWVGPNVCDYTGVFCAPAPDN  121



>ref|XP_004252054.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Solanum 
lycopersicum]
Length=727

 Score =   160 bits (405),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 69/90 (77%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            +NGPL+DSE  +I+ RQLLYYRDEFGDRGE V +DPS+ FENDRI+NAYIALQAWKQAII
Sbjct  37   ENGPLTDSEAQFIKHRQLLYYRDEFGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAII  96

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDP N T +WVG +VC+YTGVFCAPA DNP
Sbjct  97   SDPFNITMNWVGPNVCSYTGVFCAPALDNP  126



>ref|XP_006366874.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Solanum 
tuberosum]
Length=716

 Score =   159 bits (402),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 68/90 (76%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            +NGPL+DSE  +I+ RQLLYYRDEFGDRGE V +DPS+ FENDRI+NAYIALQAWKQAII
Sbjct  36   ENGPLTDSEAQFIKHRQLLYYRDEFGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAII  95

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDP N T +WVG +VC+YTG+FCAPA DNP
Sbjct  96   SDPFNITLNWVGPNVCSYTGIFCAPALDNP  125



>ref|XP_004173680.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like, 
partial [Cucumis sativus]
Length=451

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E HYI++RQLLYYRDEFGDRGE V VDP L FENDRIRNAYIALQAWKQAI+SDP 
Sbjct  47   LTDAEAHYIRQRQLLYYRDEFGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILSDPL  106

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T +WVGSDVC+Y GVFCAPAPDN
Sbjct  107  NLTKNWVGSDVCHYKGVFCAPAPDN  131



>ref|XP_006353562.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like, 
partial [Solanum tuberosum]
Length=670

 Score =   157 bits (398),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 68/90 (76%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            +NGPL+DSE  +I+ RQLLYYRDEFGDRGE V +DPS+ FENDRI+NAYIALQAWKQAII
Sbjct  2    ENGPLTDSEAQFIKHRQLLYYRDEFGDRGENVKIDPSMVFENDRIKNAYIALQAWKQAII  61

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDP N T +WVG +VC+YTG+FCAPA DNP
Sbjct  62   SDPFNITLNWVGPNVCSYTGIFCAPALDNP  91



>ref|XP_009627506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=605

 Score =   157 bits (397),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +GPL+D E  YI+ RQLLYYRDEFGDRGE V++DPS  FEN RI+NAYIALQAWKQAIIS
Sbjct  40   SGPLTDFEAQYIKHRQLLYYRDEFGDRGENVSIDPSFVFENSRIKNAYIALQAWKQAIIS  99

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T++WVG +VCNYTG+FCAPA DNP
Sbjct  100  DPFNLTANWVGPNVCNYTGIFCAPALDNP  128



>ref|XP_009760538.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nicotiana 
sylvestris]
Length=740

 Score =   158 bits (399),  Expect = 7e-42, Method: Composition-based stats.
 Identities = 68/90 (76%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            ++GPL+D E  YI+ RQLLYYRDEFGDRGE+VT+DPS  FEN+RI+NAYIALQAWKQAII
Sbjct  39   ESGPLTDFEAQYIKHRQLLYYRDEFGDRGEKVTIDPSFIFENNRIKNAYIALQAWKQAII  98

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDP N T +WVG +VCNYTG+FCAPA DNP
Sbjct  99   SDPFNLTENWVGPNVCNYTGIFCAPALDNP  128



>ref|XP_011078360.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=494

 Score =   156 bits (394),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            + GPL+++EV YI++RQLLYY DEFGDRGE VTVDPSL FEN R+R+AY+ALQAWK+AI+
Sbjct  43   NGGPLTEAEVFYIKKRQLLYYLDEFGDRGENVTVDPSLVFENPRLRSAYVALQAWKKAIL  102

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDP N T DWVGSDVCNYTGVFCAPA DNP
Sbjct  103  SDPHNLTVDWVGSDVCNYTGVFCAPALDNP  132



>ref|XP_004139428.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=608

 Score =   156 bits (395),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E HYI++RQLLYYRDEFGDRGE V VDP L FENDRIRNAYIALQAWKQAI+SDP 
Sbjct  47   LTDAEAHYIRQRQLLYYRDEFGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILSDPL  106

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T +WVGSDVC+Y GVFCAPAPDN
Sbjct  107  NLTKNWVGSDVCHYKGVFCAPAPDN  131



>gb|KJB06895.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=499

 Score =   155 bits (392),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D EV YI++RQLLYYRDEFGDRGE VTVDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  40   HGGLTDKEVSYIKQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKKAILS  99

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T+DWVGS+VC+YTGV+CAPA DN
Sbjct  100  DPFNLTADWVGSEVCDYTGVYCAPALDN  127



>ref|XP_006476103.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=700

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D+E HYI++RQLLYYRDEFGDRGE VTVDPSL F N RIRNAYIALQAWKQAI+S
Sbjct  41   HGGLTDAEAHYIRQRQLLYYRDEFGDRGENVTVDPSLVFANPRIRNAYIALQAWKQAILS  100

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T+DWVGS VC+YTGVFCAPAPDN
Sbjct  101  DPYNLTADWVGSAVCSYTGVFCAPAPDN  128



>ref|XP_008458246.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Cucumis melo]
Length=666

 Score =   156 bits (394),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E HYI++RQLLYYRDEFGDRGE V VDP L FENDRIRNAYIALQAWKQAI+SDP 
Sbjct  47   LTDAEAHYIRQRQLLYYRDEFGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILSDPL  106

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T +WVGSDVC+Y GVFCAPAPDN
Sbjct  107  NLTKNWVGSDVCHYKGVFCAPAPDN  131



>ref|XP_007013226.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY30845.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=740

 Score =   156 bits (395),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D EV YI++RQLLYYRDEFGDRGERVTVDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  36   HGGLTDQEVLYIKQRQLLYYRDEFGDRGERVTVDPSLVFENPRLRNAYIALQAWKQAILS  95

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS+VCNYTGVFCA APDN
Sbjct  96   DPFNLTGNWVGSEVCNYTGVFCAAAPDN  123



>gb|KGN60627.1| hypothetical protein Csa_2G004760 [Cucumis sativus]
Length=765

 Score =   156 bits (395),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E HYI++RQLLYYRDEFGDRGE V VDP L FENDRIRNAYIALQAWKQAI+SDP 
Sbjct  47   LTDAEAHYIRQRQLLYYRDEFGDRGEEVVVDPKLVFENDRIRNAYIALQAWKQAILSDPL  106

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T +WVGSDVC+Y GVFCAPAPDN
Sbjct  107  NLTKNWVGSDVCHYKGVFCAPAPDN  131



>ref|NP_189091.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
 sp|Q9LHF1.1|LRX4_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 4; Short=AtLRX4; 
Short=LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01951.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE76902.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
Length=494

 Score =   154 bits (389),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N PLSD+EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  31   NAPLSDTEVRFIQRRQLLYYRDEFGDRGENVTVDPSLIFENPRLRSAYIALQAWKQAILS  90

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +W+GS+VCNYTGVFC+ A DN
Sbjct  91   DPNNITVNWIGSNVCNYTGVFCSKALDN  118



>gb|KJB54162.1| hypothetical protein B456_009G023700 [Gossypium raimondii]
Length=532

 Score =   154 bits (390),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D EV YI++RQLLYYRDEFGDRGE+VTVDPSL FEN R RNAYIALQAWKQAI+S
Sbjct  35   HGGLTDKEVSYIKQRQLLYYRDEFGDRGEKVTVDPSLVFENPRQRNAYIALQAWKQAILS  94

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS VC+YTGV+CAPAPDN
Sbjct  95   DPFNLTGNWVGSSVCDYTGVYCAPAPDN  122



>gb|KJB06894.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=568

 Score =   154 bits (390),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D EV YI++RQLLYYRDEFGDRGE VTVDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  40   HGGLTDKEVSYIKQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKKAILS  99

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T+DWVGS+VC+YTGV+CAPA DN
Sbjct  100  DPFNLTADWVGSEVCDYTGVYCAPALDN  127



>ref|XP_009627507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X2 [Nicotiana tomentosiformis]
Length=555

 Score =   154 bits (390),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +GPL+D E  YI+ RQLLYYRDEFGDRGE V++DPS  FEN RI+NAYIALQAWKQAIIS
Sbjct  40   SGPLTDFEAQYIKHRQLLYYRDEFGDRGENVSIDPSFVFENSRIKNAYIALQAWKQAIIS  99

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T++WVG +VCNYTG+FCAPA DNP
Sbjct  100  DPFNLTANWVGPNVCNYTGIFCAPALDNP  128



>gb|KJB06897.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=591

 Score =   155 bits (391),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D EV YI++RQLLYYRDEFGDRGE VTVDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  40   HGGLTDKEVSYIKQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKKAILS  99

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T+DWVGS+VC+YTGV+CAPA DN
Sbjct  100  DPFNLTADWVGSEVCDYTGVYCAPALDN  127



>emb|CDX93014.1| BnaA03g37360D [Brassica napus]
Length=456

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N PL+D+EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  30   NAPLTDNEVRFIQRRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  89

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +W+GS+VC YTGVFC+ APDN
Sbjct  90   DPNNITLNWIGSNVCTYTGVFCSRAPDN  117



>gb|KJB06896.1| hypothetical protein B456_001G004000 [Gossypium raimondii]
Length=690

 Score =   154 bits (390),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D EV YI++RQLLYYRDEFGDRGE VTVDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  40   HGGLTDKEVSYIKQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKKAILS  99

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T+DWVGS+VC+YTGV+CAPA DN
Sbjct  100  DPFNLTADWVGSEVCDYTGVYCAPALDN  127



>ref|XP_007152809.1| hypothetical protein PHAVU_004G161500g [Phaseolus vulgaris]
 gb|ESW24803.1| hypothetical protein PHAVU_004G161500g [Phaseolus vulgaris]
Length=725

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NGPL+D+E  YI++RQLLYY+DEFGDRGE+VTVDPS  FEN+R+RNAYIALQAWK AI+S
Sbjct  36   NGPLTDAEASYIKQRQLLYYKDEFGDRGEKVTVDPSFRFENNRLRNAYIALQAWKHAILS  95

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP+N T DWVG +VCNYT VFCAPA DNP
Sbjct  96   DPKNLTLDWVGPNVCNYTSVFCAPALDNP  124



>ref|XP_008361263.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
Length=260

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +GPLSD E  YI+ RQLLYYRDEFGDRGE VTVDPSL FENDR+RNAYIALQA KQAI+S
Sbjct  46   HGPLSDEEALYIKHRQLLYYRDEFGDRGEHVTVDPSLVFENDRLRNAYIALQALKQAILS  105

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS+ C YTGVFC  A DN
Sbjct  106  DPFNITGNWVGSNXCKYTGVFCTKALDN  133



>ref|XP_011043443.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Populus euphratica]
Length=661

 Score =   153 bits (387),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD++  YI++RQLLYY+DEFGDRGERVTVDPSL F N R+RNAYIALQAWKQAI SD
Sbjct  38   GGLSDADAMYIKKRQLLYYKDEFGDRGERVTVDPSLVFPNPRLRNAYIALQAWKQAIFSD  97

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N T++WVGS VCNY GVFCAPAPDN
Sbjct  98   PLNLTANWVGSQVCNYEGVFCAPAPDN  124



>gb|KJB54163.1| hypothetical protein B456_009G023700 [Gossypium raimondii]
Length=727

 Score =   154 bits (388),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D EV YI++RQLLYYRDEFGDRGE+VTVDPSL FEN R RNAYIALQAWKQAI+S
Sbjct  35   HGGLTDKEVSYIKQRQLLYYRDEFGDRGEKVTVDPSLVFENPRQRNAYIALQAWKQAILS  94

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS VC+YTGV+CAPAPDN
Sbjct  95   DPFNLTGNWVGSSVCDYTGVYCAPAPDN  122



>ref|XP_004287084.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Fragaria 
vesca subsp. vesca]
Length=715

 Score =   153 bits (387),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D+E HYI++RQLLYYRDEFGDRGE V VDPSL FEN R+RNAYIALQAWK+AI+S
Sbjct  33   HGSLTDAEAHYIKQRQLLYYRDEFGDRGEVVKVDPSLVFENPRLRNAYIALQAWKKAILS  92

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T DWVGSDVC+YTGVFCAPA DN
Sbjct  93   DPFNLTGDWVGSDVCSYTGVFCAPALDN  120



>ref|XP_010088853.1| Leucine-rich repeat extensin-like protein 4 [Morus notabilis]
 gb|EXB37050.1| Leucine-rich repeat extensin-like protein 4 [Morus notabilis]
Length=777

 Score =   154 bits (388),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LS+ E  YI++RQLLYYRDEFGDRGE VTVDPSLTFENDRIR+AYIALQAWK AI+S
Sbjct  50   HGRLSNDEKLYIKQRQLLYYRDEFGDRGENVTVDPSLTFENDRIRSAYIALQAWKNAILS  109

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T+DWVGS+VC YTGVFCAPA DNP
Sbjct  110  DPNNLTTDWVGSNVCKYTGVFCAPALDNP  138



>ref|XP_010527189.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Tarenaya hassleriana]
Length=694

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
             +G LSD EV  I+ RQLLYYRDEFGDRGE VTVDPSL FEN R+R+AY+ALQAWKQAI+
Sbjct  36   SHGRLSDHEVKVIRHRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYVALQAWKQAIL  95

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDP N T  WVGS+VCNYTGVFCAPAPDNP
Sbjct  96   SDPFNFTETWVGSNVCNYTGVFCAPAPDNP  125



>ref|XP_006371912.1| hypothetical protein POPTR_0018s06150g [Populus trichocarpa]
 gb|ERP49709.1| hypothetical protein POPTR_0018s06150g [Populus trichocarpa]
Length=509

 Score =   151 bits (382),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 68/87 (78%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD++  YI++RQLLYY+DEFGDRGERVTVDPSL F N R+RNAYIALQAWKQAI SD
Sbjct  38   GGLSDADAMYIKKRQLLYYKDEFGDRGERVTVDPSLVFPNPRLRNAYIALQAWKQAIFSD  97

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N T++WVGS VCNY GVFCAPAPDN
Sbjct  98   PLNLTANWVGSQVCNYEGVFCAPAPDN  124



>ref|XP_002281292.2| PREDICTED: leucine-rich repeat extensin-like protein 4 [Vitis 
vinifera]
Length=752

 Score =   153 bits (387),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D+EV YI+RRQLLYYRDEFGDRGE VTVDPSL FEN R RNAYIALQAWKQAI+S
Sbjct  35   HGHLTDAEVMYIKRRQLLYYRDEFGDRGEDVTVDPSLVFENPRQRNAYIALQAWKQAILS  94

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS+VCNYTGV+CA APDN
Sbjct  95   DPLNLTLNWVGSNVCNYTGVYCAQAPDN  122



>ref|XP_003532491.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like [Glycine 
max]
Length=735

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            LSD+E  Y+++RQLLYYRDEFGDRGE V VDPSL FENDR+RNAYIALQAWKQAI+SDPR
Sbjct  34   LSDAEAMYVKQRQLLYYRDEFGDRGENVIVDPSLAFENDRLRNAYIALQAWKQAILSDPR  93

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N T+DWVGSDVC+YTGV+CAPA D P
Sbjct  94   NQTADWVGSDVCSYTGVYCAPALDIP  119



>ref|XP_002885650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   151 bits (381),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N  LSD+EV +IQRRQLLYYRDEFGDRGE+VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  31   NARLSDTEVRFIQRRQLLYYRDEFGDRGEKVTVDPSLIFENPRLRSAYIALQAWKQAILS  90

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +W+GS+VCNYTGVFC+ A DN
Sbjct  91   DPNNITVNWIGSNVCNYTGVFCSRALDN  118



>emb|CDX94809.1| BnaC03g43790D [Brassica napus]
Length=530

 Score =   151 bits (381),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N PL+D+EV +IQRRQLLYYRDEFGDRGE V+VDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  28   NAPLTDNEVRFIQRRQLLYYRDEFGDRGENVSVDPSLVFENPRLRSAYIALQAWKQAILS  87

