BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS158G01

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629595.1|  PREDICTED: probable pectin methyltransferase...    101   4e-21   Nicotiana tomentosiformis
ref|XP_009760349.1|  PREDICTED: probable pectin methyltransferase...  99.8    1e-20   Nicotiana sylvestris
ref|XP_006367734.1|  PREDICTED: probable pectin methyltransferase...  98.2    4e-20   Solanum tuberosum [potatoes]
ref|XP_010320179.1|  PREDICTED: probable pectin methyltransferase...  97.4    9e-20   Solanum lycopersicum
gb|KHG28112.1|  putative pectin methyltransferase QUA2 -like protein  84.0    3e-15   Gossypium arboreum [tree cotton]
gb|KJB64260.1|  hypothetical protein B456_010G039800                  83.6    4e-15   Gossypium raimondii
gb|KJB64258.1|  hypothetical protein B456_010G039800                  83.2    5e-15   Gossypium raimondii
gb|KJB64259.1|  hypothetical protein B456_010G039800                  83.2    5e-15   Gossypium raimondii
ref|XP_011074193.1|  PREDICTED: probable pectin methyltransferase...  82.0    2e-14   Sesamum indicum [beniseed]
ref|XP_007018750.1|  S-adenosyl-L-methionine-dependent methyltran...  79.3    1e-13   
ref|XP_007018751.1|  S-adenosyl-L-methionine-dependent methyltran...  79.3    1e-13   
gb|KDP41393.1|  hypothetical protein JCGZ_15800                       76.3    1e-12   Jatropha curcas
emb|CDP01069.1|  unnamed protein product                              74.7    4e-12   Coffea canephora [robusta coffee]
gb|EYU36493.1|  hypothetical protein MIMGU_mgv1a018181mg              72.0    2e-11   Erythranthe guttata [common monkey flower]
gb|KJB59032.1|  hypothetical protein B456_009G236100                  69.3    2e-10   Gossypium raimondii
gb|KJB59033.1|  hypothetical protein B456_009G236100                  68.9    2e-10   Gossypium raimondii
gb|KJB59030.1|  hypothetical protein B456_009G236100                  68.9    3e-10   Gossypium raimondii
gb|KHG17567.1|  putative pectin methyltransferase QUA2 -like protein  68.9    3e-10   Gossypium arboreum [tree cotton]
ref|XP_010535445.1|  PREDICTED: probable pectin methyltransferase...  68.6    4e-10   Tarenaya hassleriana [spider flower]
ref|XP_006472585.1|  PREDICTED: probable pectin methyltransferase...  67.8    6e-10   Citrus sinensis [apfelsine]
ref|XP_002513934.1|  S-adenosylmethionine-dependent methyltransfe...  67.0    1e-09   
ref|XP_002302304.2|  hypothetical protein POPTR_0002s09820g           66.6    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006433967.1|  hypothetical protein CICLE_v10000463mg           65.5    4e-09   Citrus clementina [clementine]
gb|KDO80996.1|  hypothetical protein CISIN_1g005417mg                 65.5    4e-09   Citrus sinensis [apfelsine]
ref|XP_011016595.1|  PREDICTED: probable pectin methyltransferase...  65.5    4e-09   Populus euphratica
ref|XP_009372838.1|  PREDICTED: probable pectin methyltransferase...  65.5    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_008383924.1|  PREDICTED: probable pectin methyltransferase...  64.3    9e-09   Malus domestica [apple tree]
ref|XP_010521185.1|  PREDICTED: probable pectin methyltransferase...  63.9    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_009334333.1|  PREDICTED: probable pectin methyltransferase...  63.5    2e-08   Pyrus x bretschneideri [bai li]
