BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS158B12

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAK19067.1|  GIGANTEA                                             94.4    4e-19   Ipomoea nil [qian niu]
ref|XP_009631431.1|  PREDICTED: protein GIGANTEA-like isoform X2      90.5    9e-18   Nicotiana tomentosiformis
ref|XP_009631429.1|  PREDICTED: protein GIGANTEA-like isoform X1      90.5    9e-18   Nicotiana tomentosiformis
ref|XP_009631433.1|  PREDICTED: protein GIGANTEA-like isoform X4      90.5    1e-17   Nicotiana tomentosiformis
ref|XP_009631432.1|  PREDICTED: protein GIGANTEA-like isoform X3      90.5    1e-17   Nicotiana tomentosiformis
ref|XP_009631434.1|  PREDICTED: protein GIGANTEA-like isoform X5      90.5    1e-17   Nicotiana tomentosiformis
emb|CDP11443.1|  unnamed protein product                              89.4    3e-17   Coffea canephora [robusta coffee]
ref|XP_006359040.1|  PREDICTED: protein GIGANTEA-like isoform X2      87.8    7e-17   Solanum tuberosum [potatoes]
ref|XP_009772049.1|  PREDICTED: protein GIGANTEA-like                 87.8    8e-17   Nicotiana sylvestris
ref|XP_004237832.1|  PREDICTED: protein GIGANTEA                      84.7    9e-16   Solanum lycopersicum
ref|XP_002264755.1|  PREDICTED: protein GIGANTEA                      84.0    1e-15   
emb|CAN81809.1|  hypothetical protein VITISV_032939                   84.0    1e-15   Vitis vinifera
emb|CBI22760.3|  unnamed protein product                              83.2    2e-15   Vitis vinifera
ref|NP_001239995.1|  uncharacterized protein LOC100800578             82.0    8e-15   
gb|ABP81863.1|  LATE BLOOMER 1                                        81.6    9e-15   Pisum sativum [garden pea]
ref|XP_003592046.1|  Protein GIGANTEA                                 81.3    1e-14   
gb|AES62299.2|  gigantea protein 1B                                   80.9    1e-14   Medicago truncatula
ref|XP_010261024.1|  PREDICTED: protein GIGANTEA-like isoform X1      80.9    2e-14   Nelumbo nucifera [Indian lotus]
gb|AII99806.1|  gigantea                                              80.9    2e-14   Dimocarpus longan [longan]
ref|XP_010261026.1|  PREDICTED: protein GIGANTEA-like isoform X3      80.9    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002524341.1|  Protein GIGANTEA, putative                       80.5    2e-14   
ref|XP_011100590.1|  PREDICTED: protein GIGANTEA-like                 79.3    6e-14   Sesamum indicum [beniseed]
ref|XP_007151935.1|  hypothetical protein PHAVU_004G088300g           79.3    6e-14   Phaseolus vulgaris [French bean]
ref|XP_006473104.1|  PREDICTED: protein GIGANTEA-like isoform X1      79.3    6e-14   Citrus sinensis [apfelsine]
ref|XP_006416158.1|  hypothetical protein EUTSA_v10006603mg           79.0    7e-14   
dbj|BAN82586.1|  gigantea                                             79.0    7e-14   Glycine max [soybeans]
dbj|BAN82581.1|  gigantea                                             79.0    7e-14   Glycine max [soybeans]
dbj|BAN82589.1|  gigantea                                             79.0    7e-14   Glycine max [soybeans]
dbj|BAJ22595.1|  GIGANTEA                                             79.0    7e-14   Glycine max [soybeans]
gb|AES62297.2|  gigantea protein 1B                                   79.0    7e-14   Medicago truncatula
ref|XP_006416159.1|  hypothetical protein EUTSA_v10006603mg           79.0    8e-14   
gb|KFK44368.1|  gigantea                                              79.0    8e-14   Arabis alpina [alpine rockcress]
ref|XP_003592048.1|  Protein GIGANTEA                                 79.0    8e-14   
ref|XP_007019601.1|  Gigantea protein isoform 1                       78.6    1e-13   
ref|XP_007019603.1|  Gigantea protein isoform 3                       78.6    1e-13   
ref|XP_007019604.1|  Gigantea protein isoform 4                       78.2    1e-13   
gb|KDP36552.1|  hypothetical protein JCGZ_08319                       77.8    2e-13   Jatropha curcas
ref|XP_010268583.1|  PREDICTED: protein GIGANTEA-like isoform X1      77.4    2e-13   Nelumbo nucifera [Indian lotus]
gb|ACJ09482.1|  putative gigantea                                     74.3    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004290483.1|  PREDICTED: protein GIGANTEA                      77.4    2e-13   Fragaria vesca subsp. vesca
gb|ACJ09488.1|  putative gigantea                                     74.3    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ09478.1|  putative gigantea                                     74.3    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007143577.1|  hypothetical protein PHAVU_007G083500g           77.4    2e-13   Phaseolus vulgaris [French bean]
gb|ACJ09481.1|  putative gigantea                                     73.6    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_006306336.1|  hypothetical protein CARUB_v10012213mg           76.6    4e-13   Capsella rubella
gb|EYU30283.1|  hypothetical protein MIMGU_mgv1a000455mg              76.6    5e-13   Erythranthe guttata [common monkey flower]
gb|ACJ65314.1|  GI3 protein                                           76.6    5e-13   Glycine max [soybeans]
gb|KHN41309.1|  Protein GIGANTEA                                      76.6    5e-13   Glycine soja [wild soybean]
gb|ACT22764.1|  GIGANTEA                                              76.3    6e-13   Allium cepa
ref|XP_010915066.1|  PREDICTED: protein GIGANTEA-like                 76.3    7e-13   Elaeis guineensis
ref|XP_011074103.1|  PREDICTED: protein GIGANTEA-like isoform X1      76.3    7e-13   Sesamum indicum [beniseed]
ref|XP_008237480.1|  PREDICTED: protein GIGANTEA                      75.9    7e-13   
ref|XP_011074106.1|  PREDICTED: protein GIGANTEA-like isoform X2      75.9    7e-13   
gb|AJC01622.1|  gigantea                                              75.9    8e-13   Prunus dulcis [sweet almond]
gb|ACJ09480.1|  putative gigantea                                     72.4    9e-13   Oryza sativa Indica Group [Indian rice]
pir||T00767  hypothetical protein T22J18.6 - Arabidopsis thaliana     75.5    1e-12