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +W+GS+VC+YTGVFC+ APDN
Sbjct  88   DPNNITLNWIGSNVCSYTGVFCSRAPDN  115



>ref|XP_010532845.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Tarenaya 
hassleriana]
Length=648

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD EV +I++RQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+SD
Sbjct  44   GRLSDHEVKFIRQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILSD  103

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N T+ WVGS+VCNYTGVFC+PAPDN
Sbjct  104  PFNFTASWVGSNVCNYTGVFCSPAPDN  130



>ref|XP_006414071.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
 gb|ESQ55524.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
Length=739

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG LSD EV  I++RQLLYYRDEFGDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  40   NGDLSDKEVRLIRQRQLLYYRDEFGDRGENVVVDPSLVFENPRLRNAYIALQAWKQAILS  99

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T++W+GSDVC+YTGV+CAPAPDN
Sbjct  100  DPNNFTTNWIGSDVCSYTGVYCAPAPDN  127



>ref|XP_009132101.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Brassica 
rapa]
Length=749

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N  LSD EVH I++RQLLYYRD+FGDRGE V VDPSL FEN R+R+AY+ALQAWKQAI+S
Sbjct  35   NSDLSDKEVHLIRQRQLLYYRDDFGDRGENVVVDPSLVFENPRLRSAYVALQAWKQAILS  94

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T++W+GSDVC+YTGV+CAPAPDNP
Sbjct  95   DPNNFTTNWIGSDVCSYTGVYCAPAPDNP  123



>ref|XP_010050506.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=425

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNT  404
            D+E  YI++RQLLYYRDEFGDRGE V+VDPSL FEN RIR+AYIALQAWK+AI+SDP+N 
Sbjct  47   DAEAMYIKQRQLLYYRDEFGDRGENVSVDPSLKFENPRIRSAYIALQAWKEAILSDPKNY  106

Query  405  TSDWVGSDVCNYTGVFCAPAPDNP  476
            T+DWVGSDVCNYTGV+CAPA D+P
Sbjct  107  TADWVGSDVCNYTGVYCAPAIDDP  130



>ref|XP_009135898.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Brassica 
rapa]
Length=909

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N PL+D+EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  27   NAPLTDNEVRFIQRRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  86

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +W+GS+VC YTGVFC+ APDN
Sbjct  87   DPNNITLNWIGSNVCTYTGVFCSRAPDN  114



>ref|XP_004148723.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like, 
partial [Cucumis sativus]
Length=740

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LSD+E  +I+ RQLLYYRDEFGDRGE VTVDPSL FENDRIRNAYIALQAWK AI+S
Sbjct  13   HGSLSDAEALFIRHRQLLYYRDEFGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  72

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T++WVGS+VCNY GVFCAP+ DNP
Sbjct  73   DPLNQTANWVGSNVCNYFGVFCAPSLDNP  101



>gb|KGN65364.1| hypothetical protein Csa_1G383520 [Cucumis sativus]
Length=775

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LSD+E  +I+ RQLLYYRDEFGDRGE VTVDPSL FENDRIRNAYIALQAWK AI+S
Sbjct  23   HGSLSDAEALFIRHRQLLYYRDEFGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  82

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T++WVGS+VCNY GVFCAP+ DNP
Sbjct  83   DPLNQTANWVGSNVCNYFGVFCAPSLDNP  111



>ref|XP_004170319.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=785

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LSD+E  +I+ RQLLYYRDEFGDRGE VTVDPSL FENDRIRNAYIALQAWK AI+S
Sbjct  23   HGSLSDAEALFIRHRQLLYYRDEFGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILS  82

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T++WVGS+VCNY GVFCAP+ DNP
Sbjct  83   DPLNQTANWVGSNVCNYFGVFCAPSLDNP  111



>ref|XP_006389464.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
 gb|ERP48378.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
Length=569

 Score =   148 bits (374),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+E  YI +RQLLYY+DEFGDRGERVTVDPSL FEN R++NAY+ALQAWKQAI SD
Sbjct  39   GGLSDAEAMYINKRQLLYYKDEFGDRGERVTVDPSLVFENPRLKNAYMALQAWKQAIFSD  98

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N T++WVGS VCNY GVFC+ APDN
Sbjct  99   PLNLTANWVGSQVCNYEGVFCSRAPDN  125



>ref|XP_008463374.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Cucumis 
melo]
Length=771

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+E  +I+ RQLLYYRDEFGDRGE VTVDPSL FENDRIRNAYIALQAWK AI+SD
Sbjct  25   GTLSDAEALFIRHRQLLYYRDEFGDRGELVTVDPSLVFENDRIRNAYIALQAWKLAILSD  84

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T++WVGS+VCNY GVFCAP+ DNP
Sbjct  85   PLNQTANWVGSNVCNYFGVFCAPSLDNP  112



>ref|XP_010488556.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Camelina sativa]
Length=444

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N  LS +EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  33   NASLSYNEVRFIQRRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  92

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T DW+GS+VC+YTGVFC+ A DN
Sbjct  93   DPNNITLDWIGSNVCSYTGVFCSRALDN  120



>ref|XP_010513507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=719

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N PLS +EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  28   NAPLSYNEVRFIQRRQLLYYRDEFGDRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  87

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T DW+GS+VC+YTGVFC+ A DN
Sbjct  88   DPNNITLDWIGSNVCSYTGVFCSRALDN  115



>ref|XP_010688564.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=607

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG LSD+EV YI++RQLLYY+DEFGDRGERV + P+L F N ++R+AYIALQAWKQAI+S
Sbjct  35   NGKLSDAEVSYIRKRQLLYYKDEFGDRGERVRIPPNLQFLNPKLRDAYIALQAWKQAILS  94

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGSDVC+YTGVFCAP+PDN
Sbjct  95   DPYNYTVNWVGSDVCHYTGVFCAPSPDN  122



>ref|XP_010254179.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=764

 Score =   147 bits (370),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG L+D+E  YIQ+RQLLYYRDEF DRGE V VDPSL FEN R +NAYIALQAWKQAIIS
Sbjct  43   NGGLTDAEARYIQQRQLLYYRDEFCDRGEHVRVDPSLVFENPRQKNAYIALQAWKQAIIS  102

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N TS+WVGS+VCNYTGVFC  A D+P
Sbjct  103  DPLNLTSNWVGSNVCNYTGVFCTSALDDP  131



>ref|XP_006285388.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
 gb|EOA18286.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
Length=747

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            +N  LSD+EV  I +RQLLYYRDEFGDRGE V VDPSL FEN R+RNAY+ALQAWKQAI+
Sbjct  32   NNNDLSDNEVRLIAQRQLLYYRDEFGDRGENVVVDPSLVFENPRLRNAYVALQAWKQAIL  91

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            SDP N T++W+GSDVC+YTGVFCAPA DN
Sbjct  92   SDPNNFTTNWIGSDVCSYTGVFCAPALDN  120



>ref|XP_004512961.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=745

 Score =   146 bits (368),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+++E  YI+ RQLLYYRD+F DRGE VTVDP+L F+N+RI+NAY+ALQAWK AI+S
Sbjct  39   DGSLTENEAMYIKHRQLLYYRDQFCDRGENVTVDPNLVFQNNRIKNAYVALQAWKHAILS  98

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DPRN T DWVGS+VCNYT V+CAPA DNP
Sbjct  99   DPRNCTVDWVGSNVCNYTNVYCAPALDNP  127



>emb|CAB37452.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78869.1| extensin-like protein [Arabidopsis thaliana]
Length=839

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG LSD+EV  I +RQLLY+RDEFGDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  35   NGDLSDNEVRLITQRQLLYFRDEFGDRGENVDVDPSLVFENPRLRNAYIALQAWKQAILS  94

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T++W+GSDVC+YTGV+CAPA DN
Sbjct  95   DPNNFTTNWIGSDVCSYTGVYCAPALDN  122



>ref|XP_009336917.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=750

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LSD E  YI+ RQLLYYRDEFGDRGE VTVDPSL FENDR+RNAYIALQA KQAI+S
Sbjct  47   HGALSDEEALYIKNRQLLYYRDEFGDRGELVTVDPSLVFENDRLRNAYIALQALKQAILS  106

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS+VCNYTGVFC  A DN
Sbjct  107  DPLNITGNWVGSNVCNYTGVFCTKALDN  134



>ref|XP_008242638.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=667

 Score =   144 bits (363),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 67/88 (76%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LS +E  YI++RQLLYYRDEFGDRGE VTVDPSL FEN RIRNAYIALQAWKQAI+S
Sbjct  42   HGALSHAEALYIKQRQLLYYRDEFGDRGELVTVDPSLVFENQRIRNAYIALQAWKQAILS  101

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS+VC+YTGVFC  A DN
Sbjct  102  DPLNLTGNWVGSNVCSYTGVFCTKALDN  129



>ref|NP_193602.4| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
 sp|Q9SN46.2|LRX5_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 5; Short=AtLRX5; 
Short=LRR/EXTENSIN5; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE84074.1| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
Length=857

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG LSD+EV  I +RQLLY+RDEFGDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  35   NGDLSDNEVRLITQRQLLYFRDEFGDRGENVDVDPSLVFENPRLRNAYIALQAWKQAILS  94

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T++W+GSDVC+YTGV+CAPA DN
Sbjct  95   DPNNFTTNWIGSDVCSYTGVYCAPALDN  122



>ref|XP_009352479.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=521

 Score =   143 bits (360),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 67/88 (76%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LSD E  YI+ RQLLYYRDEFGDRGE VTVDPSL FENDR+RNAYIALQA KQAI+S
Sbjct  42   HGLLSDEEALYIKHRQLLYYRDEFGDRGEHVTVDPSLVFENDRLRNAYIALQALKQAILS  101

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS+VC YTGVFC  A DN
Sbjct  102  DPFNITGNWVGSNVCKYTGVFCTKALDN  129



>ref|XP_010434501.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X2 [Camelina sativa]
Length=768

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG LSD+EV  I +RQLLYYRD+FGDRGE V VDP+L FEN R+RNAY+ALQAWKQAI+S
Sbjct  37   NGNLSDNEVRLITKRQLLYYRDDFGDRGENVVVDPTLVFENPRLRNAYVALQAWKQAILS  96

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T++W+GS+VC+YTGVFCAPA DN
Sbjct  97   DPNNFTTNWIGSNVCSYTGVFCAPALDN  124



>ref|XP_010434500.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X1 [Camelina sativa]
Length=780

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG LSD+EV  I +RQLLYYRD+FGDRGE V VDP+L FEN R+RNAY+ALQAWKQAI+S
Sbjct  37   NGNLSDNEVRLITKRQLLYYRDDFGDRGENVVVDPTLVFENPRLRNAYVALQAWKQAILS  96

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T++W+GS+VC+YTGVFCAPA DN
Sbjct  97   DPNNFTTNWIGSNVCSYTGVFCAPALDN  124



>gb|KEH27082.1| LRR extensin-like protein [Medicago truncatula]
Length=835

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            D   L+++E  YI+ RQLLYYRDEF DRGE VTVDP+L F N+RI+NAY+ALQA+KQAI+
Sbjct  34   DGSHLTEAETQYIKHRQLLYYRDEFNDRGENVTVDPTLVFSNNRIKNAYVALQAFKQAIL  93

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDPRN T DWVGSDVC+YT VFCAPA DNP
Sbjct  94   SDPRNCTVDWVGSDVCSYTNVFCAPALDNP  123



>ref|XP_003620502.1| Extensin-like protein [Medicago truncatula]
Length=838

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            D   L+++E  YI+ RQLLYYRDEF DRGE VTVDP+L F N+RI+NAY+ALQA+KQAI+
Sbjct  34   DGSHLTEAETQYIKHRQLLYYRDEFNDRGENVTVDPTLVFSNNRIKNAYVALQAFKQAIL  93

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDPRN T DWVGSDVC+YT VFCAPA DNP
Sbjct  94   SDPRNCTVDWVGSDVCSYTNVFCAPALDNP  123



>ref|XP_008344101.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4, partial [Malus domestica]
Length=526

 Score =   142 bits (358),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 66/88 (75%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LSD E  YI+ RQLLYYRDEFGDRGE VTV PSL FENDR+RNAYIALQA KQAI+S
Sbjct  47   HGALSDEEALYIKNRQLLYYRDEFGDRGELVTVXPSLVFENDRLRNAYIALQALKQAILS  106

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS+VC YTGVFC  A DN
Sbjct  107  DPLNITGNWVGSNVCKYTGVFCTKALDN  134



>ref|XP_010449482.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Camelina 
sativa]
Length=825

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            LSD+EV  I +RQLLYYRDEFGDRGE V VDP+L FEN R+RNAY+ALQAWKQAI+SDP 
Sbjct  45   LSDNEVRLITKRQLLYYRDEFGDRGENVVVDPTLVFENPRLRNAYVALQAWKQAILSDPN  104

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T++W+GS+VC YTGVFCAPA DN
Sbjct  105  NFTTNWIGSNVCGYTGVFCAPALDN  129



>ref|XP_010439825.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=862

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            LSD+EV  I +RQLLYYRDEFGDRGE V VDP+L FEN R+RNAY+ALQAWKQAI+SDP 
Sbjct  41   LSDNEVRLITKRQLLYYRDEFGDRGENVVVDPTLVFENPRLRNAYVALQAWKQAILSDPN  100

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T++W+GS+VC+YTGVFCAPA DN
Sbjct  101  NFTTNWIGSNVCSYTGVFCAPALDN  125



>ref|XP_002867981.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44240.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            NG LSD++V  I +RQLLY+RDE GDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct  36   NGDLSDNQVRLITQRQLLYFRDELGDRGENVVVDPSLVFENPRLRNAYIALQAWKQAILS  95

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T++W+GSDVC+YTGV+CAPA DN
Sbjct  96   DPNNFTTNWIGSDVCSYTGVYCAPALDN  123



>ref|XP_006389336.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
 gb|ERP48250.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
Length=500

 Score =   140 bits (352),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +3

Query  240  YIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWV  419
            YI +RQLLYY+DEFGDRGERVTVDPSL FEN R++NAY+ALQAWKQAI SDP N T++WV
Sbjct  2    YIDKRQLLYYKDEFGDRGERVTVDPSLVFENPRLKNAYMALQAWKQAIFSDPLNLTANWV  61

Query  420  GSDVCNYTGVFCAPAPDN  473
            GS VCNY GVFC+ APDN
Sbjct  62   GSQVCNYEGVFCSRAPDN  79



>ref|XP_010925532.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Elaeis 
guineensis]
Length=523

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E   I++RQLLYYRDEFGDRGE VTVDPSL F N  +R+AYIALQAWK AIISDP 
Sbjct  32   LTDAEAGLIRQRQLLYYRDEFGDRGESVTVDPSLNFPNSHLRDAYIALQAWKLAIISDPL  91

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N T++WVGSDVC+YTGVFCAP P +P
Sbjct  92   NLTANWVGSDVCSYTGVFCAPLPSDP  117



>ref|XP_010926371.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Elaeis 
guineensis]
Length=791

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E   I++RQLLYYRDEFGDRGE VTVDPSL F N  +R+AYIALQAWK AIISDP 
Sbjct  32   LTDAEAGLIRQRQLLYYRDEFGDRGESVTVDPSLNFPNSHLRDAYIALQAWKLAIISDPL  91

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N T++WVGSDVC+YTGVFCAP P +P
Sbjct  92   NLTANWVGSDVCSYTGVFCAPLPSDP  117



>ref|XP_008786172.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix 
dactylifera]
Length=678

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E  +I++RQLLYYRDEFGDRGE VTVDPSL F N  +R+AYIALQAWK AIISDP 
Sbjct  32   LTDAEAGFIRQRQLLYYRDEFGDRGEYVTVDPSLNFPNSHLRDAYIALQAWKLAIISDPL  91

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N T++WVGS+VCNYTGV+CAP P +P
Sbjct  92   NLTANWVGSNVCNYTGVYCAPLPSDP  117



>ref|XP_008793507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Phoenix 
dactylifera]
Length=643