gb|KHN44795.1|  Putative pectin methyltransferase QUA2                63.2    2e-08   Glycine soja [wild soybean]
ref|XP_003542374.1|  PREDICTED: probable pectin methyltransferase...  62.8    2e-08   Glycine max [soybeans]
ref|XP_002306569.2|  hypothetical protein POPTR_0005s17180g           62.0    4e-08   
ref|XP_009334340.1|  PREDICTED: probable pectin methyltransferase...  62.0    6e-08   Pyrus x bretschneideri [bai li]
ref|XP_010267469.1|  PREDICTED: probable pectin methyltransferase...  61.2    8e-08   Nelumbo nucifera [Indian lotus]
ref|XP_011003042.1|  PREDICTED: probable pectin methyltransferase...  60.5    1e-07   Populus euphratica
ref|XP_008372670.1|  PREDICTED: probable pectin methyltransferase...  60.5    2e-07   
ref|XP_006581532.1|  PREDICTED: probable pectin methyltransferase...  60.1    2e-07   Glycine max [soybeans]
gb|KHN08942.1|  Putative pectin methyltransferase QUA2                60.1    2e-07   Glycine soja [wild soybean]
ref|XP_002285784.1|  PREDICTED: probable pectin methyltransferase...  59.3    3e-07   Vitis vinifera
ref|XP_008466224.1|  PREDICTED: probable pectin methyltransferase...  56.6    2e-06   Cucumis melo [Oriental melon]
ref|XP_008219451.1|  PREDICTED: probable pectin methyltransferase...  56.6    3e-06   Prunus mume [ume]
ref|XP_010676338.1|  PREDICTED: probable pectin methyltransferase...  56.6    3e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN19772.1|  Putative pectin methyltransferase QUA2                56.2    3e-06   Glycine soja [wild soybean]
ref|XP_010676321.1|  PREDICTED: probable pectin methyltransferase...  56.2    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003522790.1|  PREDICTED: probable pectin methyltransferase...  55.5    7e-06   Glycine max [soybeans]
gb|KJB59916.1|  hypothetical protein B456_009G280800                  55.1    8e-06   Gossypium raimondii
gb|KJB59917.1|  hypothetical protein B456_009G280800                  55.1    1e-05   Gossypium raimondii
gb|KJB59918.1|  hypothetical protein B456_009G280800                  55.1    1e-05   Gossypium raimondii
ref|XP_007225175.1|  hypothetical protein PRUPE_ppa002227mg           54.7    1e-05   Prunus persica
ref|XP_004300652.1|  PREDICTED: probable pectin methyltransferase...  54.7    1e-05   Fragaria vesca subsp. vesca
ref|XP_004136285.1|  PREDICTED: probable pectin methyltransferase...  53.9    2e-05   Cucumis sativus [cucumbers]
ref|XP_010060014.1|  PREDICTED: probable pectin methyltransferase...  53.9    2e-05   
ref|XP_011100984.1|  PREDICTED: probable pectin methyltransferase...  53.5    3e-05   Sesamum indicum [beniseed]
ref|XP_007141184.1|  hypothetical protein PHAVU_008G174000g           52.8    5e-05   Phaseolus vulgaris [French bean]
gb|KHN13350.1|  Putative pectin methyltransferase QUA2                52.4    7e-05   Glycine soja [wild soybean]
ref|XP_003544795.1|  PREDICTED: probable pectin methyltransferase...  52.0    9e-05   Glycine max [soybeans]
ref|XP_004500638.1|  PREDICTED: probable pectin methyltransferase...  51.2    1e-04   
ref|XP_004500637.1|  PREDICTED: probable pectin methyltransferase...  51.2    2e-04   Cicer arietinum [garbanzo]
gb|KEH34953.1|  pectin methyltransferase QUA2, putative               48.9    0.001   Medicago truncatula