gb|ABP96497.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96496.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96484.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564180.1|  protein GIGANTEA                                    75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAT80910.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96488.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72908.1|  hypothetical protein                                 75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96485.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAT97404.1|  gigantea                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ09483.1|  putative gigantea                                     72.4    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ABP96482.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAF00023.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96483.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96498.1|  GIGANTEA                                              75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006588466.1|  PREDICTED: uncharacterized protein LOC100800...  75.5    1e-12   Glycine max [soybeans]
gb|KHN17039.1|  Protein GIGANTEA                                      75.5    1e-12   Glycine soja [wild soybean]
ref|XP_010477546.1|  PREDICTED: protein GIGANTEA-like isoform X4      75.5    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010477545.1|  PREDICTED: protein GIGANTEA-like isoform X3      75.5    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010498761.1|  PREDICTED: protein GIGANTEA                      75.5    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010477544.1|  PREDICTED: protein GIGANTEA-like isoform X2      75.1    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010477543.1|  PREDICTED: protein GIGANTEA-like isoform X1      75.1    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010462850.1|  PREDICTED: protein GIGANTEA-like                 75.1    1e-12   Camelina sativa [gold-of-pleasure]
ref|NP_001042220.1|  Os01g0182600                                     75.1    2e-12   
ref|XP_006361617.1|  PREDICTED: protein GIGANTEA-like isoform X2      75.1    2e-12   Solanum tuberosum [potatoes]
gb|EEE54000.1|  hypothetical protein OsJ_00641                        75.1    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70061.1|  hypothetical protein OsI_00663                        75.1    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006361616.1|  PREDICTED: protein GIGANTEA-like isoform X1      75.1    2e-12   Solanum tuberosum [potatoes]
gb|KJB59493.1|  hypothetical protein B456_009G258800                  75.1    2e-12   Gossypium raimondii
ref|XP_002307516.1|  GIGANTEA family protein                          75.1    2e-12   
gb|KJB59491.1|  hypothetical protein B456_009G258800                  74.7    2e-12   Gossypium raimondii
ref|XP_011044276.1|  PREDICTED: protein GIGANTEA-like                 74.7    2e-12   Populus euphratica
gb|KJB59494.1|  hypothetical protein B456_009G258800                  74.7    2e-12   Gossypium raimondii
gb|KJB59492.1|  hypothetical protein B456_009G258800                  74.7    2e-12   Gossypium raimondii
ref|XP_004252566.1|  PREDICTED: protein GIGANTEA-like isoform X1      74.7    2e-12   Solanum lycopersicum
ref|XP_010314472.1|  PREDICTED: protein GIGANTEA-like isoform X2      74.7    2e-12   
gb|ACT22765.1|  GIGANTEA                                              74.7    2e-12   Allium cepa
ref|XP_004496435.1|  PREDICTED: protein GIGANTEA-like isoform X1      74.7    2e-12   Cicer arietinum [garbanzo]
ref|XP_006643836.1|  PREDICTED: protein GIGANTEA-like isoform X1      74.7    2e-12   Oryza brachyantha
ref|XP_002890532.1|  hypothetical protein ARALYDRAFT_889789           74.3    3e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_008381855.1|  PREDICTED: protein GIGANTEA-like                 74.3    3e-12   
ref|XP_009336496.1|  PREDICTED: protein GIGANTEA-like                 74.3    3e-12   Pyrus x bretschneideri [bai li]
gb|AAW66945.1|  gigantea-like protein                                 73.6    5e-12   Hordeum vulgare [barley]
gb|EYU36555.1|  hypothetical protein MIMGU_mgv1a000427mg              73.6    6e-12   Erythranthe guttata [common monkey flower]
ref|XP_004139688.1|  PREDICTED: protein GIGANTEA-like                 73.2    7e-12   
ref|XP_008461912.1|  PREDICTED: protein GIGANTEA-like isoform X1      73.2    8e-12   Cucumis melo [Oriental melon]
ref|XP_010268589.1|  PREDICTED: protein GIGANTEA-like isoform X2      72.8    8e-12   Nelumbo nucifera [Indian lotus]
gb|ACA24490.1|  gigantea-like protein 2                               72.8    9e-12   Glycine max [soybeans]
ref|XP_010925341.1|  PREDICTED: protein GIGANTEA-like                 72.8    9e-12   Elaeis guineensis
ref|XP_003556164.1|  PREDICTED: protein GIGANTEA isoformX1            72.8    9e-12   
gb|ACJ65312.1|  GI1 protein                                           72.8    9e-12   Glycine max [soybeans]
ref|XP_011042897.1|  PREDICTED: protein GIGANTEA-like                 72.8    9e-12   Populus euphratica
ref|XP_002300901.2|  GIGANTEA family protein                          72.8    1e-11   
gb|ABP96481.1|  GIGANTEA                                              72.8    1e-11   Arabidopsis lyrata subsp. petraea
ref|XP_006386299.1|  hypothetical protein POPTR_0002s06490g           72.4    1e-11   
gb|EPS65289.1|  hypothetical protein M569_09488                       70.1    1e-11   Genlisea aurea
gb|KHG25928.1|  Protein GIGANTEA                                      72.0    1e-11   Gossypium arboreum [tree cotton]
ref|XP_008786518.1|  PREDICTED: protein GIGANTEA-like                 72.4    1e-11   
dbj|BAM67030.1|  gigantea-like                                        72.4    1e-11   Chrysanthemum seticuspe f. boreale
ref|XP_009408935.1|  PREDICTED: protein GIGANTEA-like isoform X2      72.0    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793464.1|  PREDICTED: protein GIGANTEA-like                 72.0    1e-11   Phoenix dactylifera
gb|KJB28963.1|  hypothetical protein B456_005G077100                  72.0    2e-11   Gossypium raimondii
gb|KJB28960.1|  hypothetical protein B456_005G077100                  72.0    2e-11   Gossypium raimondii
ref|XP_003564357.1|  PREDICTED: protein GIGANTEA                      72.0    2e-11   
gb|KJB28964.1|  hypothetical protein B456_005G077100                  72.0    2e-11   Gossypium raimondii