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E  +I++RQLLYYRDEFGDRGE  TVDPSL+F N  +R+AYIALQAWK AIISDP 
Sbjct  32   LTDAEAGFIRQRQLLYYRDEFGDRGENGTVDPSLSFSNSHLRDAYIALQAWKLAIISDPL  91

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N TS+WVGS+VCNYTGV+CAP P +P
Sbjct  92   NLTSNWVGSNVCNYTGVYCAPLPSDP  117



>ref|XP_008365636.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 4 [Malus domestica]
Length=505

 Score =   137 bits (345),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 64/88 (73%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +GPLSD E  YI+ RQLLYY DEFGDRGE VT+DPSL FENDR+RNAYIALQA KQAI+S
Sbjct  92   HGPLSDEEALYIKHRQLLYYHDEFGDRGEHVTIDPSLVFENDRLRNAYIALQALKQAILS  151

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +WVGS+VC YT VF   A DN
Sbjct  152  DPFNITGNWVGSNVCKYTXVFXTKALDN  179



>ref|XP_006414930.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
 gb|ESQ56383.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
Length=400

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 4/83 (5%)
 Frame = +3

Query  225  DSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNT  404
            D+EV +IQRRQLL    EF +RGE+VTVDPSL+FEN R+RNAYIALQAWKQAI+SDP N 
Sbjct  31   DNEVRHIQRRQLL----EFAERGEKVTVDPSLSFENPRLRNAYIALQAWKQAILSDPFNF  86

Query  405  TSDWVGSDVCNYTGVFCAPAPDN  473
            T++W+GS+VCNYTGVFC+PA DN
Sbjct  87   TANWIGSNVCNYTGVFCSPALDN  109



>ref|XP_010249819.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=701

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGER-VTVDPSLTFENDRIRNAYIALQAWKQAI  383
            +NG L+D E  YI++RQLLYYRDEF DRGE  V +DPSL FEN R+RNAYIALQAWK+A+
Sbjct  30   NNGGLTDIEARYIRQRQLLYYRDEFYDRGEHYVKLDPSLVFENPRLRNAYIALQAWKKAM  89

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPD  470
            ISDP N T +WVG DVCNYTGVFCA A D
Sbjct  90   ISDPLNLTGNWVGFDVCNYTGVFCANALD  118



>emb|CDY42885.1| BnaC08g46890D [Brassica napus]
Length=407

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 4/88 (5%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G LSDSEV +IQRRQLL    EF +R + V VDPSL FEN R+RNAYIALQAWKQAI S
Sbjct  25   HGTLSDSEVRHIQRRQLL----EFAERSQNVIVDPSLVFENPRLRNAYIALQAWKQAIFS  80

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T++W+GS+VCNYTGVFC+PA DN
Sbjct  81   DPFNFTANWIGSNVCNYTGVFCSPALDN  108



>ref|XP_006282938.1| hypothetical protein CARUB_v100074500mg, partial [Capsella rubella]
 gb|EOA15836.1| hypothetical protein CARUB_v100074500mg, partial [Capsella rubella]
Length=488

 Score =   132 bits (331),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 4/87 (5%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  23   GALSDNEVRHIQRRQLL----EFAERSVKITVDPSLVFENPRLRNAYIALQAWKQAILSD  78

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P   TS+W+GS+VCNYTGVFC+PA DN
Sbjct  79   PNKFTSNWIGSNVCNYTGVFCSPALDN  105



>ref|NP_193070.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
 sp|Q9T0K5.1|LRX3_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 3; Short=AtLRX3; 
Short=LRR/EXTENSIN3; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB40769.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78376.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE83265.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
Length=760

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 4/89 (4%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            D G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+
Sbjct  26   DGGVLSDNEVRHIQRRQLL----EFAERSVKITVDPSLNFENPRLRNAYIALQAWKQAIL  81

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            SDP N TS+W+GS+VCNYTGVFC+PA DN
Sbjct  82   SDPNNFTSNWIGSNVCNYTGVFCSPALDN  110



>ref|XP_003524389.2| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Glycine 
max]
Length=597

 Score =   132 bits (331),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  261  LYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNY  440
            L   DEFGDRGE VTVDPSL F+NDR+RNAYIALQAWKQAI+SDPRN T+DWVGS VC+Y
Sbjct  24   LALSDEFGDRGENVTVDPSLVFQNDRLRNAYIALQAWKQAILSDPRNQTTDWVGSQVCSY  83

Query  441  TGVFCAPAPDNP  476
            TGV+CAPA DNP
Sbjct  84   TGVYCAPALDNP  95



>ref|XP_006300268.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
 gb|EOA33166.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
Length=457

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 4/88 (5%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N PLS +EV +IQRRQLL    EF DRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct  37   NAPLSVNEVRFIQRRQLL----EFADRGENVTVDPSLVFENPRLRSAYIALQAWKQAILS  92

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N T +W+GS+VC+YTGVFC+ A DN
Sbjct  93   DPNNITLNWIGSNVCSYTGVFCSRALDN  120



>ref|XP_009403414.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   130 bits (328),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E   I+RRQLLYY DE+GDRGERV+VDPS  F N R+R+AY+ALQAWKQAI+SDP+
Sbjct  36   LTDAEAGLIRRRQLLYYLDEYGDRGERVSVDPSFHFPNPRLRDAYVALQAWKQAILSDPQ  95

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T +WVG +VC Y GV+CAP P N
Sbjct  96   NFTGNWVGPNVCTYRGVYCAPLPCN  120



>ref|XP_010925096.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Elaeis guineensis]
Length=441

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E  YI+RRQLL YRD+ G RGE VTVDP+  F N R+RNAYIALQAWK AI SDP 
Sbjct  34   LTDAEAGYIRRRQLLTYRDQLGGRGENVTVDPTFVFPNPRLRNAYIALQAWKLAIFSDPL  93

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N T++WVG DVCNYT V+CAP P +P
Sbjct  94   NLTANWVGPDVCNYTSVYCAPLPSDP  119



>gb|KFK36221.1| hypothetical protein AALP_AA4G093700 [Arabis alpina]
Length=844

 Score =   132 bits (333),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 4/87 (5%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  29   GVLSDNEVRHIQRRQLL----EFAERSVKITVDPSLVFENPRLRNAYIALQAWKQAILSD  84

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N TS+W+GS+VCNYTGVFC+P+ DN
Sbjct  85   PFNFTSNWIGSNVCNYTGVFCSPSLDN  111



>ref|XP_009408826.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=553

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E  +I+RRQLLYY DE+GDRGERV+VDPS  F N R+R+AY+ALQAWK+AI+SDP 
Sbjct  34   LTDAEAGFIRRRQLLYYLDEYGDRGERVSVDPSFRFPNPRLRDAYVALQAWKKAILSDPH  93

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T  WVG +VC+Y GVFCAP P N
Sbjct  94   NFTGSWVGPNVCSYYGVFCAPLPCN  118



>ref|XP_002863246.1| hypothetical protein ARALYDRAFT_497051 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39505.1| hypothetical protein ARALYDRAFT_497051 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   130 bits (326),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 4/87 (5%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  25   GVLSDNEVRHIQRRQLL----EFAERSVKITVDPSLIFENPRLRNAYIALQAWKQAILSD  80

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N TS+W+GS+VCNYTGVFC+PA DN
Sbjct  81   PNNFTSNWIGSNVCNYTGVFCSPALDN  107



>ref|XP_007013716.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY31335.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=614

 Score =   130 bits (327),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/86 (65%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+DS+  +I++RQL+YYR++FG  G+  +V   LTF+N R+R+AY+ALQAWKQAIISDP 
Sbjct  35   LTDSQASFIKQRQLIYYREQFGSGGKFDSVPSQLTFDNSRLRSAYVALQAWKQAIISDPL  94

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N TS+WVGSDVCNYTGVFC+PA D+P
Sbjct  95   NLTSNWVGSDVCNYTGVFCSPALDDP  120



>gb|KHN21547.1| Leucine-rich repeat extensin-like protein 5 [Glycine soja]
Length=588

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  261  LYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNY  440
            L   DEFGDRGE VTVDPSL F+NDR+RNAYIALQAWKQAI+SDPRN T+DWVGS VC+Y
Sbjct  24   LALSDEFGDRGENVTVDPSLVFQNDRLRNAYIALQAWKQAILSDPRNQTTDWVGSQVCSY  83

Query  441  TGVFCAPAPDNP  476
            TGV+CAPA DNP
Sbjct  84   TGVYCAPALDNP  95



>ref|XP_010450229.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Camelina sativa]
Length=733

 Score =   129 bits (324),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 4/87 (5%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+EV +IQRRQLL    EF +R   +TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  25   GALSDNEVRHIQRRQLL----EFAERSVNITVDPSLVFENPRLRNAYIALQAWKQAILSD  80

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N TS+W+GS+VCNYTGVFC+P+ DN
Sbjct  81   PNNFTSNWIGSNVCNYTGVFCSPSLDN  107



>emb|CBI28097.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            +G L+D+EV YI+RRQLLYYRDEFGDRGE VTVDPSL FEN R RNAYIALQAWKQAI+S
Sbjct  35   HGHLTDAEVMYIKRRQLLYYRDEFGDRGEDVTVDPSLVFENPRQRNAYIALQAWKQAILS  94

Query  390  DPRNTTSDWVGSD  428
            DP N T +WVGS+
Sbjct  95   DPLNLTLNWVGSN  107



>ref|XP_010450227.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Camelina sativa]
Length=688

 Score =   129 bits (323),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 4/87 (5%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+EV +IQRRQLL    EF +R   +TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  25   GALSDNEVRHIQRRQLL----EFAERSVNITVDPSLVFENPRLRNAYIALQAWKQAILSD  80

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N TS+W+GS+VCNYTGVFC+P+ DN
Sbjct  81   PNNFTSNWIGSNVCNYTGVFCSPSLDN  107



>ref|XP_010450228.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Camelina sativa]
Length=725

 Score =   129 bits (323),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 4/87 (5%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+EV +IQRRQLL    EF +R   +TVDPSL FEN R+RNAYIALQAWKQAI+SD
Sbjct  25   GALSDNEVRHIQRRQLL----EFAERSVNITVDPSLVFENPRLRNAYIALQAWKQAILSD  80

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N TS+W+GS+VCNYTGVFC+P+ DN
Sbjct  81   PNNFTSNWIGSNVCNYTGVFCSPSLDN  107



>ref|XP_007160348.1| hypothetical protein PHAVU_002G314200g [Phaseolus vulgaris]
 gb|ESW32342.1| hypothetical protein PHAVU_002G314200g [Phaseolus vulgaris]
Length=740

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +3

Query  228  SEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTT  407
            S +     R +L YRDEFGDRGE V+VDPSL F+N+R+R+AYIALQAWK AI+SDP+N T
Sbjct  26   SSLTLTHPRHVLSYRDEFGDRGENVSVDPSLVFQNNRLRDAYIALQAWKLAILSDPQNQT  85

Query  408  SDWVGSDVCNYTGVFCAPAPDNP  476
            +DWVGS VC YTGV+CAPA DNP
Sbjct  86   TDWVGSQVCTYTGVYCAPALDNP  108



>ref|XP_010435287.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=738

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 4/87 (5%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+EV +IQRRQLL    EF +R  ++TVD SL FEN R+RNAYIALQAWKQAI+SD
Sbjct  26   GALSDNEVRHIQRRQLL----EFAERSVKITVDHSLVFENPRLRNAYIALQAWKQAILSD  81

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N TS+W+GS+VCNYTGVFC+P+ DN
Sbjct  82   PNNFTSNWIGSNVCNYTGVFCSPSLDN  108



>ref|XP_009381253.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=546

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+D+E   I+RRQLLYY DE+GDRGERVTVDPS  F N  +R AY+ALQAWKQAI+SDP 
Sbjct  36   LTDAEAGLIRRRQLLYYLDEYGDRGERVTVDPSFHFANPGLRAAYVALQAWKQAILSDPH  95

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T +WVG DVC+Y GV+CA  P N
Sbjct  96   NFTGNWVGPDVCHYYGVYCASLPCN  120



>gb|EPS61338.1| hypothetical protein M569_13456, partial [Genlisea aurea]
Length=387

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +3

Query  243  IQRRQLLYYRDEFGDRGERVTVD-PSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWV  419
            ++ R+LLYY DEFGDRGE V+VD  SL FENDR+R+AYIALQAWK+AI+SDP N T+DWV
Sbjct  1    VKERRLLYYLDEFGDRGEDVSVDEASLVFENDRLRSAYIALQAWKEAILSDPYNLTADWV  60

Query  420  GSDVCNYTGVFCAPAPDNP  476
            GSDVC YTGVFCA A D+P
Sbjct  61   GSDVCGYTGVFCAQAIDDP  79



>ref|XP_010440602.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=720

 Score =   127 bits (319),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 4/87 (5%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAY+ALQAWKQAI+SD
Sbjct  26   GALSDNEVRHIQRRQLL----EFAERSVKITVDPSLVFENPRLRNAYVALQAWKQAILSD  81

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N TS+W+GS+VCNYTGVFC+P+ +N
Sbjct  82   PNNFTSNWIGSNVCNYTGVFCSPSLNN  108



>gb|KDO79655.1| hypothetical protein CISIN_1g041736mg [Citrus sinensis]
Length=500

 Score =   125 bits (313),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            +NG   ++E  +I++RQLLYYR+ +G RGE   + PS  FEN RIR+AYIALQAWK+AII
Sbjct  30   NNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAII  89

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            SDP N TS+WVG  VCNYTGVFCA A DN
Sbjct  90   SDPWNLTSNWVGCYVCNYTGVFCAQALDN  118



>ref|XP_009377376.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=679

 Score =   127 bits (318),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 61/91 (67%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = +3

Query  210  NGPLSDS--EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  383
            N  L DS    HY QR QLLYY D+ G RGE VTV  SL FEN R+R+AYIALQAWKQA+
Sbjct  34   NAGLRDSLRTSHYKQR-QLLYYIDQDGSRGETVTVPASLVFENSRLRSAYIALQAWKQAM  92

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +SDP +  S+WVGSDVC YTGVFCA APD+P
Sbjct  93   VSDPLDQISNWVGSDVCKYTGVFCAQAPDDP  123



>ref|XP_006450582.1| hypothetical protein CICLE_v10010264mg [Citrus clementina]
 gb|ESR63822.1| hypothetical protein CICLE_v10010264mg [Citrus clementina]
Length=503

 Score =   124 bits (311),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            +NG   ++E  +I++RQLLYYR+ +G RGE   + PS  FEN RIR+AYIALQAWK+AII
Sbjct  30   NNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAII  89

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            SDP N TS+WVG  VCNYTGVFCA A DN
Sbjct  90   SDPWNLTSNWVGCYVCNYTGVFCAQALDN  118



>ref|XP_006476177.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Citrus 
sinensis]
Length=514

 Score =   124 bits (311),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  207  DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            +NG   ++E  +I++RQLLYYR+ +G RGE   + PS  FEN RIR+AYIALQAWK+AII
Sbjct  30   NNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAII  89

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            SDP N TS+WVG  VCNYTGVFCA A DN
Sbjct  90   SDPWNLTSNWVGCYVCNYTGVFCAQALDN  118



>ref|XP_008378297.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Malus 
domestica]
Length=577

 Score =   124 bits (310),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +3

Query  210  NGPLSDS--EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  383
            N  L DS    HY QR QLL Y D+ G RGE VTV   L FEN R+R+AYIALQAWKQA+
Sbjct  34   NAGLRDSLRTSHYKQR-QLLXYIDQDGSRGETVTVPDXLVFENSRLRSAYIALQAWKQAM  92

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +SDPR+  S+WVGSDVC YTGVFCA APD+P
Sbjct  93   VSDPRDQISNWVGSDVCKYTGVFCAQAPDDP  123



>ref|XP_008357497.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3, partial [Malus domestica]
Length=557

 Score =   124 bits (310),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 60/91 (66%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +3

Query  210  NGPLSDS--EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  383
            N  L DS    HY QR QLL Y D+ G RGE VTV   L FEN R+R+AYIALQAWKQA+
Sbjct  34   NAGLRDSLRTSHYKQR-QLLXYIDQDGSRGETVTVPDXLVFENSRLRSAYIALQAWKQAM  92