>ref|XP_009629595.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
tomentosiformis]
Length=697

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            N     DDSQMKDK EKED + ++SAGDQ+ LS+KFL RIL  D SP+K  + ENG LS+
Sbjct  18   NGPDIWDDSQMKDKTEKEDLERNRSAGDQTPLSIKFLSRILFPDNSPSKQSLGENGLLSD  77

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFSPG GR+++K+TLLL++L
Sbjct  78   PFSPGTGRNRLKYTLLLIRL  97



>ref|XP_009760349.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
sylvestris]
Length=697

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            N     DDSQMKDK EKED + +++AGDQ+ LS+KFL R+L  D SP+K  + ENG LS+
Sbjct  18   NGPDIWDDSQMKDKTEKEDLERNRAAGDQTHLSIKFLSRMLFPDNSPSKQSLGENGLLSD  77

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFSPG GR+++K+TLLL++L
Sbjct  78   PFSPGTGRNRLKYTLLLIRL  97



>ref|XP_006367734.1| PREDICTED: probable pectin methyltransferase QUA2-like [Solanum 
tuberosum]
Length=697

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            N   F DDSQMKDKIEKED + ++S GDQ++   KFL RIL  D SP+K+ + ENG LS+
Sbjct  18   NGPDFWDDSQMKDKIEKEDLERNRSPGDQTYSPTKFLCRILFPDNSPSKHNLGENGLLSD  77

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFSPG GR+++K+ L L++L
Sbjct  78   PFSPGTGRNRLKYALGLIRL  97



>ref|XP_010320179.1| PREDICTED: probable pectin methyltransferase QUA2 [Solanum lycopersicum]
Length=697

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            N   F DDSQMKDKIEKED + ++S GD ++   KFL RIL  D SP+K+ + ENG LS+
Sbjct  18   NGPDFWDDSQMKDKIEKEDLERNRSPGDLTYSPTKFLCRILFPDNSPSKHNLGENGLLSD  77

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFSPG GR+++K+ L+L++L
Sbjct  78   PFSPGTGRNRLKYALVLIRL  97



>gb|KHG28112.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=697

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K GV+ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGVTENGFASD  76

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFS G+ RS+ K T+L LKL
Sbjct  77   PFSVGSPRSRHKLTVLFLKL  96



>gb|KJB64260.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=697

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFS G+ RS+ K T+L LKL
Sbjct  77   PFSVGSPRSRHKLTVLFLKL  96



>gb|KJB64258.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64261.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=630

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFS G+ RS+ K T+L LKL
Sbjct  77   PFSVGSPRSRHKLTVLFLKL  96



>gb|KJB64259.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=691

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFS G+ RS+ K T+L LKL
Sbjct  77   PFSVGSPRSRHKLTVLFLKL  96



>ref|XP_011074193.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074194.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074195.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=697

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAG-DQSFLSMKFLLRILSTDKSPTKNGVSENGYLS  516
            NSQ F +DSQMK++ EKED D S++ G D +FLS+KF  R L TD   +K+  SENG++S
Sbjct  19   NSQDFWEDSQMKERTEKEDLDRSRANGADNTFLSLKFPFRYLFTDNLSSKH-FSENGFMS  77

Query  517  NPFSPGAGRSQIKFTLLLLKL  579
            +PFSPG  RS+ K TL LLK 
Sbjct  78   DPFSPGPLRSRHKVTLTLLKF  98



>ref|XP_007018750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=695

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D SQ+K K EK+D D ++S  DQS+LS++F  R+L  D SP K+GV+ENG+ S+
Sbjct  17   NSNDFWD-SQVKAKTEKDDLDRNRSP-DQSYLSLRFPFRLLFPDSSPLKHGVTENGFASD  74

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFS G  RS+ K T+L LKL
Sbjct  75   PFSVGTPRSRHKLTMLFLKL  94



>ref|XP_007018751.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15976.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=658

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D SQ+K K EK+D D ++S  DQS+LS++F  R+L  D SP K+GV+ENG+ S+
Sbjct  17   NSNDFWD-SQVKAKTEKDDLDRNRSP-DQSYLSLRFPFRLLFPDSSPLKHGVTENGFASD  74

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PFS G  RS+ K T+L LKL
Sbjct  75   PFSVGTPRSRHKLTMLFLKL  94



>gb|KDP41393.1| hypothetical protein JCGZ_15800 [Jatropha curcas]
Length=690

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLS  516
            NSQ  L DSQMKDK EKED D ++S+ DQS+L++KF LR+L  D  SP+K G  ENG+ S
Sbjct  16   NSQE-LWDSQMKDKTEKEDLDRNRSS-DQSYLALKFPLRVLFPDNSSPSKYGTGENGFAS  73

Query  517  NPFSPGAGRSQIKFT  561
            +PFS G  RS+ KFT
Sbjct  74   DPFSIGTPRSRHKFT  88



>emb|CDP01069.1| unnamed protein product [Coffea canephora]
Length=696

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +1

Query  358  DDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGA  537
            DDSQMKDK+EKED D      DQ++LS++   R L TD S +K+G+ ENG++S+PFSPG 
Sbjct  22   DDSQMKDKLEKEDVDRKSPNADQTYLSIRQPFRFLLTDNSSSKHGLMENGFVSDPFSPGV  81