gb|KJB28961.1|  hypothetical protein B456_005G077100                  72.0    2e-11   Gossypium raimondii
gb|KJB28962.1|  hypothetical protein B456_005G077100                  72.0    2e-11   Gossypium raimondii
gb|ADP92454.1|  GIGANTEA 1                                            71.6    2e-11   x Doritaenopsis hybrid cultivar
gb|AIC83986.1|  gigantea-like protein                                 71.6    2e-11   Festuca pratensis [meadow ryegrass]
gb|KCW69153.1|  hypothetical protein EUGRSUZ_F02686                   71.2    3e-11   Eucalyptus grandis [rose gum]
ref|XP_010062087.1|  PREDICTED: protein GIGANTEA isoform X1           71.2    3e-11   Eucalyptus grandis [rose gum]
ref|XP_009381150.1|  PREDICTED: protein GIGANTEA-like                 71.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGU91438.1|  GIGANTEA-like protein                                 71.2    3e-11   Chrysanthemum boreale
ref|XP_008456743.1|  PREDICTED: protein GIGANTEA-like                 70.9    4e-11   Cucumis melo [Oriental melon]
ref|XP_009610493.1|  PREDICTED: protein GIGANTEA-like                 70.9    4e-11   Nicotiana tomentosiformis
ref|XP_004140955.1|  PREDICTED: protein GIGANTEA-like                 70.9    4e-11   Cucumis sativus [cucumbers]
ref|XP_010681263.1|  PREDICTED: protein GIGANTEA                      70.9    4e-11   
gb|AAQ11738.1|  gigantea                                              70.9    4e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004160322.1|  PREDICTED: protein GIGANTEA-like                 70.5    5e-11   
gb|AAT79487.1|  gigantea 3                                            70.5    6e-11   Triticum aestivum [Canadian hard winter wheat]
gb|AAT79486.1|  gigantea 2                                            70.5    6e-11   Triticum aestivum [Canadian hard winter wheat]
emb|CDM81775.1|  unnamed protein product                              70.5    6e-11   Triticum aestivum [Canadian hard winter wheat]
gb|EMS55238.1|  hypothetical protein TRIUR3_30834                     70.5    6e-11   Triticum urartu
emb|CAY26028.1|  GIGANTEA                                             70.1    8e-11   Lolium perenne [perennial ryegrass]
emb|CDY04787.1|  BnaC05g18020D                                        69.7    9e-11   
ref|XP_009115601.1|  PREDICTED: protein GIGANTEA                      69.7    9e-11   Brassica rapa
emb|CDY21388.1|  BnaA09g30390D                                        69.7    9e-11   Brassica napus [oilseed rape]
ref|NP_001288824.1|  protein GIGANTEA                                 69.7    9e-11   Brassica rapa
dbj|BAD97869.1|  GI homologue                                         69.7    1e-10   Lemna gibba
ref|XP_009408933.1|  PREDICTED: protein GIGANTEA-like isoform X1      69.7    1e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT06342.1|  hypothetical protein F775_28583                       68.9    2e-10   
ref|XP_009335139.1|  PREDICTED: protein GIGANTEA-like                 68.9    2e-10   Pyrus x bretschneideri [bai li]
gb|AGL61504.1|  gigantea-like protein                                 68.9    2e-10   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_008386373.1|  PREDICTED: protein GIGANTEA-like                 68.6    2e-10   
dbj|BAD97864.1|  GI homologue 1                                       68.6    2e-10   Lemna aequinoctialis
gb|ABZ81992.1|  gigantea                                              68.2    3e-10   Zea mays [maize]
ref|XP_004968438.1|  PREDICTED: protein GIGANTEA-like                 67.8    4e-10   Setaria italica
ref|NP_001140728.1|  uncharacterized protein LOC100272803             67.8    5e-10   
ref|XP_008672375.1|  PREDICTED: uncharacterized protein LOC100272...  67.4    5e-10   Zea mays [maize]
gb|AFW80282.1|  gigantea1A                                            67.4    5e-10   
ref|NP_001288586.1|  gigantea like1a                                  67.4    5e-10   Zea mays [maize]
gb|AFK65758.1|  GIGANTEA                                              66.2    1e-09   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFW80279.1|  gigantea1A isoform 1                                  65.9    2e-09   
gb|AFW80281.1|  gigantea1A                                            65.9    2e-09   
ref|XP_009802612.1|  PREDICTED: protein GIGANTEA-like                 65.5    2e-09   Nicotiana sylvestris
gb|ADR51711.1|  GI                                                    64.7    4e-09   Secale cereale
ref|XP_010097648.1|  hypothetical protein L484_023788                 64.3    6e-09   
ref|XP_009380419.1|  PREDICTED: protein GIGANTEA-like isoform X1      63.9    8e-09   
gb|ABR18021.1|  unknown                                               60.5    1e-07   Picea sitchensis
dbj|BAP76055.1|  putative GI                                          58.5    4e-07   Cryptomeria japonica
gb|AGH20049.1|  GI                                                    58.5    5e-07   Picea abies
emb|CDP21210.1|  unnamed protein product                              51.2    3e-06   Coffea canephora [robusta coffee]
gb|AEK05812.1|  gigantea-5                                            49.7    9e-06   Populus balsamifera [balsam poplar]
ref|XP_010535090.1|  PREDICTED: protein GIGANTEA                      52.4    4e-05   Tarenaya hassleriana [spider flower]
gb|ADX35845.1|  gigantea                                              48.5    7e-05   Brachypodium mexicanum
gb|ADX35837.1|  gigantea                                              48.5    8e-05   Brachypodium rupestre
gb|ADX35846.1|  gigantea                                              48.5    8e-05   Brachypodium distachyon [annual false brome]
gb|AFB78142.1|  gigantea                                              48.5    8e-05   Brachypodium boissieri
gb|ADX35848.1|  gigantea                                              48.5    8e-05   Brachypodium distachyon [annual false brome]
gb|ACJ09479.1|  putative gigantea                                     50.1    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ADX35839.1|  gigantea                                              48.5    8e-05   Brachypodium retusum
gb|ADX35844.1|  gigantea                                              48.1    9e-05   Brachypodium mexicanum
gb|AGW52153.1|  GI                                                    48.9    6e-04   Populus tomentosa [Chinese white poplar]