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +SDPR+  S+WVGSDVC YTGVFCA APD+P
Sbjct  93   VSDPRDQISNWVGSDVCKYTGVFCAQAPDDP  123



>ref|XP_008337109.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3 [Malus domestica]
Length=480

 Score =   120 bits (302),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = +3

Query  222  SDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRN  401
            S   +HY QR QLLYY D  G RG  VT   SL FEN R+R+AY ALQAWK+A++SDP +
Sbjct  40   SSHTLHYKQR-QLLYYTDHHGSRGVTVTAAGSLVFENPRLRSAYTALQAWKRAMVSDPWD  98

Query  402  TTSDWVGSDVCNYTGVFCAPAPDNP  476
             TS+WVGSDVC YTGVFCA APD+P
Sbjct  99   QTSNWVGSDVCKYTGVFCAQAPDDP  123



>ref|XP_009348443.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Pyrus 
x bretschneideri]
Length=745

 Score =   122 bits (305),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 68/91 (75%), Gaps = 3/91 (3%)
 Frame = +3

Query  210  NGPLSDSE--VHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAI  383
            N  L DS   +HY QR QLLYY D  G RG  VT   SL FEN R+R+AY ALQAWK+A+
Sbjct  34   NAGLRDSSHTLHYKQR-QLLYYTDHHGSRGVTVTAAGSLVFENPRLRSAYTALQAWKRAM  92

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +SDPR+ TS+WVGSDVC YTGVFCA APD+P
Sbjct  93   VSDPRDQTSNWVGSDVCKYTGVFCAQAPDDP  123



>ref|XP_008347715.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Malus 
domestica]
Length=403

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  237  HYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDW  416
            HY ++RQLL Y D+ G RGE VTV  +L FEN R+R+AYIALQAWKQA++SDPR+  S+W
Sbjct  45   HY-KQRQLLXYIDQDGSRGETVTVPDALVFENSRLRSAYIALQAWKQAMVSDPRDQISNW  103

Query  417  VGSDVCNYTGVFCAPAPDNP  476
            VGSDVC YTGVFCA APD+P
Sbjct  104  VGSDVCKYTGVFCAQAPDDP  123



>ref|XP_010049719.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=732

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  246  QRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGS  425
            + R LL+Y DEFGDRG +VTVDPS +FEN R+RNAY+ALQA KQAI+SDP N T++WVG 
Sbjct  37   EHRLLLHYLDEFGDRGLQVTVDPSASFENPRLRNAYVALQALKQAILSDPNNFTANWVGP  96

Query  426  DVCNYTGVFCAPAPDNP  476
            DVC+Y+ V+C+PAPD+P
Sbjct  97   DVCSYSNVYCSPAPDDP  113



>ref|XP_006842252.1| hypothetical protein AMTR_s00078p00197410 [Amborella trichopoda]
 gb|ERN03927.1| hypothetical protein AMTR_s00078p00197410 [Amborella trichopoda]
Length=874

 Score =   120 bits (302),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            L+ +E   I+ RQLLYY D +GDRGE V VDPS  FEN R+R AYIALQAWK AIISDP 
Sbjct  76   LTFAEASSIKHRQLLYYIDRYGDRGESVFVDPSFEFENSRLREAYIALQAWKMAIISDPM  135

Query  399  NTTSDWVGSDVCNYTGVFCAPAPD  470
            N T +W+G  VCNYTGVFC+ + D
Sbjct  136  NITGNWIGPIVCNYTGVFCSKSLD  159



>gb|KFK28537.1| hypothetical protein AALP_AA7G009800 [Arabis alpina]
Length=738

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = +3

Query  222  SDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRN  401
            SD EV  I +RQLL    +F DR E V VDPSL FEN R+RNAYIALQAWKQAI+SDP N
Sbjct  24   SDKEVRLIGQRQLL----QFHDRSENVVVDPSLVFENPRLRNAYIALQAWKQAILSDPNN  79

Query  402  TTSDWVGSDVCNYTGVFCAPAPDN  473
             T++W GS+VC+YTGV+C+PA DN
Sbjct  80   FTTNWFGSNVCSYTGVYCSPALDN  103



>ref|XP_008219840.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus 
mume]
Length=559

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N  L + ++ +I +RQLL+Y D+ G RGE V V  SL F N R+R+AY+ALQAWKQA++S
Sbjct  29   NAGLRELKLSHINQRQLLFYTDQDGSRGELVAVPSSLVFHNPRLRSAYVALQAWKQAMLS  88

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP   TS+WVGS++C+YTGVFC+ A D+P
Sbjct  89   DPLGETSNWVGSNICSYTGVFCSRALDDP  117



>ref|XP_004292960.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Fragaria 
vesca subsp. vesca]
Length=524

 Score =   113 bits (283),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +3

Query  240  YIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQ-AIISDPRNTTSDW  416
            +I++RQLL+Y+D    RGE VTV PSL F N RIR AYIALQAWKQ A++SDP   T++W
Sbjct  39   HIKQRQLLHYKDNNCSRGETVTVPPSLVFPNPRIRTAYIALQAWKQIAMLSDPLGYTANW  98

Query  417  VGSDVCNYTGVFCAPAPDNP  476
            VGS+VCNYTGVFCA A D+P
Sbjct  99   VGSNVCNYTGVFCAQALDDP  118



>ref|XP_007227690.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
 gb|EMJ28889.1| hypothetical protein PRUPE_ppa1027218m2g, partial [Prunus persica]
Length=413

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +3

Query  225  DSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNT  404
            +SE    + RQLL+Y D+ G RGE V V  SL F N R+R+AY+ALQAWKQA++SDP   
Sbjct  5    ESEPSQKKTRQLLFYTDQDGSRGELVAVPSSLVFHNPRLRSAYVALQAWKQAMLSDPLGQ  64

Query  405  TSDWVGSDVCNYTGVFCAPAPDNP  476
            TS+WVGS+VC+YTGVFC+ A D+P
Sbjct  65   TSNWVGSNVCSYTGVFCSRALDDP  88



>ref|XP_011026539.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Populus euphratica]
Length=502

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  249  RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  428
            +RQLLYYR+E     E + + P L F+N R+R+AYIALQAWKQAIISDP N TS+W G D
Sbjct  53   QRQLLYYREELDVEDEYLMLPPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGPD  112

Query  429  VCNYTGVFCAPAPDN  473
            VCNYTGVFCA A DN
Sbjct  113  VCNYTGVFCATALDN  127



>ref|XP_011026538.1| PREDICTED: leucine-rich repeat extensin-like protein 4 isoform 
X1 [Populus euphratica]
Length=614

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  249  RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  428
            +RQLLYYR+E     E + + P L F+N R+R+AYIALQAWKQAIISDP N TS+W G D
Sbjct  53   QRQLLYYREELDVEDEYLMLPPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGPD  112

Query  429  VCNYTGVFCAPAPDN  473
            VCNYTGVFCA A DN
Sbjct  113  VCNYTGVFCATALDN  127



>gb|KJB27056.1| hypothetical protein B456_004G274900 [Gossypium raimondii]
Length=462

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 61/78 (78%), Gaps = 2/78 (3%)
 Frame = +3

Query  249  RRQLLYYRDEFGDRGERVTVDPS--LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVG  422
            RR++ YY  EF    +  +V PS  LTF+N R++ AYIALQAWKQAIISDP N TSDWVG
Sbjct  32   RRRVFYYGGEFKSGADFDSVLPSSSLTFDNPRLKTAYIALQAWKQAIISDPLNLTSDWVG  91

Query  423  SDVCNYTGVFCAPAPDNP  476
            S+VCNYTGVFC+PA D+P
Sbjct  92   SNVCNYTGVFCSPALDDP  109



>ref|XP_002324259.1| hypothetical protein POPTR_0018s01010g [Populus trichocarpa]
 gb|EEF02824.1| hypothetical protein POPTR_0018s01010g [Populus trichocarpa]
Length=496

 Score =   105 bits (263),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  249  RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  428
            +RQLLYYR+E     E + + P L F+N R+R+AYIALQAWKQAIISDP N TS+W G D
Sbjct  45   QRQLLYYREELDVEDEYLMLPPCLKFDNPRLRSAYIALQAWKQAIISDPLNLTSNWAGPD  104

Query  429  VCNYTGVFCAPAPDN  473
            VCNYTGVFCA A D+
Sbjct  105  VCNYTGVFCATALDD  119



>ref|XP_009613983.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Nicotiana 
tomentosiformis]
Length=533

 Score =   105 bits (263),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 6/82 (7%)
 Frame = +3

Query  231  EVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTS  410
            ++ Y  RR+LL Y       G+ + ++PSL FEN R++NAYIALQAWK+AI+SDP N T+
Sbjct  46   DIEYTNRRKLLSYN------GDILAINPSLNFENFRLKNAYIALQAWKEAILSDPHNITA  99

Query  411  DWVGSDVCNYTGVFCAPAPDNP  476
            +W+GS+VCNYTGVFC P+ D P
Sbjct  100  NWIGSNVCNYTGVFCWPSLDEP  121



>ref|XP_010251965.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nelumbo 
nucifera]
Length=734

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            LS++EV +I  RQLL    E GD  E     VD +LTF N R+R AYIALQAWK+AI+SD
Sbjct  25   LSEAEVSFIAHRQLLSL-PENGDLPENYEYQVDVNLTFPNARLRRAYIALQAWKEAIVSD  83

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P   T+ WVG+DVC+Y GVFCAPAPD+P
Sbjct  84   PHKITTSWVGADVCDYKGVFCAPAPDDP  111



>ref|XP_011019700.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Populus euphratica]
 ref|XP_011019701.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Populus euphratica]
Length=482

 Score =   104 bits (260),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/88 (57%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +3

Query  213  GPLSDSEVHYIQ-RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            GP     +H  Q +R LL+YR+E     E + +   L F+N R+R+AYIALQAWK AIIS
Sbjct  32   GPRDSQTIHIKQSQRHLLHYREELDIEDEYLMLPACLKFDNPRLRSAYIALQAWKLAIIS  91

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N TS+WVGSDVC+YTGVFCA + DN
Sbjct  92   DPLNLTSNWVGSDVCSYTGVFCATSLDN  119



>ref|XP_011019702.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X4 [Populus euphratica]
Length=469

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +3

Query  213  GPLSDSEVHYIQ-RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            GP     +H  Q +R LL+YR+E     E + +   L F+N R+R+AYIALQAWK AIIS
Sbjct  32   GPRDSQTIHIKQSQRHLLHYREELDIEDEYLMLPACLKFDNPRLRSAYIALQAWKLAIIS  91

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N TS+WVGSDVC+YTGVFCA + DN
Sbjct  92   DPLNLTSNWVGSDVCSYTGVFCATSLDN  119



>ref|XP_011019699.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Populus euphratica]
Length=492

 Score =   104 bits (260),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/88 (57%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +3

Query  213  GPLSDSEVHYIQ-RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            GP     +H  Q +R LL+YR+E     E + +   L F+N R+R+AYIALQAWK AIIS
Sbjct  32   GPRDSQTIHIKQSQRHLLHYREELDIEDEYLMLPACLKFDNPRLRSAYIALQAWKLAIIS  91

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP N TS+WVGSDVC+YTGVFCA + DN
Sbjct  92   DPLNLTSNWVGSDVCSYTGVFCATSLDN  119



>ref|XP_008366033.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific leucine-rich 
repeat extensin-like protein 3 [Malus domestica]
Length=922

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGER-VTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            L+D+EV  I RRQLL++ +    R E+   V+ ++TF + R+R AYIALQAWK+AI SDP
Sbjct  151  LTDAEVSSITRRQLLHFHEGDDQRDEKEYEVELNVTFPHTRLRRAYIALQAWKKAIYSDP  210

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
              TT +WVG DVC YTGVFCAPA D+P
Sbjct  211  LKTTENWVGGDVCAYTGVFCAPALDDP  237



>ref|XP_008776836.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
 ref|XP_008779029.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Phoenix 
dactylifera]
Length=640

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 61/85 (72%), Gaps = 7/85 (8%)
 Frame = +3

Query  225  DSEVHYIQRR-QLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRN  401
            D+   YI+RR QLL YR      GE V VDP+  F N R+R+AYIALQAWK AIISDP N
Sbjct  30   DAAAGYIRRRRQLLTYR------GENVAVDPTFAFPNLRLRDAYIALQAWKLAIISDPLN  83

Query  402  TTSDWVGSDVCNYTGVFCAPAPDNP  476
             T++WVG +VCNYTGV+C P P +P
Sbjct  84   LTANWVGPNVCNYTGVYCGPLPSDP  108



>ref|XP_011081863.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=525

 Score =   100 bits (250),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 60/85 (71%), Gaps = 6/85 (7%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            +S++   + Q R+LL Y       G+ +  +PS  FEN R+ NAYIALQAWK+ I+SDP+
Sbjct  38   VSEAADDFHQHRRLLSYN------GDPLATEPSHKFENPRLENAYIALQAWKETILSDPK  91

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            N T++WVG DVCNY GVFC PAPDN
Sbjct  92   NMTTNWVGPDVCNYKGVFCWPAPDN  116



>ref|XP_002455880.1| hypothetical protein SORBIDRAFT_03g026730 [Sorghum bicolor]
 gb|EES01000.1| hypothetical protein SORBIDRAFT_03g026730 [Sorghum bicolor]
Length=613

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = +3

Query  213  GPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            G LS S+  +I+RRQLL Y ++ G     V VD S  F N R+R+AY+ALQAWK+AI+SD
Sbjct  35   GGLSASDAAHIRRRQLLQYHNDDGSDDGGVVVDASYAFPNPRLRDAYVALQAWKRAILSD  94

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T  W G DVC Y GV+CAP+P +P
Sbjct  95   PYNVTGSWSGPDVCAYGGVYCAPSPQDP  122



>ref|XP_009798822.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Nicotiana 
sylvestris]
Length=540

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 6/89 (7%)
 Frame = +3

Query  210  NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS  389
            N  L    + Y  RR+LL Y       G+ + ++PSL F N R++NAYIALQAWK+A +S
Sbjct  39   NDHLGVPNIEYTNRRKLLSYN------GDILAINPSLNFGNLRLKNAYIALQAWKEATLS  92

Query  390  DPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DP N T++W+GS+VCNYTGVFC P+ D P
Sbjct  93   DPHNITANWIGSNVCNYTGVFCWPSLDEP  121



>ref|XP_008458675.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Cucumis melo]
Length=677

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/88 (56%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            +S++E  Y+ RRQLL  +  DE  D   +  +D + TF N+R++ AY+ALQAWK AI SD
Sbjct  44   ISEAEASYLTRRQLLALKEHDELPD-DFKYQLDIADTFPNERLKMAYVALQAWKLAIYSD  102

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P+N T++WVG+DVC+YTGVFCAPA DNP
Sbjct  103  PQNMTANWVGADVCSYTGVFCAPALDNP  130



>ref|XP_008225431.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Prunus mume]
Length=934

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGER-VTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            L+D+E  ++  RQLL++   +  RG+    V+ +L F + R+R+AY+ALQAWK+AI SDP
Sbjct  23   LTDAEASFVAHRQLLHFHASYDLRGDHEYEVELNLKFPHPRLRSAYVALQAWKKAIYSDP  82

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
              TT +WVG++VC YTGVFCAPA D+P
Sbjct  83   LKTTENWVGANVCAYTGVFCAPALDDP  109



>ref|XP_011005677.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=799

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            L+D+E  YI RRQLL   +      E    VD  +TF N R+R AYI LQAWK+AI SDP
Sbjct  28   LTDAEASYIARRQLLTLNENSELPHEFEYEVDVKITFANQRLRRAYIGLQAWKKAIYSDP  87

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             NTT DWVG++VC Y GVFCAPA D+P
Sbjct  88   FNTTGDWVGANVCAYNGVFCAPALDDP  114



>ref|XP_011001177.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=830

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            L+D+E  YI RRQLL   +      E    VD  +TF N R+R AYI LQAWK+AI SDP
Sbjct  28   LTDAEASYIARRQLLTLNENSELPHEFEYEVDVKITFANQRLRRAYIGLQAWKKAIYSDP  87