Query  538  GRSQIKFT  561
             R++ K T
Sbjct  82   LRNRHKRT  89



>gb|EYU36493.1| hypothetical protein MIMGU_mgv1a018181mg, partial [Erythranthe 
guttata]
Length=497

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAG-DQSFLSMKFLLRILSTDKSPTKNGVSENGYLS  516
            NS    +DSQMK++ +KED D  ++ G D +  S+KFL R L  D   +K+G++EN ++S
Sbjct  21   NSHDLWEDSQMKERPDKEDVDPKRTNGADHTHSSIKFLFRYLFPDNLSSKHGLNENSFMS  80

Query  517  NPFSPGAGRSQIKFTLLLLKL  579
            +PFSPG  RS+ K TL  LKL
Sbjct  81   DPFSPGPTRSRHKVTLSFLKL  101



>gb|KJB59032.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=597

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PF  G  RS+ + T+L LKL
Sbjct  75   PFGGGTPRSRHRLTMLFLKL  94



>gb|KJB59033.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
 gb|KJB59034.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=644

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PF  G  RS+ + T+L LKL
Sbjct  75   PFGGGTPRSRHRLTMLFLKL  94



>gb|KJB59030.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=696

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PF  G  RS+ + T+L LKL
Sbjct  75   PFGGGTPRSRHRLTMLFLKL  94



>gb|KHG17567.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=696

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            NS  F D +++KDK EKE+ D + S+  QSFLS++   R+   D SP K GV+ENG+ S+
Sbjct  17   NSNDFWD-AEVKDKTEKEESDRNHSS-SQSFLSLRSPFRLFFQDNSPPKYGVTENGFTSD  74

Query  520  PFSPGAGRSQIKFTLLLLKL  579
            PF  G  RS+ + T+L LKL
Sbjct  75   PFRGGTPRSRHRLTMLFLKL  94



>ref|XP_010535445.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=689

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  534
            L DSQMKDK EK D D S+S  D +FL+++F    L ++ S  KNG++ENG+ S+P+  G
Sbjct  21   LWDSQMKDKTEKGDLDRSRSM-DNTFLALRFPFGFLFSNHSSPKNGINENGFASDPYISG  79

Query  535  AGRSQIKFTLLLLKL  579
              RS+ +  +LLLK+
Sbjct  80   TARSRHRLMMLLLKI  94



>ref|XP_006472585.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472586.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Citrus sinensis]
Length=697

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  534
            DS+MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DSEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  535  AGRSQIKFTLLLLKL  579
              RS+  FT+L LK 
Sbjct  82   TPRSRQNFTMLFLKF  96



>ref|XP_002513934.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48517.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=656

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 2/70 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  531
            L DSQMKDK EKE+ + ++S+ DQS+L+++F  R+L  D  SP+K G +ENG  S+PFS 
Sbjct  21   LWDSQMKDKPEKEELEKNRSS-DQSYLALRFPFRVLFPDNVSPSKYGSTENGIASDPFSI  79

Query  532  GAGRSQIKFT  561
            G  RS+ KFT
Sbjct  80   GTPRSRHKFT  89



>ref|XP_002302304.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
 gb|EEE81577.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
Length=694

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  531
            L DSQMKDK EKED D ++S+ DQS+L+++F  R+L   + SP+K G  ENG+ S+PF  
Sbjct  21   LWDSQMKDKTEKEDLDRNRSS-DQSYLALRFPFRVLFPENNSPSKYGSGENGFASDPFIV  79

Query  532  GAGRSQIKFT  561
            G+ RS+ K+ 
Sbjct  80   GSPRSRHKWA  89



>ref|XP_006433967.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
 gb|ESR47207.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
Length=697

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  534
            D +MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  535  AGRSQIKFTLLLLKL  579
              RS+  FT+L LK 
Sbjct  82   TPRSRQNFTMLFLKF  96



>gb|KDO80996.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
 gb|KDO80997.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=697

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  534
            D +MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  535  AGRSQIKFTLLLLKL  579
              RS+  FT+L LK 
Sbjct  82   TPRSRQNFTMLFLKF  96



>ref|XP_011016595.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
 ref|XP_011016602.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=693