>dbj|BAK19067.1| GIGANTEA [Ipomoea nil]
Length=1166

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/43 (98%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAASCERWIDRLQFSSL WPPPQDAQQRKDQITAYVEYFGQFT
Sbjct  1    MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFT  43



>ref|XP_009631431.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nicotiana tomentosiformis]
Length=1169

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+CERWID LQFSSL WPPPQDAQQRK QITAYVEYFGQFT
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFT  43



>ref|XP_009631429.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009631430.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
Length=1173

 Score = 90.5 bits (223),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+CERWID LQFSSL WPPPQDAQQRK QITAYVEYFGQFT
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFT  43



>ref|XP_009631433.1| PREDICTED: protein GIGANTEA-like isoform X4 [Nicotiana tomentosiformis]
Length=1159

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+CERWID LQFSSL WPPPQDAQQRK QITAYVEYFGQFT
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFT  43



>ref|XP_009631432.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nicotiana tomentosiformis]
Length=1165

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+CERWID LQFSSL WPPPQDAQQRK QITAYVEYFGQFT
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFT  43



>ref|XP_009631434.1| PREDICTED: protein GIGANTEA-like isoform X5 [Nicotiana tomentosiformis]
Length=1155

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+CERWID LQFSSL WPPPQDAQQRK QITAYVEYFGQFT
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFT  43



>emb|CDP11443.1| unnamed protein product [Coffea canephora]
Length=1167

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAASCERWID LQFSSL WPPPQDA+QRK QITAYVEYFGQFT
Sbjct  1    MAASCERWIDGLQFSSLFWPPPQDAEQRKAQITAYVEYFGQFT  43



>ref|XP_006359040.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1166

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+CERWID LQ+SS+ WPPPQDAQQRK QITAYVEYFGQFT
Sbjct  1    MAATCERWIDGLQYSSIFWPPPQDAQQRKAQITAYVEYFGQFT  43