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             NTT DWVG++VC Y GVFCAPA D+P
Sbjct  88   FNTTGDWVGANVCAYNGVFCAPALDDP  114



>ref|XP_006361150.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Solanum 
tuberosum]
Length=494

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +3

Query  216  PLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            P     +     R+LL Y+      G+ + ++PSL+ EN R++NAYIALQ+WK+ I+SDP
Sbjct  41   PFGGIAIETSNSRKLLSYK------GDVLAINPSLSIENFRLKNAYIALQSWKEVILSDP  94

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             N T +WVGS+VCNYTGVFC+P+ D P
Sbjct  95   HNITQNWVGSNVCNYTGVFCSPSLDQP  121



>ref|XP_006384469.1| hypothetical protein POPTR_0004s153601g, partial [Populus trichocarpa]
 gb|ERP62266.1| hypothetical protein POPTR_0004s153601g, partial [Populus trichocarpa]
Length=552

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            L+D+E  YI RRQLL   +      E    VD  +TF N R+R AYI LQAWK+AI SDP
Sbjct  28   LTDAEASYIARRQLLTLNENSELPHEFEYEVDVKITFANQRLRRAYIGLQAWKKAIYSDP  87

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             NTT +WVG++VC Y GVFCAPA D+P
Sbjct  88   FNTTGNWVGANVCAYNGVFCAPALDDP  114



>ref|XP_004512856.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Cicer 
arietinum]
Length=642

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  309  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            DPSL FEN+RIRNAYIA QAWKQAI+SDP+N T++WVGS+VC+YTGV+CA A DNP
Sbjct  39   DPSLVFENNRIRNAYIAFQAWKQAILSDPQNFTTNWVGSNVCSYTGVYCAQALDNP  94



>ref|XP_006848210.1| hypothetical protein AMTR_s00029p00242610 [Amborella trichopoda]
 gb|ERN09791.1| hypothetical protein AMTR_s00029p00242610 [Amborella trichopoda]
Length=258

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            ++D+E  +I  RQLL+ R+  +  D  E   VD +LTF N R+R AYIAL  WK+AI SD
Sbjct  25   VTDTEARFIAGRQLLHLREGEDLPDDLE-FHVDTNLTFPNPRLRRAYIALHTWKEAIFSD  83

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N TS+W G+DVC+Y GVFCAPA D+P
Sbjct  84   PYNVTSNWEGADVCSYKGVFCAPALDDP  111



>ref|XP_008458676.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3, partial [Cucumis melo]
Length=568

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            +S+ E  Y+ RRQLL  +  DE  +   +  +D + TF N+R++ AY+ALQAWK AI SD
Sbjct  27   ISEVEASYLTRRQLLTLKQHDELPN-DFKYKLDIADTFPNERLKMAYVALQAWKLAIYSD  85

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P+N T++WVG+DVC+YTGVFCAPA DNP
Sbjct  86   PQNMTANWVGADVCSYTGVFCAPALDNP  113



>ref|XP_004173261.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like, partial [Cucumis sativus]
Length=487

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            LS++E  Y+ RRQLL  +  +    + +  +D + TF N+R++ AY ALQAWK A+ SDP
Sbjct  44   LSEAEASYLTRRQLLTLKKHYELPDDFQYELDIADTFPNERLKKAYRALQAWKLAVYSDP  103

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +N T++WVG+DVC+YTGVFCAPA D+P
Sbjct  104  QNMTANWVGADVCSYTGVFCAPALDDP  130



>tpg|DAA58808.1| TPA: leucine-rich repeat (LRR) family protein, partial [Zea mays]
Length=555

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            LS S+  +I+RRQLL Y       G  V VDPS  F N R+R+AY+ALQAW++AI+SDP 
Sbjct  35   LSASDAAHIRRRQLLQYHGGGAGNGSGVVVDPSYAFPNPRLRDAYVALQAWRRAILSDPH  94

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N T  W G DVC Y GV+CAP+P +P
Sbjct  95   NVTGSWTGPDVCAYAGVYCAPSPQDP  120



>emb|CDO97126.1| unnamed protein product [Coffea canephora]
Length=608

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/91 (54%), Positives = 60/91 (66%), Gaps = 6/91 (7%)
 Frame = +3

Query  222  SDSEVHYIQRRQLLYYR--DEFGDRG----ERVTVDPSLTFENDRIRNAYIALQAWKQAI  383
            +D+E  YI RRQLL +   D   + G         + + TFENDR++ AYIALQAWK+A 
Sbjct  29   TDAEATYIARRQLLTFSKLDHLSEGGILDSTNFDFELNFTFENDRLKKAYIALQAWKKAT  88

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             SDP NTT +W G DVC YTGVFCAPA D+P
Sbjct  89   YSDPHNTTGNWDGPDVCQYTGVFCAPALDDP  119



>ref|XP_010107567.1| Leucine-rich repeat extensin-like protein 2 [Morus notabilis]
 gb|EXC16249.1| Leucine-rich repeat extensin-like protein 2 [Morus notabilis]
Length=789

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +3

Query  285  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  464
            D  + V VDP+L FEN R+R AYIALQAWKQAI SDP N T++W G+DVC+Y+GVFCAP 
Sbjct  32   DENDVVRVDPTLNFENPRLRRAYIALQAWKQAIFSDPLNFTANWNGADVCSYSGVFCAPF  91

Query  465  PDNP  476
            P NP
Sbjct  92   PANP  95



>gb|KFK40046.1| hypothetical protein AALP_AA3G322800 [Arabis alpina]
Length=905

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL    E GD  + +   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  31   LTDAEASFIVQRQLLTL-PENGDLPDDIEYEVDLKVTFANHRLKRAYIALQAWKKAVFSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VCNYTGVFCAPA D+P
Sbjct  90   PFNTTGNWHGPHVCNYTGVFCAPALDDP  117



>gb|KGN45680.1| hypothetical protein Csa_6G006180 [Cucumis sativus]
Length=617

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            LS++E  Y+ RR+LL  ++ +    + +  +D + TF N+R++ AY ALQAWK A+ SDP
Sbjct  31   LSEAEASYLTRRRLLTLKNHYELPDDFQYELDIADTFPNERLKKAYRALQAWKLAVYSDP  90

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +N T++WVG+DVC+YTGVFCAPA D+P
Sbjct  91   QNMTANWVGADVCSYTGVFCAPALDDP  117



>gb|KGN45681.1| hypothetical protein Csa_6G006190 [Cucumis sativus]
Length=761

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 64/88 (73%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            LS++E  Y+ RRQLL  +  DE      +  +D   TF N+R++ AY+ALQAWK A+ SD
Sbjct  31   LSEAEASYLTRRQLLTLKNYDEL-PLDFQYELDIPDTFPNERLKKAYVALQAWKLAVYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P+N T++WVG+DVC+YTGVFCAPA D+P
Sbjct  90   PQNMTANWVGADVCSYTGVFCAPALDDP  117



>ref|XP_009119384.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=834

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERV--TVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   ++ GD  E +   VD  LTF N R++ AYIALQAWK+A+ SD
Sbjct  31   LTDAEASFIAQRQLLTLPED-GDLPENIEYKVDIKLTFPNQRLKRAYIALQAWKKAVYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC+YTGV CAPA D+P
Sbjct  90   PFNTTGNWHGPHVCDYTGVVCAPALDDP  117



>ref|XP_010466040.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Camelina sativa]
Length=920

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D E  ++ RRQLL    E GD  + +   VD  L F+N+R++ AYIALQAWK+AI SD
Sbjct  31   LTDEEASFLTRRQLLALS-ENGDLPDDMEYEVDLDLKFDNNRLKRAYIALQAWKKAIYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NT ++WVG +VC+Y GVFCAPA D+P
Sbjct  90   PFNTAANWVGPNVCSYKGVFCAPALDDP  117



>ref|XP_002519151.1| protein binding protein, putative [Ricinus communis]
 gb|EEF43362.1| protein binding protein, putative [Ricinus communis]
Length=829

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+EV +I  RQLL  ++  E  +  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  28   LTDAEVSFITGRQLLSLKENEELPNEYEH-EVDVKVTFANQRLKRAYIALQAWKKAMYSD  86

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTTS+W G++VC Y GVFCAPA D+P
Sbjct  87   PFNTTSNWNGANVCAYNGVFCAPALDDP  114



>ref|XP_004173016.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like, partial [Cucumis sativus]
Length=294

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            +S +EV YI +RQLL  +  D+  D   +  +D   TF N+R++ AY+ALQAWK A+ SD
Sbjct  33   VSQAEVSYITQRQLLTLKEHDQLPDDF-KYELDIPDTFPNERLKKAYVALQAWKLAVYSD  91

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P+N T +WVG++VC+Y GVFCAPA D+P
Sbjct  92   PKNMTVNWVGANVCSYNGVFCAPALDDP  119



>gb|EYU21900.1| hypothetical protein MIMGU_mgv1a006829mg [Erythranthe guttata]
Length=430

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = +3

Query  249  RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  428
             R LL Y       G+ +  DP L FEN R+++AYIALQAWK +I+SDP N T+ W G D
Sbjct  40   HRHLLSYN------GDPLAADPVLDFENPRLKSAYIALQAWKDSILSDPNNVTATWTGPD  93

Query  429  VCNYTGVFCAPAPDNP  476
            VCNYTGVFC  APDNP
Sbjct  94   VCNYTGVFCWQAPDNP  109



>ref|NP_179188.1| pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis 
thaliana]
 sp|Q9XIL9.1|PLRX3_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 3; Short=AtPEX3; Short=Pollen-specific LRR/EXTENSIN3; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD41978.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06443.1| pollen-specific leucine-rich repeat extensin-like protein 3 [Arabidopsis 
thaliana]
Length=727

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+EV +I +RQLL   +  E  D  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  19   LTDAEVSFIAQRQLLTLPENGELPDDIE-YEVDLKVTFANHRLKRAYIALQAWKKAVYSD  77

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  78   PFNTTGNWHGPHVCGYTGVFCAPALDDP  105



>gb|KJB79255.1| hypothetical protein B456_013G040300 [Gossypium raimondii]
Length=511

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D E  YI RRQLL  R+  +  D G   TV  +  FEN+R+R A+IALQAWK+A+ SD
Sbjct  30   LTDVEQSYITRRQLLALRENGKLPD-GYEYTVKTTEKFENERLRRAFIALQAWKKAMYSD  88

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P+N TS+W G +VC+Y GV+C  A D+P
Sbjct  89   PKNITSNWFGPNVCDYKGVYCVRAMDDP  116



>ref|XP_010251729.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nelumbo nucifera]
Length=692

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+++E  YI +RQLL    E GD  +     V+ ++TF N R+R AYIALQAWK+A+ SD
Sbjct  25   LTEAETSYITQRQLLSL-PENGDLPDDYEYEVNINITFPNARLRRAYIALQAWKKAMYSD  83

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T +WVG+DVCNYTGVFCA A D P
Sbjct  84   PHNVTGNWVGADVCNYTGVFCANALDEP  111



>ref|XP_006480071.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Citrus sinensis]
Length=984

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 18/96 (19%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLY----------YRDEFGDRGERVTVDPSLTFENDRIRNAYIALQA  368
            L+D+E  +I RRQLL           + DE+G + +         F NDR++ AY+ALQA
Sbjct  30   LTDAEAAFIARRQLLTLPKDGKLPDNFDDEYGLKNKN--------FANDRLKKAYVALQA  81

Query  369  WKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +K+AI SDP N T +WV +DVC+Y GVFCAPAPDNP
Sbjct  82   FKKAIYSDPFNITGNWVDTDVCSYNGVFCAPAPDNP  117



>gb|EYU24926.1| hypothetical protein MIMGU_mgv1a006719mg [Erythranthe guttata]
Length=434

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = +3

Query  249  RRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  428
             R LL Y       G+ +  DP L FEN R+++AYIALQAWK +I+SDP N T+ W G D
Sbjct  44   HRHLLSYN------GDPLAADPVLDFENPRLKSAYIALQAWKDSILSDPNNITATWTGPD  97

Query  429  VCNYTGVFCAPAPDNP  476
            VCNYTG+FC  APDNP
Sbjct  98   VCNYTGIFCWQAPDNP  113



>gb|KJB74832.1| hypothetical protein B456_012G009700 [Gossypium raimondii]
Length=709

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  306  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            VDP+L FEN R+R AYIALQAWK AI SDP N T++W GSDVC+Y G++CAP+P NP
Sbjct  31   VDPNLRFENPRLREAYIALQAWKSAIFSDPFNFTANWNGSDVCSYMGIYCAPSPSNP  87



>ref|XP_007200697.1| hypothetical protein PRUPE_ppa000722m2g, partial [Prunus persica]
 gb|EMJ01896.1| hypothetical protein PRUPE_ppa000722m2g, partial [Prunus persica]
Length=609

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 59/86 (69%), Gaps = 3/86 (3%)
 Frame = +3

Query  222  SDSEVHYIQRRQLLYYRDEFGDRGER--VTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            +D+EV +I  RQLL    E GD  E   V VD  L FENDR++NAY+ALQA K+AI SDP
Sbjct  32   TDAEVAFIAHRQLLAL-PEGGDLPENYVVQVDAKLNFENDRLKNAYVALQALKKAIFSDP  90

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDN  473
               T +W G DVC+Y GVFCAPA DN
Sbjct  91   FGFTVNWEGEDVCSYKGVFCAPALDN  116



>ref|XP_008458201.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific leucine-rich 
repeat extensin-like protein 3 [Cucumis melo]
Length=636

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 64/92 (70%), Gaps = 11/92 (12%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYR------DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQA  380
            +S++E  Y+ RRQLL  +      D+F     +  +D   TF N+R++ AY+ALQAWK A
Sbjct  31   ISEAEASYLTRRQLLALKAHGELPDDF-----KYELDIPDTFPNERLKKAYVALQAWKLA  85

Query  381  IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            + SDP+N T++WVG+DVC+Y GVFCAPA D+P
Sbjct  86   VYSDPQNMTANWVGADVCSYIGVFCAPALDDP  117



>ref|XP_006406541.1| hypothetical protein EUTSA_v10022433mg, partial [Eutrema salsugineum]
 gb|ESQ47994.1| hypothetical protein EUTSA_v10022433mg, partial [Eutrema salsugineum]
Length=351

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D E  ++ RRQLL   +  GD  + +   VD  L F N+R++ AYIALQAWK+A+ SD
Sbjct  31   LTDEEASFLTRRQLLALSEN-GDLPDDMEYEVDLDLNFANNRLKRAYIALQAWKKAVYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPD  470
            P NTT++W G +VC+Y GVFCAPA D
Sbjct  90   PFNTTANWFGPNVCSYKGVFCAPALD  115



>ref|XP_006409498.1| hypothetical protein EUTSA_v10023190mg, partial [Eutrema salsugineum]
 gb|ESQ50951.1| hypothetical protein EUTSA_v10023190mg, partial [Eutrema salsugineum]
Length=518

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL    E GD  + +   VD  +TF  +R++ AYIALQAWK+A+ SD
Sbjct  1    LTDAEASFIAQRQLLTL-PENGDLPDDIEYEVDLKVTFAKNRLKRAYIALQAWKKAVFSD  59

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  60   PFNTTGNWHGPHVCGYTGVFCAPALDDP  87



>ref|XP_004242113.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Solanum 
lycopersicum]
Length=493

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  237  HYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDW  416
            +YI   ++   R      G+ + ++PS + EN R++NAYIALQAWK+ I+SDP N T +W
Sbjct  35   NYIDHIEISNSRKLLSYNGDVLAINPSFSIENFRLKNAYIALQAWKEVILSDPHNITQNW  94

Query  417  VGSDVCNYTGVFCAPAPDNP  476
            VGS+VC+YTGVFC+P+ D P
Sbjct  95   VGSNVCSYTGVFCSPSLDQP  114



>ref|XP_010467332.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=727

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   +  E  D  E   VD  +TF N+R++ AYIALQAWK+A+ SD
Sbjct  51   LTDAEASFIAQRQLLTLPENGELPDDIE-YEVDLKVTFANNRLKRAYIALQAWKKAVYSD  109