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  531
            L DSQMKDK EKED D ++S+ DQS+L+++F  R+L  D  SP+K G  ENG+ S+PF  
Sbjct  21   LWDSQMKDKTEKEDLDRNRSS-DQSYLALRFPFRVLFPDNNSPSKYGSGENGFASDPFIV  79

Query  532  GAGRSQ  549
            G+ RS+
Sbjct  80   GSPRSR  85



>ref|XP_009372838.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372846.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372855.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +1

Query  340  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  519
            +S  FLD SQMKDK +KED D   S+ + SF + +  +R+L  D SP+K+G +ENG+ S+
Sbjct  17   SSNDFLD-SQMKDKTDKEDLDRRASSDNNSF-AFRLPVRVLFPDNSPSKHGNTENGFASD  74

Query  520  PFSPGAGRSQIK  555
            PF  G  RS+ K
Sbjct  75   PFMAGTPRSRHK  86



>ref|XP_008383924.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008383925.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMKDK +KED D   S+ + SF + KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNSF-AFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  541  RSQIK  555
            RS+ K
Sbjct  82   RSRHK  86



>ref|XP_010521185.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=696

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  534
            L DSQMKDKIEKED + S+S  D + L+++     L  + S +KNG+SENG  S+P+S  
Sbjct  21   LWDSQMKDKIEKEDLNRSRSM-DNTSLALRSPFGFLFNNHSSSKNGISENGVTSDPYSGS  79

Query  535  AGRSQIKFTLLLLKL  579
              RS+ +F LL LK+
Sbjct  80   NSRSRQRFMLLFLKI  94



>ref|XP_009334333.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334334.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334335.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMKDK +KED D   S+ D + L+ KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASS-DNNSLAFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  541  RSQIK  555
            RS+ K
Sbjct  82   RSRHK  86



>gb|KHN44795.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=670

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  528
            L DSQ KDK EKED D ++ + D S  +++F LR+L  + S +K  NG++ENG+ S+PF 
Sbjct  23   LWDSQSKDKTEKEDLD-TRGSSDHSPFTLRFPLRVLLGNNSDSKYGNGIAENGFASDPFM  81

Query  529  PGAGRSQIKFTLLLLK  576
             G  RS++K  LL LK
Sbjct  82   VGTPRSRLKLMLLSLK  97



>ref|XP_003542374.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006593562.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=694

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  528
            L DSQ KDK EKED D ++ + D S  +++F LR+L  + S +K  NG++ENG+ S+PF 
Sbjct  23   LWDSQSKDKTEKEDLD-TRGSSDHSPFTLRFPLRVLLGNNSDSKYGNGIAENGFASDPFM  81

Query  529  PGAGRSQIKFTLLLLK  576
             G  RS++K  LL LK
Sbjct  82   VGTPRSRLKLMLLSLK  97



>ref|XP_002306569.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
 gb|EEE93565.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
Length=718

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  531
            L DSQMKDK EKED D ++S+ DQS+L++KF  R+L  D  SP+K    E+G+ S+PFS 
Sbjct  45   LWDSQMKDKTEKEDMDRNRSS-DQSYLALKFPFRVLFPDNNSPSKYVNGESGFASDPFSV  103

Query  532  GAGRSQ  549
            G+ RS+
Sbjct  104  GSPRSR  109



>ref|XP_009334340.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334341.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334342.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            +SQMKDK +KED D   S+ D + L+ KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   NSQMKDKTDKEDLDRRASS-DNNSLAFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  541  RSQIK  555
            RS+ K
Sbjct  82   RSRHK  86



>ref|XP_010267469.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
 ref|XP_010267476.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
Length=700

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 52/76 (68%), Gaps = 3/76 (4%)
 Frame = +1

Query  361  DSQMKDK---IEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSP  531
            DSQMK +    EKED D ++S+ D + LS++FL+ +   D S  K+G+++NG+ S+PF+ 
Sbjct  25   DSQMKSRSPRTEKEDVDRNRSSPDHTSLSLRFLVNLFFPDNSSFKSGLTDNGFGSDPFNM  84