>ref|XP_009772049.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1155

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+CERWID LQFSSL WPPPQDAQQRK QITAYVEYFGQFT
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFT  43



>ref|XP_004237832.1| PREDICTED: protein GIGANTEA [Solanum lycopersicum]
Length=1167

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+CERWID LQ+SS+ WPPPQDAQQRK QITAYVEYF QFT
Sbjct  1    MAATCERWIDGLQYSSIFWPPPQDAQQRKAQITAYVEYFVQFT  43



>ref|XP_002264755.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665061.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665062.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
Length=1170

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+SCERWID LQFSSL WPPPQD QQRK QITAYV+YFGQFT
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFT  43



>emb|CAN81809.1| hypothetical protein VITISV_032939 [Vitis vinifera]
Length=1172

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+SCERWID LQFSSL WPPPQD QQRK QITAYV+YFGQFT
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFT  43



>emb|CBI22760.3| unnamed protein product [Vitis vinifera]
Length=549

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+SCERWID LQFSSL WPPPQD QQRK QITAYV+YFGQFT
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFT  43



>ref|NP_001239995.1| uncharacterized protein LOC100800578 [Glycine max]
 gb|ACJ65313.1| GI2 protein [Glycine max]
 dbj|BAJ22594.1| GIGANTEA [Glycine max]
Length=1170

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAAS ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  43



>gb|ABP81863.1| LATE BLOOMER 1 [Pisum sativum]
Length=1175

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERWIDRLQFSSL WPPPQD QQ+KDQI AYVEY  QFT
Sbjct  5    MAATSERWIDRLQFSSLFWPPPQDGQQKKDQIAAYVEYLIQFT  47



>ref|XP_003592046.1| Protein GIGANTEA [Medicago truncatula]
Length=1172

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERWIDRLQFSSL WPPPQD QQ+KDQI AYVEY  QFT
Sbjct  1    MAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFT  43



>gb|AES62299.2| gigantea protein 1B [Medicago truncatula]
Length=1177

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERWIDRLQFSSL WPPPQD QQ+KDQI AYVEY  QFT
Sbjct  6    MAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFT  48



>ref|XP_010261024.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1174

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M++SCERWID LQFSSL WP PQDAQQR+ QITAYVEYFGQFT
Sbjct  1    MSSSCERWIDGLQFSSLFWPSPQDAQQRQAQITAYVEYFGQFT  43



>gb|AII99806.1| gigantea [Dimocarpus longan]
Length=1171

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWID LQFSSL WPPPQDAQQRK Q TAYVEYFGQFT
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDAQQRKAQTTAYVEYFGQFT  43



>ref|XP_010261026.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nelumbo nucifera]
Length=1079

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M++SCERWID LQFSSL WP PQDAQQR+ QITAYVEYFGQFT
Sbjct  1    MSSSCERWIDGLQFSSLFWPSPQDAQQRQAQITAYVEYFGQFT  43



>ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis]
 gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis]
Length=1161

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +1

Query  316  ASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            AS ERWID LQFSSL WPPPQDAQQRK QITAYVEYFGQFT
Sbjct  2    ASSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFT  42



>ref|XP_011100590.1| PREDICTED: protein GIGANTEA-like [Sesamum indicum]
Length=1166

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S E+WID LQFSSL WPPPQDA+QRK Q+TAYVEYFGQFT
Sbjct  1    MATSNEKWIDSLQFSSLFWPPPQDAEQRKAQVTAYVEYFGQFT  43



>ref|XP_007151935.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
 gb|ESW23929.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
Length=1169

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAAS ERWIDRLQFSSL WPPP + QQRKDQI AYVEY GQFT
Sbjct  5    MAASSERWIDRLQFSSLFWPPPLEDQQRKDQIAAYVEYIGQFT  47



>ref|XP_006473104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Citrus sinensis]
 ref|XP_006473105.1| PREDICTED: protein GIGANTEA-like isoform X2 [Citrus sinensis]
 ref|XP_006473106.1| PREDICTED: protein GIGANTEA-like isoform X3 [Citrus sinensis]
 ref|XP_006473107.1| PREDICTED: protein GIGANTEA-like isoform X4 [Citrus sinensis]
Length=1165

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWID LQFSSL WPPPQDA+QRK Q TAYVEYFGQFT
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDAEQRKIQTTAYVEYFGQFT  43



>ref|XP_006416158.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34511.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=984

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  43



>dbj|BAN82586.1| gigantea [Glycine max]
 dbj|BAN82590.1| gigantea [Glycine max]
 dbj|BAN82591.1| gigantea [Glycine max]
 dbj|BAN82592.1| gigantea [Glycine max]
Length=1170

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAAS ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  43



>dbj|BAN82581.1| gigantea [Glycine max]
 dbj|BAN82582.1| gigantea [Glycine max]
 dbj|BAN82583.1| gigantea [Glycine max]
 dbj|BAN82584.1| gigantea [Glycine max]
 dbj|BAN82585.1| gigantea [Glycine max]
 dbj|BAN82587.1| gigantea [Glycine max]
 dbj|BAN82588.1| gigantea [Glycine max]
Length=1170