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  110  PFNTTGNWHGPHVCGYTGVFCAPALDDP  137



>ref|XP_010473463.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Camelina sativa]
Length=718

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  291  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  470
            G+ + VDPSLTFEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P 
Sbjct  41   GDGIKVDPSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPS  100

Query  471  N  473
            +
Sbjct  101  S  101



>ref|XP_010473462.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Camelina sativa]
Length=734

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  291  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  470
            G+ + VDPSLTFEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P 
Sbjct  41   GDGIKVDPSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPS  100

Query  471  N  473
            +
Sbjct  101  S  101



>ref|XP_010431693.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Camelina 
sativa]
Length=743

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  291  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPD  470
            G+ + VDPSLTFEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P 
Sbjct  47   GDGIKVDPSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPS  106

Query  471  N  473
            +
Sbjct  107  S  107



>ref|XP_004138582.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Cucumis sativus]
Length=613

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            LS++E  Y+ RRQLL  +  DE      +  +D   TF N+R++ AY ALQAWK A+ SD
Sbjct  31   LSEAEASYLTRRQLLTLKNYDEL-PLDFQYELDIPDTFPNERLKKAYRALQAWKLAVYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P+N T++WVG+DVC+YTGVFCAPA D+P
Sbjct  90   PQNMTANWVGADVCSYTGVFCAPALDDP  117



>ref|XP_006417273.1| hypothetical protein EUTSA_v10006975mg [Eutrema salsugineum]
 gb|ESQ35626.1| hypothetical protein EUTSA_v10006975mg [Eutrema salsugineum]
Length=691

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 1/67 (1%)
 Frame = +3

Query  273  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  452
            DE G  G  + VDP L FEN ++R+AYIALQ+WKQAI SDP N T++W GSDVC+Y G++
Sbjct  30   DESG-LGSHIKVDPKLKFENPKLRDAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIY  88

Query  453  CAPAPDN  473
            CAP+PD+
Sbjct  89   CAPSPDS  95



>ref|XP_010461787.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Camelina sativa]
Length=905

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  306  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            VDP+L FENDR++ AYIALQAWK+AI SDP  TTS+WVGS+VC+Y GV+CAPA D+P
Sbjct  53   VDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVYCAPALDDP  109



>ref|XP_002885986.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62245.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   +  E  D  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  19   LTDAEASFIAQRQLLTLPENGELPDDIE-YEVDLKVTFANHRLKRAYIALQAWKKAVYSD  77

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  78   PFNTTGNWHGPHVCGYTGVFCAPALDDP  105



>emb|CDY54073.1| BnaA07g36350D [Brassica napus]
Length=649

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERV--TVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   ++ GD  E +   VD  LTF N R++ AYIALQAWK+A+ SD
Sbjct  31   LTDAEASFIAQRQLLTLPED-GDLPENIEYKVDIKLTFPNQRLKRAYIALQAWKKAVYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC+YTGV CAPA D+P
Sbjct  90   PFNTTGNWHGPHVCDYTGVVCAPALDDP  117



>ref|XP_010064140.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Eucalyptus grandis]
Length=580

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFG-DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDP  395
            LS SE   I RRQLL  R+     R     V+ + TF N R+R AYIAL+AWK+A+ SDP
Sbjct  25   LSTSEASLIARRQLLALRENTKLPRNYEYVVEVNETFANSRLRRAYIALRAWKEAMYSDP  84

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             NTT +WVG  VC Y GVFC+PA D+P
Sbjct  85   LNTTGNWVGPGVCEYNGVFCSPALDDP  111



>ref|XP_009136284.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=861

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL    E GD  + +   VD   TF N+R++ AYIALQAWK+A+ SD
Sbjct  31   LTDAEASFIAQRQLLTL-PENGDLPDDIEYEVDLKETFANNRLKRAYIALQAWKKAVYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  90   PFNTTGNWHGPHVCGYTGVFCAPALDDP  117



>ref|XP_006372265.1| hypothetical protein POPTR_0018s14790g [Populus trichocarpa]
 gb|ERP50062.1| hypothetical protein POPTR_0018s14790g [Populus trichocarpa]
Length=461

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  300  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            + VD +L FEN RIR AYIALQ+WKQAI SDP N T++W GSDVC+Y GVFCAP+P N
Sbjct  35   INVDSTLKFENPRIRRAYIALQSWKQAIFSDPFNFTANWNGSDVCSYMGVFCAPSPKN  92



>ref|XP_010999749.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Populus euphratica]
Length=1004

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E   I RRQLL   +  E  D  E   VD   TF N R+R AYI LQAWK+A+ SD
Sbjct  28   LTDAEASSIARRQLLTLHENGELPDDFE-YEVDVKETFANQRLRRAYIGLQAWKKAMYSD  86

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P NTT +WVG+DVC Y GVFCAPA D+
Sbjct  87   PFNTTGNWVGADVCAYNGVFCAPALDD  113



>ref|XP_010520859.1| PREDICTED: leucine-rich repeat extensin-like protein 7 [Tarenaya 
hassleriana]
Length=452

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 6/83 (7%)
 Frame = +3

Query  228  SEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTT  407
            + VH    RQLLY +D        V+V P L F N+R+  AY+ALQAWK+ +ISDP N T
Sbjct  22   ATVHGSGIRQLLYTKDG------PVSVPPFLIFGNERLERAYVALQAWKRVMISDPFNLT  75

Query  408  SDWVGSDVCNYTGVFCAPAPDNP  476
            ++W GS VCNYTG+FC+P+ D+P
Sbjct  76   ANWEGSSVCNYTGIFCSPSLDDP  98



>ref|XP_010507380.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X1 [Camelina sativa]
Length=907

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D E  ++ RRQLL    E GD  + +   V   L F+N+R++ AYIALQAWK+AI SD
Sbjct  31   LTDEEASFLTRRQLLALS-ENGDLPDDMEYEVHLDLKFDNNRLKRAYIALQAWKKAIYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NT  +WVG +VC+Y GVFCAPA D+P
Sbjct  90   PFNTAGNWVGPNVCSYKGVFCAPALDDP  117



>ref|XP_010507385.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 isoform X2 [Camelina sativa]
Length=891

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D E  ++ RRQLL    E GD  + +   V   L F+N+R++ AYIALQAWK+AI SD
Sbjct  31   LTDEEASFLTRRQLLALS-ENGDLPDDMEYEVHLDLKFDNNRLKRAYIALQAWKKAIYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NT  +WVG +VC+Y GVFCAPA D+P
Sbjct  90   PFNTAGNWVGPNVCSYKGVFCAPALDDP  117



>ref|XP_006379216.1| hypothetical protein POPTR_0009s11130g [Populus trichocarpa]
 gb|ERP57013.1| hypothetical protein POPTR_0009s11130g [Populus trichocarpa]
Length=1117

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E   I RRQLL   +  E  D  E   VD   TF N R+R AYI LQAWK+A+ SD
Sbjct  28   LTDAEASSIARRQLLTLHENGELPDDFE-YEVDVKETFANQRLRRAYIGLQAWKKAMYSD  86

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P NTT +WVG+DVC Y GVFCAPA D+
Sbjct  87   PFNTTGNWVGADVCAYNGVFCAPALDD  113



>ref|XP_011018198.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 2 [Populus euphratica]
Length=576

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  309  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            DP+L FEN RIR AYIALQ+WKQAI SDP N T++W GSDVC+Y GVFCAP+P N
Sbjct  42   DPTLKFENPRIRXAYIALQSWKQAIFSDPFNFTANWNGSDVCSYMGVFCAPSPKN  96



>sp|O48809.1|LRX2_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 2; Short=AtLRX2; 
Short=LRR/EXTENSIN2; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD43602.1|AC005698_1 T3P18.1 [Arabidopsis thaliana]
 gb|AAF70841.1|AC003113_8 F24O1.18 [Arabidopsis thaliana]
Length=786

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  300  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P +P
Sbjct  40   IKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSP  98



>ref|XP_010487832.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Camelina sativa]
Length=923

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%), Gaps = 7/90 (8%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE----RVTVDPSLTFENDRIRNAYIALQAWKQAII  386
            L+D E  ++ RRQLL    E GD  +     V +D  L F+N+R++ AYIALQAWK+AI 
Sbjct  31   LTDEEASFLTRRQLLAL-SENGDLPDDMEYEVHLD--LKFDNNRLKRAYIALQAWKKAIY  87

Query  387  SDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            SDP NT ++WVG ++C+Y GVFCAPA D+P
Sbjct  88   SDPFNTAANWVGPNLCSYKGVFCAPALDDP  117



>ref|NP_175372.1| Leucine-rich repeat family protein [Arabidopsis thaliana]
 sp|Q9XIB6.1|PLRX2_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 2; Short=AtPEX2; Short=Pollen-specific LRR/EXTENSIN2; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD43152.1|AC007504_7 Hypothetical Protein [Arabidopsis thaliana]
 gb|AEE32435.1| Leucine-rich repeat family protein [Arabidopsis thaliana]
Length=847

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  306  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  464
            VDP+L FENDR++ AYIALQAWK+AI SDP  TT++WVGSDVC+Y GV+CAPA
Sbjct  48   VDPNLKFENDRLKRAYIALQAWKKAIYSDPFKTTANWVGSDVCSYNGVYCAPA  100



>ref|NP_176434.1| leucine-rich repeat extensin-like protein 2 [Arabidopsis thaliana]
 gb|AEE33968.1| leucine-rich repeat/extensin 2 [Arabidopsis thaliana]
Length=826

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +3

Query  300  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P +P
Sbjct  80   IKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSP  138



>ref|XP_004290381.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Fragaria vesca subsp. vesca]
Length=542

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+++E  YI +RQLL    E GD  +   +TVDP LTF NDR+++AY+ L A K  I SD
Sbjct  31   LTNAEAAYIAKRQLLTL-PENGDLPDNYEITVDPKLTFANDRLKSAYVGLHALKDVIYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T++W G DVC Y GV C+PA DNP
Sbjct  90   PTNFTANWEGPDVCKYNGVVCSPALDNP  117



>ref|XP_004138583.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4-like, partial [Cucumis sativus]
Length=517

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 45/88 (51%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYR--DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            +S +EV YI +RQLL  +  D+  D   +  +D   TF N+R++ AY+ALQAWK A+ SD
Sbjct  7    VSQAEVSYITQRQLLTLKEHDQLPD-DFKYELDIPDTFPNERLKKAYVALQAWKLAVYSD  65

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P+N T +WVG++VC+Y GVFCAPA D+P
Sbjct  66   PKNMTVNWVGANVCSYNGVFCAPALDDP  93



>gb|KJB74831.1| hypothetical protein B456_012G009700 [Gossypium raimondii]
Length=602

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  306  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            VDP+L FEN R+R AYIALQAWK AI SDP N T++W GSDVC+Y G++CAP+P NP
Sbjct  31   VDPNLRFENPRLREAYIALQAWKSAIFSDPFNFTANWNGSDVCSYMGIYCAPSPSNP  87



>emb|CDY26536.1| BnaA09g47410D [Brassica napus]
Length=670

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +3

Query  285  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  464
            D G+ + VDP L FEN ++R AYIALQ+WKQ I SDP N T++W GSDVC+Y G++CAP+
Sbjct  114  DLGDHIKVDPKLKFENPKLREAYIALQSWKQTIFSDPFNFTANWNGSDVCSYNGIYCAPS  173

Query  465  PDN  473
            P++
Sbjct  174  PNS  176



>ref|XP_007017392.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14617.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=911

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGD--RGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            LSDSEV +I RRQLL    E GD        V+ +LTFEN R+R AYIALQA K AI SD
Sbjct  32   LSDSEVAFIARRQLLTL-PENGDLPHDYEYNVELNLTFENSRLRRAYIALQALKHAIYSD  90

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P  TT +W G  VCNY GVFCAPA D+P
Sbjct  91   PLKTTQNWKGPKVCNYKGVFCAPAVDDP  118



>emb|CDX89681.1| BnaC03g45950D [Brassica napus]
Length=784

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL    E GD  + +   VD   TF N+R++ AYIALQAWK+A+ SD
Sbjct  27   LTDAEASFIAQRQLLTL-PENGDLPDDIEYEVDLKETFANNRLKRAYIALQAWKKAVYSD  85

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  86   PFNTTGNWHGPHVCGYTGVFCAPALDDP  113



>ref|XP_009118084.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Brassica rapa]
Length=694

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE-----RVTVDPSLTFENDRIRNAYIALQAWKQAI  383
            +SDSE  ++ RRQLL    E GD GE        VD   TF N R++ AYIALQAWK+AI
Sbjct  28   ISDSEAAFLVRRQLLTL-PENGD-GELPDDIEYEVDLKATFANTRLKKAYIALQAWKKAI  85

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             SDP NTT++W G  VC YTGV CAPA D+P
Sbjct  86   YSDPFNTTANWHGPHVCAYTGVVCAPALDDP  116



>gb|AID60115.1| leucine-rich repeat (LRR) family protein [Brassica napus]
 gb|AID60158.1| leucine-rich repeat (LRR) family protein [Brassica napus]
 emb|CDX75393.1| BnaA01g03090D [Brassica napus]
Length=666

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE-----RVTVDPSLTFENDRIRNAYIALQAWKQAI  383
            +SDSE  ++ RRQLL    E GD GE        VD   TF N R++ AYIALQAWK+AI
Sbjct  28   ISDSEAAFLVRRQLLTL-PENGD-GELPDDIEYEVDLKATFANTRLKKAYIALQAWKKAI  85

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             SDP NTT++W G  VC YTGV CAPA D+P
Sbjct  86   YSDPFNTTANWHGPHVCAYTGVVCAPALDDP  116



>ref|XP_006300291.1| hypothetical protein CARUB_v100136950mg, partial [Capsella rubella]
 gb|EOA33189.1| hypothetical protein CARUB_v100136950mg, partial [Capsella rubella]
Length=395

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   +  E  D  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  34   LTDAEASFIPQRQLLTLPENGELPDDIEY-EVDLKVTFANHRLKRAYIALQAWKKAVYSD  92

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCA A D+P
Sbjct  93   PFNTTGNWHGPHVCGYTGVFCASALDDP  120



>ref|XP_007014601.1| Leucine-rich repeat/extensin 2 [Theobroma cacao]
 gb|EOY32220.1| Leucine-rich repeat/extensin 2 [Theobroma cacao]
Length=748

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  300  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            V VDP+L FEN R+R AYIALQAWK AI SDP N T++W G DVC+Y G++CAP+P NP
Sbjct  36   VVVDPNLRFENPRLREAYIALQAWKSAIFSDPFNFTANWDGPDVCSYMGIYCAPSPSNP  94



>ref|XP_009108764.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Brassica rapa]
Length=670

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            +S++E  ++ RRQLL    E G+    +   VD   TF N R++ AYIALQAWK+AI SD
Sbjct  34   ISETEAAFLVRRQLLTL-PENGELPNDIEYEVDLKATFANSRLKKAYIALQAWKKAIYSD  92

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VCNYTGV CAPA D+P
Sbjct  93   PFNTTGNWHGPHVCNYTGVICAPALDDP  120



>emb|CDY51948.1| BnaA08g11700D [Brassica napus]
Length=660

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            +S++E  ++ RRQLL    E G+    +   VD   TF N R++ AYIALQAWK+AI SD
Sbjct  34   ISETEAAFLVRRQLLTL-PENGELPNDIEYEVDLKATFANSRLKKAYIALQAWKKAIYSD  92

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VCNYTGV CAPA D+P
Sbjct  93   PFNTTGNWHGPHVCNYTGVICAPALDDP  120



>ref|XP_007042323.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOX98154.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=726

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 49/88 (56%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSL--TFENDRIRNAYIALQAWKQAIISD  392
            LSD+E  YI  RQLL    E G+  E    +  +  TF N R++ AYIALQAWK+A+ SD
Sbjct  30   LSDAEASYIAHRQLLTL-PENGELPEDFEYEVKIVETFANQRLKRAYIALQAWKKAMYSD  88

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +WVG +VC YTGVFCAPA D+P
Sbjct  89   PLNTTGNWVGPNVCAYTGVFCAPALDDP  116