Query  532  GAGRSQIKFTLLLLKL  579
            G+ RS+   TLL L++
Sbjct  85   GSSRSRQNLTLLFLRI  100



>ref|XP_011003042.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=694

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  531
            L DSQMKDK EKED D ++S+ DQS+L++KF  R+L   + SP+K    E+G+ S+PFS 
Sbjct  21   LWDSQMKDKTEKEDMDSNRSS-DQSYLALKFPFRVLFPYNNSPSKYVNGESGFASDPFSV  79

Query  532  GAGRSQ  549
            G+ RS+
Sbjct  80   GSPRSR  85



>ref|XP_008372670.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008372733.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMKDK +KED D   S+ + SF + +  +R+L  D SP+K G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNSF-AFRMPIRVLFPDNSPSKXGNTENGFASDPFMAGTP  81

Query  541  RSQIK  555
            RS+ K
Sbjct  82   RSRHK  86



>ref|XP_006581532.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Glycine max]
 ref|XP_006581533.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
 ref|XP_006581534.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Glycine max]
 ref|XP_006581535.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X4 [Glycine max]
Length=690

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  534
            L DSQ KDK EKE  D   S+G  S L   F  R+L +D S +K G+SENG+ S+PF  G
Sbjct  21   LWDSQSKDKSEKEGLDRRGSSGHPSPLRSPF--RLLFSDNSNSKYGISENGFSSDPFIIG  78

Query  535  AGRSQIKFTLLLLKL  579
              RS++K  LL L+ 
Sbjct  79   TPRSRLKLVLLFLRF  93



>gb|KHN08942.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  534
            L DSQ KDK EKE  D   S+G  S L   F  R+L +D S +K G+SENG+ S+PF  G
Sbjct  21   LWDSQSKDKSEKEGLDRRGSSGHPSPLRSPF--RLLFSDNSNSKYGISENGFSSDPFIIG  78

Query  535  AGRSQIKFTLLLLKL  579
              RS++K  LL L+ 
Sbjct  79   TPRSRLKLVLLFLRF  93



>ref|XP_002285784.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 ref|XP_010664337.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 emb|CBI19170.3| unnamed protein product [Vitis vinifera]
Length=696

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMK K EKED + ++S+ D + LS KF   +   D S +K+G+SENG+ S+ FS G+ 
Sbjct  23   DSQMKVKTEKEDSEKNRSS-DHTCLSFKFP-SVPFPDNSSSKHGISENGFASDTFSAGSP  80

Query  541  RSQIKFTLLLLKL  579
            RS+ K T+L+LKL
Sbjct  81   RSRHKLTMLVLKL  93



>ref|XP_008466224.1| PREDICTED: probable pectin methyltransferase QUA2 [Cucumis melo]
Length=690

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMKDK +KE+ D   S      L+ +   R+L  D SP+K+G +ENG+ S+ F  G  
Sbjct  23   DSQMKDKTDKEEVDRKGSLDHGGNLAPRLPFRLLLPDNSPSKHGGTENGFASDSFLVGNS  82

Query  541  RSQIKFTLLLLKL  579
            RS+ +F L +L+L
Sbjct  83   RSRQQFILQMLRL  95



>ref|XP_008219451.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
 ref|XP_008219452.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
Length=698

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 41/91 (45%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +1

Query  283  MARPlhrglsvggggrhsgNSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL  462
            M+RPLHRG S   G R SG+S  F D SQMKDK +KED +   S+ D + ++ +F +R+L
Sbjct  1    MSRPLHRGSSGAAGERISGSSNDFWD-SQMKDKTDKEDLERRASS-DNNSIAFRFPIRVL  58

Query  463  STDKSPTKNGVSENGYLSNPFSPGAGRSQIK  555
              D SP+K+G + NG+ S+P      RS+ K
Sbjct  59   FPDNSPSKHGNTGNGFASDPLIASTPRSRHK  89



>ref|XP_010676338.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMK+K EK+D   S+S  DQ + S+K    + S D   +K GV+ENG+ ++ FS  + 
Sbjct  28   DSQMKEKSEKDDTRASRSLSDQGYSSLKLPFHLNSLDNGHSKLGVNENGFTTDLFSSKSP  87

Query  541  RSQIKFTLLLLKL  579
            R++ KF LL+L++
Sbjct  88   RNRHKFILLMLRI  100



>gb|KHN19772.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 42/75 (56%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  534
            L DSQ KDK EKE  D   S G  S L   F  R+L +D S  K G+ ENG+ S+PF  G
Sbjct  21   LWDSQSKDKTEKEGLDRRGSFGHPSPLRSPF--RLLFSDNSNPKYGIGENGFSSDPFIIG  78