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAAS ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  43



>dbj|BAN82589.1| gigantea [Glycine max]
Length=1171

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAAS ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  43



>dbj|BAJ22595.1| GIGANTEA [Glycine max]
Length=1168

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAAS ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  43



>gb|AES62297.2| gigantea protein 1B [Medicago truncatula]
Length=975

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERWIDRLQFSSL WPPPQD QQ+KDQI AYVEY  QFT
Sbjct  6    MAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFT  48



>ref|XP_006416159.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 ref|XP_006416160.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34512.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34513.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=1171

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  43



>gb|KFK44368.1| gigantea [Arabis alpina]
Length=1173

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  43



>ref|XP_003592048.1| Protein GIGANTEA [Medicago truncatula]
Length=1200

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERWIDRLQFSSL WPPPQD QQ+KDQI AYVEY  QFT
Sbjct  1    MAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFT  43



>ref|XP_007019601.1| Gigantea protein isoform 1 [Theobroma cacao]
 ref|XP_007019602.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16826.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16827.1| Gigantea protein isoform 1 [Theobroma cacao]
Length=1170

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+  ERWID LQFSSL WPPPQD QQRK QITAYVEYFGQFT
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFT  43



>ref|XP_007019603.1| Gigantea protein isoform 3 [Theobroma cacao]
 gb|EOY16828.1| Gigantea protein isoform 3 [Theobroma cacao]
Length=1171

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+  ERWID LQFSSL WPPPQD QQRK QITAYVEYFGQFT
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFT  43



>ref|XP_007019604.1| Gigantea protein isoform 4 [Theobroma cacao]
 gb|EOY16829.1| Gigantea protein isoform 4 [Theobroma cacao]
Length=1147

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+  ERWID LQFSSL WPPPQD QQRK QITAYVEYFGQFT
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFT  43



>gb|KDP36552.1| hypothetical protein JCGZ_08319 [Jatropha curcas]
Length=1168

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWID LQFSSL WP PQD QQRK QITAYVEYFGQFT
Sbjct  1    MASSSERWIDGLQFSSLFWPAPQDVQQRKAQITAYVEYFGQFT  43



>ref|XP_010268583.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268584.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268585.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268586.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268587.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268588.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1083

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWID LQFSSL WPPPQD QQR+ QI AYVEYFGQFT
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDVQQRQAQINAYVEYFGQFT  43



>gb|ACJ09482.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD+QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFT  43



>ref|XP_004290483.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458472.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458473.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
Length=1178

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S ERWIDRLQFSSL  PPPQDA +RK QITAYVEYFGQFT
Sbjct  1    MACSSERWIDRLQFSSLFGPPPQDAPRRKAQITAYVEYFGQFT  43



>gb|ACJ09488.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD+QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFT  43



>gb|ACJ09478.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09484.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09485.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09486.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09487.1| putative gigantea, partial [Oryza sativa]
 gb|ACJ09489.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09490.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09491.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09492.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09493.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD+QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFT  43



>ref|XP_007143577.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 ref|XP_007143578.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15571.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15572.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
Length=1199

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA  E+WIDRLQFSSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  8    MAAPSEKWIDRLQFSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  50



>gb|ACJ09481.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD+QQ++ Q+ AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQVLAYVEYFGQFT  43



>ref|XP_006306336.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
 gb|EOA39234.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
Length=1171

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  3    ATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  44



>gb|EYU30283.1| hypothetical protein MIMGU_mgv1a000455mg [Erythranthe guttata]
Length=1141

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S E+WID LQ SSL WPPPQDA+QRK QITAYVEYFGQFT
Sbjct  1    MATSNEKWIDSLQPSSLFWPPPQDAEQRKAQITAYVEYFGQFT  43



>gb|ACJ65314.1| GI3 protein [Glycine max]
Length=1155

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            AAS ERW+DRLQFSSL WPPP D QQRKDQ+ AYVEY GQFT
Sbjct  3    AASGERWMDRLQFSSLFWPPPLDDQQRKDQVAAYVEYIGQFT  44



>gb|KHN41309.1| Protein GIGANTEA [Glycine soja]
Length=1166

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            AAS ERW+DRLQFSSL WPPP D QQRKDQ+ AYVEY GQFT
Sbjct  3    AASGERWMDRLQFSSLFWPPPLDDQQRKDQVAAYVEYIGQFT  44



>gb|ACT22764.1| GIGANTEA [Allium cepa]
Length=1109

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+  CE+WID LQ+SSL+WPPPQD  QR+ QI AYVEYFGQFT
Sbjct  1    MSVVCEKWIDGLQYSSLLWPPPQDEHQRQAQILAYVEYFGQFT  43



>ref|XP_010915066.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1171

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQF  435
            M+ S E+WID LQFSSL+WPPPQD QQR+ QI AYVEYFGQF
Sbjct  1    MSVSNEKWIDGLQFSSLLWPPPQDEQQRQAQIVAYVEYFGQF  42



>ref|XP_011074103.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074105.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
Length=1169

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S ERWID LQFSSL WPPPQD +QRK QI AYVE+FGQFT
Sbjct  1    MATSNERWIDSLQFSSLFWPPPQDVKQRKAQIAAYVEFFGQFT  43