>ref|XP_006494306.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Citrus sinensis]
Length=1091

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 4/86 (5%)
 Frame = +3

Query  225  DSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLT---FENDRIRNAYIALQAWKQAIISDP  395
            D+E  ++ RRQLL    + G   + +  +  L    F NDR++ AY+ALQA+K+AI SDP
Sbjct  26   DAEAAFLVRRQLLTLPQD-GKLPDNIENEYDLKNKYFSNDRLKKAYVALQAFKKAIYSDP  84

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDN  473
             NTT +WVG+DVC+Y GVFCAPAPDN
Sbjct  85   FNTTGNWVGTDVCSYNGVFCAPAPDN  110



>ref|XP_006303848.1| hypothetical protein CARUB_v10012584mg [Capsella rubella]
 gb|EOA36746.1| hypothetical protein CARUB_v10012584mg [Capsella rubella]
Length=852

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +3

Query  306  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            VDP+L FENDR++ AYIALQAWK+AI SDP  TTS+WVGS+VC+Y GVFCAPA DNP
Sbjct  55   VDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTSNWVGSNVCSYNGVFCAPALDNP  111



>emb|CDY53352.1| BnaA06g38270D [Brassica napus]
Length=641

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +3

Query  282  GDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAP  461
            G  G R+ VDP L FEN ++R AYIALQ+WKQAI SDP N T++W GSDVC+Y G++CAP
Sbjct  27   GVLGSRIKVDPKLKFENPKLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIYCAP  86

Query  462  AP  467
             P
Sbjct  87   FP  88



>gb|KDP43798.1| hypothetical protein JCGZ_23006 [Jatropha curcas]
Length=834

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 4/79 (5%)
 Frame = +3

Query  249  RRQLLYYRDEFGDRGERVTVDP----SLTFENDRIRNAYIALQAWKQAIISDPRNTTSDW  416
            RR+ L+++D+     + VT+      SL F+N RI +AYIALQ WK++IISDP+N T++W
Sbjct  39   RRKPLHFKDKVDSINDYVTLSSKSSASLEFDNPRIDSAYIALQKWKRSIISDPKNLTANW  98

Query  417  VGSDVCNYTGVFCAPAPDN  473
            VG DVCNYTG+FC  APD+
Sbjct  99   VGFDVCNYTGIFCWAAPDD  117



>ref|XP_006391867.1| hypothetical protein EUTSA_v10023291mg [Eutrema salsugineum]
 gb|ESQ29153.1| hypothetical protein EUTSA_v10023291mg [Eutrema salsugineum]
Length=778

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  273  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  452
            D  G  G+   VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G++
Sbjct  32   DNSGINGDDFKVDPSLNFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIY  91

Query  453  CAPAP  467
            CAP+P
Sbjct  92   CAPSP  96



>emb|CDY12948.1| BnaA09g13260D [Brassica napus]
Length=714

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  294  ERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            + + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y GV+CAP+P  
Sbjct  36   DNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGVYCAPSPSR  95

Query  474  P  476
            P
Sbjct  96   P  96



>ref|XP_010418239.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Camelina 
sativa]
Length=722

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  306  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            VDPSLTFEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+P +
Sbjct  41   VDPSLTFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSS  96



>ref|XP_010040127.1| PREDICTED: leucine-rich repeat extensin-like protein 2, partial 
[Eucalyptus grandis]
Length=439

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  300  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            V +D SL FEN R+R AYIALQAWKQAI SDP N T++W G +VC+Y GVFCAP+P N
Sbjct  34   VKLDLSLKFENGRLRKAYIALQAWKQAIFSDPFNFTANWHGPNVCSYKGVFCAPSPSN  91



>ref|XP_009113078.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Brassica rapa]
 ref|XP_009113079.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X3 [Brassica rapa]
Length=723

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  294  ERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            + + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y GV+CAP+P  
Sbjct  36   DNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGVYCAPSPSR  95

Query  474  P  476
            P
Sbjct  96   P  96



>ref|XP_009113077.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Brassica rapa]
Length=737

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  294  ERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            + + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y GV+CAP+P  
Sbjct  36   DNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGVYCAPSPSR  95

Query  474  P  476
            P
Sbjct  96   P  96



>ref|XP_009350755.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Pyrus x bretschneideri]
 ref|XP_009350758.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Pyrus x bretschneideri]
Length=702

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+++E  +I  RQL     E GD  +   V VD  L FENDR++ AY+ALQA K+AI SD
Sbjct  32   LTNAEAAHIAHRQLTSL-PENGDLPDNYEVQVDAKLKFENDRLKRAYVALQAQKKAIFSD  90

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T++WVG +VC Y GVFCAPA DNP
Sbjct  91   PFNFTANWVGENVCAYKGVFCAPALDNP  118



>ref|XP_002308630.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
 gb|EEE92153.2| hypothetical protein POPTR_0006s26190g [Populus trichocarpa]
Length=487

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  318  LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            L F+N R+R+AYIALQAWK AIISDP N TS+WVGSDVCNYTGVFCA + DN
Sbjct  6    LKFDNPRLRSAYIALQAWKLAIISDPLNLTSNWVGSDVCNYTGVFCATSLDN  57



>emb|CDY02276.1| BnaA03g38910D [Brassica napus]
Length=605

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL    E GD  + +   VD   TF N+R++ AYIALQAWK+A+ SD
Sbjct  27   LTDAEASFIAQRQLLTL-PENGDLPDDIEYEVDLKETFANNRLKRAYIALQAWKKAVYSD  85

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  86   PFNTTGNWHGPHVCGYTGVFCAPALDDP  113



>gb|EPS72402.1| hypothetical protein M569_02357, partial [Genlisea aurea]
Length=395

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +3

Query  300  VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            + VDP L FEN R++NAYIALQ+WK+AI+SDP N T++W+G DVC+Y G+FC  +PDN
Sbjct  1    LAVDPRLKFENPRLQNAYIALQSWKEAILSDPNNITANWIGPDVCDYNGIFCWTSPDN  58



>emb|CDY51859.1| BnaC03g77110D [Brassica napus]
Length=657

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 57/91 (63%), Gaps = 9/91 (10%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE-----RVTVDPSLTFENDRIRNAYIALQAWKQAI  383
            +S +E  ++ RRQLL       + GE        VD   TF N R++ AYIALQAWK+AI
Sbjct  34   ISQTEAAFLVRRQLL----TLPENGELPNDIEYEVDLKATFANSRLKKAYIALQAWKKAI  89

Query  384  ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             SDP NTT +W G  VCNYTGV CAPA D+P
Sbjct  90   YSDPFNTTGNWHGPHVCNYTGVICAPALDDP  120



>ref|XP_003629650.1| Receptor-like protein kinase [Medicago truncatula]
Length=661

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  309  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +PSL FEN+RI+NAYIALQA KQAI+SDP N T++WVGS+VC+YTG++CA A DNP
Sbjct  29   NPSLVFENNRIQNAYIALQALKQAILSDPLNFTTNWVGSNVCSYTGIYCAQALDNP  84



>emb|CDY18563.1| BnaA01g26320D [Brassica napus]
Length=638

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L++ E  ++ +RQLL   +  +  D  E   VD +L F N R++ AYIALQAWK+AI SD
Sbjct  31   LTNEETSFLTKRQLLALSENEDLSDDMEY-EVDLNLKFANTRLKRAYIALQAWKKAIYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPD  470
            P NT+++W+G +VC+Y GVFCAPA D
Sbjct  90   PFNTSANWIGQNVCSYKGVFCAPALD  115



>ref|XP_009345516.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Pyrus x bretschneideri]
Length=710

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+++E  +I  RQL     E GD  +   V VD  L FENDR++ AY+ALQA K+AI SD
Sbjct  32   LTNAEAAHIAHRQLTSL-PENGDLPDNYEVQVDAKLKFENDRLKRAYVALQAQKKAIFSD  90

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T++WVG +VC Y GVFCAPA DNP
Sbjct  91   PFNFTANWVGENVCAYKGVFCAPALDNP  118



>ref|XP_002888025.1| hypothetical protein ARALYDRAFT_475099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64284.1| hypothetical protein ARALYDRAFT_475099 [Arabidopsis lyrata subsp. 
lyrata]
Length=713

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +3

Query  306  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FC+P+P +P
Sbjct  15   VDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCSPSPSSP  71



>ref|XP_002885290.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61549.1| hypothetical protein ARALYDRAFT_479420 [Arabidopsis lyrata subsp. 
lyrata]
Length=927

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D E  ++ RRQLL    E GD  + +   VD  L F N+R++ AYIALQAWK+A  SD
Sbjct  26   LTDEEASFLTRRQLLAL-SENGDLPDDMEYEVDLDLKFANNRLKRAYIALQAWKKAFYSD  84

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NT ++WVG DVC+Y GVFCAPA D+P
Sbjct  85   PFNTAANWVGPDVCSYKGVFCAPALDDP  112



>ref|XP_010669462.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Beta 
vulgaris subsp. vulgaris]
Length=839

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  285  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCA  458
            D  E V VDPS  FENDR+R AYI LQAWK A++SDP N T +WVG DVC+Y G+FCA
Sbjct  75   DGPEGVKVDPSYQFENDRLRKAYIGLQAWKNAMLSDPSNFTGNWVGPDVCSYNGIFCA  132



>ref|XP_010647882.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Vitis vinifera]
Length=719

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +3

Query  225  DSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            D+E   I RRQLL   ++ GD  +     +D  +TF N R+R AYIALQAWK A+ SDP 
Sbjct  32   DAEASLIARRQLLSLPED-GDLPDDFEYEIDLVVTFANSRLRRAYIALQAWKNAMYSDPF  90

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            NTT +WVG++VC Y GVFCAPA D+
Sbjct  91   NTTGNWVGANVCAYNGVFCAPALDD  115



>emb|CBI32495.3| unnamed protein product [Vitis vinifera]
Length=772

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +3

Query  225  DSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            D+E   I RRQLL   ++ GD  +     +D  +TF N R+R AYIALQAWK A+ SDP 
Sbjct  32   DAEASLIARRQLLSLPED-GDLPDDFEYEIDLVVTFANSRLRRAYIALQAWKNAMYSDPF  90

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDN  473
            NTT +WVG++VC Y GVFCAPA D+
Sbjct  91   NTTGNWVGANVCAYNGVFCAPALDD  115



>gb|KJB77687.1| hypothetical protein B456_012G150700 [Gossypium raimondii]
Length=546

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 50/87 (57%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQL--LYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  YI RRQL  L   DE     E   V  SLTF N R++ AYI LQA K+AI SD
Sbjct  38   LTDAEAAYIVRRQLKTLPPNDELPPEVE-YEVKVSLTFSNQRLKKAYIGLQALKKAIYSD  96

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P N T DWVGS+VCNYTGVFC+ A D+
Sbjct  97   PMNKTGDWVGSNVCNYTGVFCSEALDD  123



>gb|EYU25784.1| hypothetical protein MIMGU_mgv1a026389mg, partial [Erythranthe 
guttata]
Length=390

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  318  LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            L+FEN  +R AYIALQAWKQ+I SDP N TSDW GSDVC+Y GVFCAPA  NP
Sbjct  41   LSFENPNLRQAYIALQAWKQSIFSDPFNFTSDWTGSDVCSYGGVFCAPATTNP  93



>gb|AGT16383.1| hypothetical protein SHCRBa_052_I12_F_230 [Saccharum hybrid cultivar 
R570]
Length=641

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +3

Query  222  SDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSL--TFENDRIRNAYIALQAWKQAIISDP  395
            SD+E   I RRQLL  R+  GD  +    D  +  TF NDR+R AY+ALQAW++A+ SDP
Sbjct  44   SDAEASNIARRQLLSLREGDGDLPDDFEFDIHVDVTFANDRLRRAYVALQAWRRAMYSDP  103

Query  396  RNTTSDWVGSDVCNYTGVFCAPAPDN  473
            +N T  WVG+DVC+Y G+ C PA D+
Sbjct  104  KNFTGGWVGADVCSYFGITCVPALDD  129



>ref|XP_010530870.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Tarenaya hassleriana]
Length=634

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  ++  RQLL   +  E  D  E   VD  +TF N R++ AYIALQAWK+AI SD
Sbjct  30   LTDAEASFLAHRQLLALPENGELPDDLE-FEVDLKVTFANSRLKRAYIALQAWKKAIYSD  88

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P NTT +W G  VC Y GVFCAPA D+
Sbjct  89   PFNTTGNWFGPHVCGYNGVFCAPALDD  115



>ref|NP_001043463.1| Os01g0594300 [Oryza sativa Japonica Group]
 dbj|BAD52898.1| extensin precursor-like [Oryza sativa Japonica Group]
 dbj|BAD53165.1| extensin precursor-like [Oryza sativa Japonica Group]
 dbj|BAF05377.1| Os01g0594300 [Oryza sativa Japonica Group]
Length=551

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  246  QRRQLL-YYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVG  422
            QRR+LL Y+    G  G  V VDPS TF N R+R+AY+A+QAWK+A++SDP N T  W+G
Sbjct  38   QRRRLLDYHGGGGGHGGGDVYVDPSYTFPNARLRDAYVAMQAWKRAVLSDPHNVTGTWIG  97

Query  423  SDVCNYTGVFCAPAPDNP  476
             DVC Y GVFCA A D+P
Sbjct  98   PDVCAYEGVFCAAARDDP  115



>emb|CDX95474.1| BnaC01g33660D [Brassica napus]
Length=691

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L++ E  ++ +RQLL   +  +  D  E   VD +L F N R++ AYIALQAWK+AI SD
Sbjct  31   LTNEETSFLTKRQLLALSENEDLSDDMEY-EVDLNLKFANTRLKRAYIALQAWKKAIYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P NT+++W+G +VC+Y GVFCAPA D+
Sbjct  90   PFNTSANWIGQNVCSYKGVFCAPALDD  116



>gb|KJB47441.1| hypothetical protein B456_008G026700 [Gossypium raimondii]
Length=607

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  225  DSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            D+E  Y+ +RQLL   +  E  D G    V  +L F+N R+R AYIALQAWK+A+ SDP+
Sbjct  32   DAEASYLSQRQLLTLPENGELPD-GFEFQVQINLKFDNSRLRRAYIALQAWKKAMYSDPK  90

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            N T++WVG +VC Y+GVFCA A D+P
Sbjct  91   NITNNWVGPNVCGYSGVFCAQALDDP  116



>ref|XP_010533784.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X1 [Tarenaya hassleriana]
Length=810

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  291  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAP  467
            G+ V VDPSL FEN ++R AYIALQAWK AI SDP N T++W GSDVC+Y G+FCAP P
Sbjct  29   GDDVRVDPSLRFENPKLRQAYIALQAWKLAIFSDPFNFTANWNGSDVCSYNGIFCAPLP  87



>dbj|BAB91812.1| extensin precursor-like [Oryza sativa Japonica Group]
 dbj|BAB92308.1| extensin precursor-like [Oryza sativa Japonica Group]
 dbj|BAG97332.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70999.1| hypothetical protein OsI_02671 [Oryza sativa Indica Group]
Length=570

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +3

Query  246  QRRQLL-YYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVG  422
            QRR+LL Y+    G  G  V VDPS TF N R+R+AY+A+QAWK+A++SDP N T  W+G
Sbjct  38   QRRRLLDYHGGGGGHGGGDVYVDPSYTFPNARLRDAYVAMQAWKRAVLSDPHNVTGTWIG  97

Query  423  SDVCNYTGVFCAPAPDNP  476
             DVC Y GVFCA A D+P
Sbjct  98   PDVCAYEGVFCAAARDDP  115



>emb|CDY19550.1| BnaC09g13530D [Brassica napus]
Length=767

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = +3

Query  258  LLYYRDEFGD---RGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSD  428
             L+ R + G     G+ + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSD
Sbjct  21   FLHTRAQEGQGDISGDNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSD  80

Query  429  VCNYTGVFCAPAPDNP  476
            VC+Y GV+CA +P  P
Sbjct  81   VCSYNGVYCASSPSRP  96



>ref|XP_008225416.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Prunus mume]
Length=777