Query  535  AGRSQIKFTLLLLKL  579
              RS+ K  LL LK 
Sbjct  79   TPRSRHKLVLLFLKF  93



>ref|XP_010676321.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010676329.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=697

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMK+K EK+D   S+S  DQ + S+K    + S D   +K GV+ENG+ ++ FS  + 
Sbjct  28   DSQMKEKSEKDDTRASRSLSDQGYSSLKLPFHLNSLDNGHSKLGVNENGFTTDLFSSKSP  87

Query  541  RSQIKFTLLLLKL  579
            R++ KF LL+L++
Sbjct  88   RNRHKFILLMLRI  100



>ref|XP_003522790.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
1 [Glycine max]
Length=690

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  534
            L DSQ KDK EKE  D   S G  S L   F  ++L +D S +K G+ ENG+ S+PF  G
Sbjct  21   LWDSQSKDKTEKEGLDRRGSFGHPSPLRSPF--KLLFSDNSNSKYGIGENGFSSDPFIIG  78

Query  535  AGRSQIKFTLLLLKL  579
              RS+ K  LL LK 
Sbjct  79   TPRSRHKLVLLFLKF  93



>gb|KJB59916.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=432

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  531
            L DSQ+K++ EKE+FD +QS       S +F    L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQS-------SHRFPFWSLFSDNSPLTKYDATDNGFASDPFTV  73

Query  532  GAGRSQIKFTLLLLK  576
            G  RS+ + T+LLLK
Sbjct  74   GTPRSRHRLTMLLLK  88



>gb|KJB59917.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=592

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  531
            L DSQ+K++ EKE+FD +QS       S +F    L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQS-------SHRFPFWSLFSDNSPLTKYDATDNGFASDPFTV  73

Query  532  GAGRSQIKFTLLLLK  576
            G  RS+ + T+LLLK
Sbjct  74   GTPRSRHRLTMLLLK  88



>gb|KJB59918.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=690

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  531
            L DSQ+K++ EKE+FD +QS       S +F    L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQS-------SHRFPFWSLFSDNSPLTKYDATDNGFASDPFTV  73

Query  532  GAGRSQIKFTLLLLK  576
            G  RS+ + T+LLLK
Sbjct  74   GTPRSRHRLTMLLLK  88



>ref|XP_007225175.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
 gb|EMJ26374.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
Length=698

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +1

Query  283  MARPlhrglsvggggrhsgNSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL  462
            M+RPLHRG S   G R SGNS  F D SQMKDK +KED +   S+ D + ++ +F +R+L
Sbjct  1    MSRPLHRGSSGAAGERISGNSNDFWD-SQMKDKTDKEDLERRASS-DNNSIAFRFPIRVL  58

Query  463  STDKSPTKNGVSENGYLSNPFSPGAGRSQIK  555
              D SP+K+G + NG+ S+P      RS+ K
Sbjct  59   FPDNSPSKHGNTGNGFASDPLIASTPRSRHK  89



>ref|XP_004300652.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465516.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465517.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465518.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465519.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
Length=693

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMKDK +KED D   S+ DQ+  S +  +R+L  + SP+K GV ENG+ S P    + 
Sbjct  20   DSQMKDKTDKEDLDRRASS-DQNSFSFRIPVRLLLGENSPSKQGVGENGFASEPLLAVSP  78

Query  541  RSQIK  555
            RS+ K
Sbjct  79   RSRHK  83



>ref|XP_004136285.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis 
sativus]
 ref|XP_004160281.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis 
sativus]
 gb|KGN60218.1| hypothetical protein Csa_3G889740 [Cucumis sativus]
Length=690

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQMKDK +KE+ D   S      L+ +   R+L  D SP+K G +ENG+ S+ F  G  
Sbjct  23   DSQMKDKTDKEEVDRKGSLDHGGNLAPRLPFRLLLPDNSPSKYGGTENGFASDSFLVGNS  82

Query  541  RSQIKFTLLLLK  576
            RS+ +F L +L+
Sbjct  83   RSRQQFILQMLR  94