>ref|XP_008237480.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237481.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237482.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237483.1| PREDICTED: protein GIGANTEA [Prunus mume]
Length=1170

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERWIDRLQFSSL  PPPQDA +RK Q+TAYV+YFGQFT
Sbjct  1    MAATSERWIDRLQFSSLFGPPPQDALRRKAQVTAYVDYFGQFT  43



>ref|XP_011074106.1| PREDICTED: protein GIGANTEA-like isoform X2 [Sesamum indicum]
Length=1138

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S ERWID LQFSSL WPPPQD +QRK QI AYVE+FGQFT
Sbjct  1    MATSNERWIDSLQFSSLFWPPPQDVKQRKAQIAAYVEFFGQFT  43



>gb|AJC01622.1| gigantea [Prunus dulcis]
Length=1170

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERWIDRLQFSSL  PPPQDA +RK Q+TAYV+YFGQFT
Sbjct  1    MAATSERWIDRLQFSSLFGPPPQDALRRKAQVTAYVDYFGQFT  43



>gb|ACJ09480.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQF SL WPPPQD+QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFPSLFWPPPQDSQQKQAQILAYVEYFGQFT  43



>pir||T00767 hypothetical protein T22J18.6 - Arabidopsis thaliana
 gb|AAC25507.1|AAC25507 T22J18.6 [Arabidopsis thaliana]
Length=1070

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|ABP96497.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|ABP96496.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|ABP96484.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96487.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96489.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96500.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96501.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|NP_564180.1| protein GIGANTEA [Arabidopsis thaliana]
 sp|Q9SQI2.2|GIGAN_ARATH RecName: Full=Protein GIGANTEA [Arabidopsis thaliana]
 gb|AAF00092.1|AF105064_1 GIGANTEA [Arabidopsis thaliana]
 emb|CAB56039.1| gigantea protein [Arabidopsis thaliana]
 gb|AAT97405.1| gigantea [Arabidopsis thaliana]
 gb|AEE30286.1| gigantea protein (GI) [Arabidopsis thaliana]
Length=1173

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|AAT80910.1| GIGANTEA [Arabidopsis thaliana]
Length=1173

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|ABP96488.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>emb|CAA72908.1| hypothetical protein [Arabidopsis thaliana]
Length=1167

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|ABP96485.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96486.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96499.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|AAT97404.1| gigantea [Arabidopsis thaliana]
Length=1173

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|ACJ09483.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+A  E+WID LQFSSL WPPPQD+QQ++ QI AYVEYFGQFT
Sbjct  1    MSAPNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFT  43



>gb|ABP96482.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|AAF00023.1| GIGANTEA [Arabidopsis thaliana]
Length=1155

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|ABP96483.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96490.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96491.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96492.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96493.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96494.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96495.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96502.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>gb|ABP96498.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|XP_006588466.1| PREDICTED: uncharacterized protein LOC100800578 isoform X1 [Glycine 
max]
 ref|XP_006588467.1| PREDICTED: uncharacterized protein LOC100800578 isoform X2 [Glycine 
max]
 ref|XP_006588468.1| PREDICTED: uncharacterized protein LOC100800578 isoform X3 [Glycine 
max]
Length=1177

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  50



>gb|KHN17039.1| Protein GIGANTEA [Glycine soja]
Length=1149

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  50



>ref|XP_010477546.1| PREDICTED: protein GIGANTEA-like isoform X4 [Camelina sativa]
Length=1169

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A S ERWID LQFSS++WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|XP_010477545.1| PREDICTED: protein GIGANTEA-like isoform X3 [Camelina sativa]
Length=1169

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A S ERWID LQFSS++WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|XP_010498761.1| PREDICTED: protein GIGANTEA [Camelina sativa]
Length=1169

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A S ERWID LQFSS++WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|XP_010477544.1| PREDICTED: protein GIGANTEA-like isoform X2 [Camelina sativa]
Length=1170

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A S ERWID LQFSS++WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|XP_010477543.1| PREDICTED: protein GIGANTEA-like isoform X1 [Camelina sativa]
Length=1170

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A S ERWID LQFSS++WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|XP_010462850.1| PREDICTED: protein GIGANTEA-like [Camelina sativa]
Length=1138

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A S ERWID LQFSS++WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|NP_001042220.1| Os01g0182600 [Oryza sativa Japonica Group]
 sp|Q9AWL7.2|GIGAN_ORYSJ RecName: Full=Protein GIGANTEA [Oryza sativa Japonica Group]
 dbj|BAD68052.1| putative gigantea [Oryza sativa Japonica Group]
 dbj|BAF04134.1| Os01g0182600 [Oryza sativa Japonica Group]
Length=1160

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD+QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFT  43



>ref|XP_006361617.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1170

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S  RWID L FSSL W PPQDA+QRKDQITAYV+YFGQFT
Sbjct  1    MASSSTRWIDSLHFSSLFWLPPQDAEQRKDQITAYVKYFGQFT  43



>gb|EEE54000.1| hypothetical protein OsJ_00641 [Oryza sativa Japonica Group]
Length=1176

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD+QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFT  43