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E   I RRQLL    E GD  +     V+ +L F N R+R AYIALQAWK+A+ SD
Sbjct  24   LTDAEASSIARRQLLAL-PEGGDLPDHYEFEVELNLNFPNTRLRRAYIALQAWKKAMYSD  82

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P  TT +WVG++VC+YTGVFCA A D+P
Sbjct  83   PLKTTENWVGANVCSYTGVFCAKALDDP  110



>ref|XP_010533785.1| PREDICTED: leucine-rich repeat extensin-like protein 2 isoform 
X2 [Tarenaya hassleriana]
Length=845

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  291  GERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAP  467
            G+ V VDPSL FEN ++R AYIALQAWK AI SDP N T++W GSDVC+Y G+FCAP P
Sbjct  29   GDDVRVDPSLRFENPKLRQAYIALQAWKLAIFSDPFNFTANWNGSDVCSYNGIFCAPLP  87



>gb|AAM13864.1| unknown protein [Arabidopsis thaliana]
Length=712

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D E  ++ RRQLL    E GD  + +   VD  L F N+R++ AYIALQAWK+A  SD
Sbjct  31   LTDEEASFLTRRQLLAL-SENGDLPDDIEYEVDLDLKFANNRLKRAYIALQAWKKAFYSD  89

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NT ++WVG DVC+Y GVFCAPA D+P
Sbjct  90   PFNTAANWVGPDVCSYKGVFCAPALDDP  117



>ref|XP_006342607.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3-like [Solanum tuberosum]
Length=698

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 56/88 (64%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQL--LYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            LSD E   + RRQL  L       D+ E   V+   TF N R+R AYIAL+AWK+AI SD
Sbjct  24   LSDHEASLLARRQLSTLLENGNLPDKYE-FEVNVEYTFPNSRLRRAYIALKAWKEAIYSD  82

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P   TS+W G DVCNY GVFC+PA D+P
Sbjct  83   PSEFTSNWKGPDVCNYKGVFCSPALDDP  110



>ref|NP_195123.1| pollen-specific leucine-rich repeat extensin-like protein 4 [Arabidopsis 
thaliana]
 sp|O81765.1|PLRX4_ARATH RecName: Full=Pollen-specific leucine-rich repeat extensin-like 
protein 4; Short=AtPEX4; Short=Pollen-specific LRR/EXTENSIN4; 
AltName: Full=Cell wall hydroxyproline-rich glycoprotein; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA19879.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB80114.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE86302.1| pollen-specific leucine-rich repeat extensin-like protein 4 [Arabidopsis 
thaliana]
Length=699

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   D  E  D  E   VD   TF N R++ AYIALQAWK+AI SD
Sbjct  45   LTDTEAAFIVQRQLLTLPDNGELPDDIEY-EVDLKATFANTRLKRAYIALQAWKKAIFSD  103

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P NTT +W G  VC YTGV CAPA D+
Sbjct  104  PFNTTGNWHGPHVCGYTGVVCAPALDD  130



>ref|XP_009118117.1| PREDICTED: leucine-rich repeat extensin-like protein 1 [Brassica 
rapa]
Length=584

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  285  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  464
            D G+ + VDP L FEN ++R AYIALQ+WKQ I SDP N T+ W GSDVC+Y G++CAP+
Sbjct  28   DLGDHIKVDPKLKFENPKLREAYIALQSWKQTIFSDPFNFTATWNGSDVCSYNGIYCAPS  87

Query  465  PDN  473
            P++
Sbjct  88   PNS  90



>ref|XP_006838987.1| hypothetical protein AMTR_s00002p00271610 [Amborella trichopoda]
 gb|ERN01556.1| hypothetical protein AMTR_s00002p00271610 [Amborella trichopoda]
Length=487

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +3

Query  312  PSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            PSL F N R++NAYIALQAWK AI+SDP+N T +WVG +VCNYTGV+CA A D+P
Sbjct  33   PSLLFPNPRLQNAYIALQAWKHAIVSDPKNITRNWVGPNVCNYTGVYCARALDDP  87



>ref|XP_010423784.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=1132

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   +  E  D  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  50   LTDAEASFIAQRQLLTLPENGELPDDIE-YEVDLKVTFANHRLKRAYIALQAWKKAVYSD  108

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  109  PFNTTGNWHGPHVCGYTGVFCAPALDDP  136


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  360  LQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
             QAWK+A+ SDP NTT +W G  VC YTGVFCAPA D+P
Sbjct  401  FQAWKKAVYSDPFNTTGNWHGPHVCGYTGVFCAPALDDP  439



>ref|XP_002867142.1| hypothetical protein ARALYDRAFT_491276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43401.1| hypothetical protein ARALYDRAFT_491276 [Arabidopsis lyrata subsp. 
lyrata]
Length=668

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   D  E  D  E   VD   TF N R++ AYIALQAWK+AI SD
Sbjct  28   LTDTEAAFIVQRQLLTLPDNGELPDDIE-YEVDLKATFANTRLKRAYIALQAWKKAIFSD  86

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P NTT +W G  VC+YTGV CAPA D+
Sbjct  87   PFNTTGNWHGPHVCSYTGVVCAPALDD  113



>ref|XP_006300262.1| hypothetical protein CARUB_v100151920mg, partial [Capsella rubella]
 gb|EOA33160.1| hypothetical protein CARUB_v100151920mg, partial [Capsella rubella]
Length=649

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D E  ++ RRQLL    E GD  + +   VD  L F+N+R++ AYIALQAWK+AI SD
Sbjct  2    LTDEEASFLTRRQLLAL-SENGDLPDDMEYEVDVDLKFDNNRLKRAYIALQAWKKAIYSD  60

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NT ++WVG +VC Y GVFCAPA D+P
Sbjct  61   PFNTAANWVGPNVCTYKGVFCAPALDDP  88



>ref|XP_003630813.1| Extensin-like protein [Medicago truncatula]
 gb|AET05289.1| LRR extensin-like protein [Medicago truncatula]
Length=712

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  309  DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +PSL FEN+RI+NAYIALQA KQAI+SDP N T++WVGS+VC+YTG++CA A DNP
Sbjct  29   NPSLVFENNRIQNAYIALQALKQAILSDPLNFTTNWVGSNVCSYTGIYCAQALDNP  84



>ref|XP_011460368.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Fragaria vesca subsp. vesca]
Length=499

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  ++ RRQLL    E GD  E     V  ++ F N R+R AYIALQAWK+AI SD
Sbjct  24   LTDAEASFLTRRQLLTL-PEGGDLPENFENGVQLNMEFPNPRLRRAYIALQAWKKAIYSD  82

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P  TT++WVG DVC+Y GVFC  A D+P
Sbjct  83   PLKTTANWVGPDVCHYKGVFCEKALDDP  110



>ref|XP_002516600.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF45941.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=516

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 3/78 (4%)
 Frame = +3

Query  249  RRQLLYYRDEFGDRGERVTV---DPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWV  419
            +R+LL YR+      + V +     S  F+N R++ AYIALQ+WKQA+ISDP N T++WV
Sbjct  47   QRKLLPYRENVVAADDHVGLGSKTSSFKFDNPRLKTAYIALQSWKQAMISDPNNLTANWV  106

Query  420  GSDVCNYTGVFCAPAPDN  473
            G DVC+YTG+FC  APDN
Sbjct  107  GCDVCSYTGIFCWTAPDN  124



>ref|XP_010664614.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Vitis vinifera]
Length=514

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +3

Query  225  DSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR  398
            D E   I  RQLL    + GD        VD  + F N R+R AYIALQAWK A+ SDP 
Sbjct  27   DEEASLIAHRQLLAIPKD-GDLPNDFEYEVDLVVAFANARLRQAYIALQAWKHAMYSDPF  85

Query  399  NTTSDWVGSDVCNYTGVFCAPAPDNP  476
            NTTS+W G++VC Y GVFCAPA DNP
Sbjct  86   NTTSNWEGANVCAYKGVFCAPALDNP  111



>ref|XP_008361641.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 [Malus domestica]
Length=991

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGE--RVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            LS++E  +I  RQL     E GD  +   V VD +L FENDR++ AY+ALQA K+AI SD
Sbjct  32   LSNAEAAHIAHRQLTSL-PENGDLPDNYEVQVDANLKFENDRLKRAYVALQAQKRAIFSD  90

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T++WVG +VC Y GVFCAPA DNP
Sbjct  91   PFNFTANWVGENVCAYKGVFCAPALDNP  118



>ref|XP_006285576.1| hypothetical protein CARUB_v10007020mg [Capsella rubella]
 gb|EOA18474.1| hypothetical protein CARUB_v10007020mg [Capsella rubella]
Length=700

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYY--RDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL     DE  +  E   VD   TF N R++ AYIALQAWK+AI SD
Sbjct  45   LTDTEAAFIVQRQLLTLPENDELPNDIE-YEVDLKATFANTRLKRAYIALQAWKKAIFSD  103

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P NTT++W G  VC+YTGV CAPA D+
Sbjct  104  PFNTTANWHGPHVCSYTGVVCAPALDD  130



>ref|XP_011019927.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Populus 
euphratica]
Length=773

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/63 (63%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  285  DRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPA  464
            D    + V+P+L FEN RIR AYIALQ+WKQAI SDP N T++W GSDVC+Y G+FCAP+
Sbjct  36   DEDHDIDVNPNLKFENPRIRRAYIALQSWKQAIHSDPFNFTANWKGSDVCSYMGIFCAPS  95

Query  465  PDN  473
            P N
Sbjct  96   PQN  98



>emb|CDY15964.1| BnaC08g41590D [Brassica napus]
Length=588

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +3

Query  273  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  452
            DE G  G  + VDP L FEN ++R AYIALQ+WKQ I SDP N T++W GSDVC+Y G++
Sbjct  25   DESG-LGNHIKVDPKLKFENPKLREAYIALQSWKQTIFSDPFNFTANWNGSDVCSYNGIY  83

Query  453  CAPAPDN  473
            CAP+P++
Sbjct  84   CAPSPNS  90



>ref|XP_004501605.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1-like [Cicer arietinum]
Length=906

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD  392
            LS+ EV +I RRQLL+   E  D  E  T      LTF +  ++ AYIALQAWK+A+ SD
Sbjct  25   LSNEEVSFIARRQLLHLH-ENEDLPENYTDNYTTDLTFPHPGLKRAYIALQAWKKAMYSD  83

Query  393  PRNTTSDWVGSDVCNYTGVFCAPA  464
            P N+T+DWVG DVC+Y GVFCAP+
Sbjct  84   PLNSTADWVGPDVCSYHGVFCAPS  107



>ref|XP_010489184.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=777

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   +  E  D  E   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct  50   LTDAEASFIAQRQLLTLPENGELPDDIE-YEVDLKVTFANHRLKRAYIALQAWKKAVYSD  108

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P NTT +W G  VC YTGVFCAPA D+P
Sbjct  109  PFNTTGNWHGPHVCGYTGVFCAPALDDP  136



>ref|XP_010104364.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Morus 
notabilis]
 gb|EXB99784.1| Pollen-specific leucine-rich repeat extensin-like protein 1 [Morus 
notabilis]
Length=939

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 48/88 (55%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLL--YYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E   I RRQLL  +   +  D  E      +LTF N R++ AYIALQAWK+AI SD
Sbjct  82   LTDAEASSIVRRQLLTLHQHGDLPDDYEYKVDLGNLTFSNSRLKRAYIALQAWKKAIYSD  141

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T  WVG+DVC+Y GVFCAPA D P
Sbjct  142  PLNITGGWVGTDVCSYNGVFCAPALDEP  169



>gb|KDO52192.1| hypothetical protein CISIN_1g035831mg, partial [Citrus sinensis]
Length=443

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (66%), Gaps = 19/97 (20%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLY----------YRDEFGDRGERVTVDPSLTFENDRIRNAYIALQA  368
            LSD+E  +I RRQLL           + DE+G + +        TF N+R++ AY+ALQA
Sbjct  25   LSDAEAAFITRRQLLTLPKDGKLPDNFDDEYGLKNK--------TFANERLKKAYVALQA  76

Query  369  WKQAIISDPRNTTSDWV-GSDVCNYTGVFCAPAPDNP  476
            +K++I SDP NTT++WV  +DVC+Y GVFCAPA D+P
Sbjct  77   FKKSIYSDPFNTTANWVDNTDVCSYNGVFCAPALDDP  113



>ref|XP_006393251.1| hypothetical protein EUTSA_v10012214mg [Eutrema salsugineum]
 gb|ESQ30537.1| hypothetical protein EUTSA_v10012214mg [Eutrema salsugineum]
Length=811

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  306  VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            +DP+L FENDR++ AYIALQAWK+AI SDP  TT +WVGSDVC+Y GV+CA A D+P
Sbjct  49   IDPNLRFENDRLKRAYIALQAWKKAIYSDPFKTTKNWVGSDVCSYNGVYCAEALDDP  105



>ref|XP_009402787.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1, partial [Musa acuminata subsp. malaccensis]
Length=813

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPS--LTFENDRIRNAYIALQAWKQAIISD  392
            LS++E  +I RRQLL      GD  +    D    L F N R+R AYIALQAW+ A+ SD
Sbjct  24   LSNAEAAWIARRQLLAL-SRGGDLPDDFEFDIKIDLDFANARLRRAYIALQAWRHAMYSD  82

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDNP  476
            P N T +WVG DVC+Y GVFC+PA DNP
Sbjct  83   PFNFTGNWVGRDVCSYNGVFCSPALDNP  110



>ref|NP_172668.1| leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana]
 sp|O65375.1|LRX1_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 1; Short=AtLRX1; 
Short=LRR/EXTENSIN1; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC17609.1| Strong similarity to extensin-like protein gb|Z34465 from Zea 
mays [Arabidopsis thaliana]
 gb|AAK07681.1| leucine-rich repeat/extensin 1 [Arabidopsis thaliana]
 gb|AEE28829.1| leucine-rich repeat extensin-like protein 1 [Arabidopsis thaliana]
Length=744

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  270  RDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGV  449
             D+  D G  + VD  L FEN ++R AYIALQ+WK+AI SDP N T++W GSDVC+Y G+
Sbjct  28   HDDESDLGSDIKVDKRLKFENPKLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGI  87

Query  450  FCAPAPDNP  476
            +CAP+P  P
Sbjct  88   YCAPSPSYP  96



>gb|KFK27830.1| hypothetical protein AALP_AA8G435400 [Arabis alpina]
Length=446

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 6/75 (8%)
 Frame = +3

Query  252  RQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV  431
            RQLLY RD        +TV P L FEN+R+  AY+ALQAWKQA+ISDP N T +W GS V
Sbjct  31   RQLLYSRDN------PITVPPYLIFENERLERAYVALQAWKQAMISDPWNLTLNWFGSRV  84

Query  432  CNYTGVFCAPAPDNP  476
            C+Y GV C+ + D+P
Sbjct  85   CDYNGVVCSSSIDDP  99



>gb|ADA62506.1| c-myc tagged LRX1 [synthetic construct]
Length=834

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +3

Query  273  DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF  452
            D+  D G  + VD  L FEN ++R AYIALQ+WK+AI SDP N T++W GSDVC+Y G++
Sbjct  29   DDESDLGSDIKVDKRLKFENPKLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIY  88

Query  453  CAPAPDNP  476
            CAP+P  P
Sbjct  89   CAPSPSYP  96



>ref|XP_010437689.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 isoform X2 [Camelina sativa]
 ref|XP_010437691.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 4 isoform X3 [Camelina sativa]
Length=762

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 3/87 (3%)
 Frame = +3

Query  219  LSDSEVHYIQRRQLLYYRD--EFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISD  392
            L+D+E  +I +RQLL   +  E  D  E   VD   TF N R++ AYIALQAWK+AI SD
Sbjct  45   LTDTEAAFIVQRQLLTLPENGELPDDIEY-EVDLKATFANTRLKKAYIALQAWKKAIYSD  103

Query  393  PRNTTSDWVGSDVCNYTGVFCAPAPDN  473
            P NTT +W G  VC+YTGV CAPA D+
Sbjct  104  PFNTTGNWHGPHVCSYTGVVCAPALDD  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552245584395