>ref|XP_010060014.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 ref|XP_010060015.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 gb|KCW66537.1| hypothetical protein EUGRSUZ_F00334 [Eucalyptus grandis]
Length=695

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  534
            L DSQMKDK EKED     S+ DQS+  +KF  ++L    SP+K    ENG+ S+P S G
Sbjct  21   LWDSQMKDKSEKEDLSRRDSS-DQSYPPLKFASQLLHPSNSPSKFTNLENGFASDPCSAG  79

Query  535  AGRSQIKFTLLLLK  576
            + R +    +L L+
Sbjct  80   SPRKRHHLIMLALR  93



>ref|XP_011100984.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100985.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100986.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=693

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 4/78 (5%)
 Frame = +1

Query  346  QSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPF  525
              F +D QMK++IEK+  + + S    ++LS K+  R L T+   + + + ++G++S+PF
Sbjct  21   HDFSEDCQMKERIEKDRTNGAVS----TYLSSKYPFRFLFTNNLSSNHSLGDHGFISDPF  76

Query  526  SPGAGRSQIKFTLLLLKL  579
             P A RS  K TL LLK 
Sbjct  77   GPRAPRSLHKVTLCLLKF  94



>ref|XP_007141184.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
 gb|ESW13178.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
Length=693

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  528
            L DSQ KDK EKED D   S+ D S L+++F L +L  + S +K  NG+ ENG+ S+ F 
Sbjct  22   LWDSQSKDKTEKEDLDKRGSS-DHSPLALRFPLGLLLGNNSDSKYGNGIGENGFASDSFI  80

Query  529  PGAGRSQIKFTLLLLK  576
              + RS++K  LL LK
Sbjct  81   VSSPRSRLKLMLLSLK  96



>gb|KHN13350.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=693

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG--VSENGYLSNPFS  528
            L DSQ KDKIEKED D   SA D S  +++F LR+L  + S +K G   +ENG+ S+PF 
Sbjct  22   LWDSQSKDKIEKEDLDRRGSA-DHSPFALRFPLRVLLGNNSESKYGNVKAENGFASDPFM  80

Query  529  PGAGR  543
             G  R
Sbjct  81   VGTPR  85



>ref|XP_003544795.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006596348.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=693

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = +1

Query  355  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG--VSENGYLSNPFS  528
            L DSQ KDKIEKED D   SA D S  +++F LR+L  + S +K G   +ENG+ S+PF 
Sbjct  22   LWDSQSKDKIEKEDLDKRGSA-DHSPFALRFPLRVLLGNNSESKYGNVKAENGFASDPFM  80

Query  529  PGAGR  543
             G  R
Sbjct  81   VGTPR  85



>ref|XP_004500638.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Cicer arietinum]
Length=659

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQ KDK EK+  D   S+ D S L +K   R+L  D S  KNG++ENG+  +PF  G  
Sbjct  23   DSQSKDKTEKDGLDKKGSS-DPSPLPLKSPFRLLFADNS--KNGITENGFSPDPFILGTP  79

Query  541  RSQIKFTLLLLKL  579
            RS+ K  LL +K 
Sbjct  80   RSRHKLILLFMKF  92



>ref|XP_004500637.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Cicer arietinum]
Length=689

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (59%), Gaps = 3/73 (4%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  540
            DSQ KDK EK+  D   S+ D S L +K   R+L  D S  KNG++ENG+  +PF  G  
Sbjct  23   DSQSKDKTEKDGLDKKGSS-DPSPLPLKSPFRLLFADNS--KNGITENGFSPDPFILGTP  79

Query  541  RSQIKFTLLLLKL  579
            RS+ K  LL +K 
Sbjct  80   RSRHKLILLFMKF  92



>gb|KEH34953.1| pectin methyltransferase QUA2, putative [Medicago truncatula]
Length=693

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +1

Query  361  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSPGA  537
            DSQ KDK EK+  D   S+ DQS L +    R+L  D S  +K GV+ENG+  +PF  G 
Sbjct  23   DSQSKDKTEKDGLDRRGSS-DQSPLHLSSPFRLLFADNSSHSKFGVTENGFSPDPFILGT  81

Query  538  GRSQIKFTLLLLKL  579
             RS+ K  LL +K 
Sbjct  82   PRSRHKLILLFMKF  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220