>gb|EEC70061.1| hypothetical protein OsI_00663 [Oryza sativa Indica Group]
Length=1176

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD+QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFT  43



>ref|XP_006361616.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1171

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S  RWID L FSSL W PPQDA+QRKDQITAYV+YFGQFT
Sbjct  1    MASSSTRWIDSLHFSSLFWLPPQDAEQRKDQITAYVKYFGQFT  43



>gb|KJB59493.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=973

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   +RWID LQFSSL WPPPQD Q+RK QITAYVEYFGQFT
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFT  43



>ref|XP_002307516.1| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE94512.1| GIGANTEA family protein [Populus trichocarpa]
Length=1171

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL WPPPQDAQQRK QITAYV+YFGQ T
Sbjct  3    SSSSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVDYFGQCT  44



>gb|KJB59491.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=975

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   +RWID LQFSSL WPPPQD Q+RK QITAYVEYFGQFT
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFT  43



>ref|XP_011044276.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1171

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL WPPPQDAQQRK QITAYV+YFGQ T
Sbjct  3    SSSSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVDYFGQCT  44



>gb|KJB59494.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59495.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59496.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59497.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59498.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1168

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   +RWID LQFSSL WPPPQD Q+RK QITAYVEYFGQFT
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFT  43



>gb|KJB59492.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1055

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   +RWID LQFSSL WPPPQD Q+RK QITAYVEYFGQFT
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFT  43



>ref|XP_004252566.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum lycopersicum]
Length=1167

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWID L FSSL W PPQ A+QRKDQITAYV+YFGQFT
Sbjct  1    MASSSERWIDSLHFSSLFWVPPQAAEQRKDQITAYVKYFGQFT  43



>ref|XP_010314472.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum lycopersicum]
Length=1166

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWID L FSSL W PPQ A+QRKDQITAYV+YFGQFT
Sbjct  1    MASSSERWIDSLHFSSLFWVPPQAAEQRKDQITAYVKYFGQFT  43



>gb|ACT22765.1| GIGANTEA [Allium cepa]
Length=1109

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+  CE+WID L++SSL+WPPPQD  QR+ QI AYVEYFGQFT
Sbjct  1    MSVVCEKWIDGLRYSSLLWPPPQDEHQRQAQILAYVEYFGQFT  43



>ref|XP_004496435.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cicer arietinum]
Length=1180

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWIDRLQ+SSL WPPPQD QQ+KDQI AYVEY  QFT
Sbjct  11   ERWIDRLQYSSLFWPPPQDGQQKKDQIAAYVEYLIQFT  48



>ref|XP_006643836.1| PREDICTED: protein GIGANTEA-like isoform X1 [Oryza brachyantha]
 ref|XP_006643837.1| PREDICTED: protein GIGANTEA-like isoform X2 [Oryza brachyantha]
Length=1162

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDVQQKQAQILAYVEYFGQFT  43



>ref|XP_002890532.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66791.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
Length=1174

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWID LQFSSL+WPPP+D QQ KDQ+ AYVEYFGQFT
Sbjct  9    ERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFT  46



>ref|XP_008381855.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1170

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERW DRLQFSSL  PPPQDA +RK QITAYV+YFGQFT
Sbjct  1    MAATSERWFDRLQFSSLFGPPPQDALRRKAQITAYVDYFGQFT  43



>ref|XP_009336496.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1170

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERW DRLQFSSL  PPPQDA +RK QITAYV+YFGQFT
Sbjct  1    MAATSERWFDRLQFSSLFGPPPQDALRRKAQITAYVDYFGQFT  43



>gb|AAW66945.1| gigantea-like protein [Hordeum vulgare]
 gb|AAW66946.1| gigantea-like protein [Hordeum vulgare subsp. vulgare]
Length=1155

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS  +WID LQFSSL WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  1    MSASNGKWIDGLQFSSLFWPPPHDAQQKQAQILAYVEYFGQFT  43



>gb|EYU36555.1| hypothetical protein MIMGU_mgv1a000427mg [Erythranthe guttata]
Length=1160

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   ERWID LQFSSL WPPPQD ++RK QI AYVE+FGQFT
Sbjct  1    MATQNERWIDSLQFSSLFWPPPQDTEERKAQINAYVEFFGQFT  43



>ref|XP_004139688.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1168

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S ERWIDRLQ SSL WPPP D QQRK Q +AYVEY GQFT
Sbjct  1    MATSSERWIDRLQLSSLFWPPPDDDQQRKVQCSAYVEYLGQFT  43



>ref|XP_008461912.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cucumis melo]
Length=1168

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S ERWIDRLQ SSL WPPP D QQRK Q +AYVEY GQFT
Sbjct  1    MATSSERWIDRLQLSSLFWPPPDDDQQRKVQCSAYVEYLGQFT  43



>ref|XP_010268589.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1081

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 36/43 (84%), Gaps = 2/43 (5%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWID LQFSSL WPPPQD QQR  QI AYVEYFGQFT
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDVQQR--QINAYVEYFGQFT  41



>gb|ACA24490.1| gigantea-like protein 2 [Glycine max]
Length=990

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  50



>ref|XP_010925341.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1170

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S E+WID LQFSSL WPPPQD QQR+ QI AYVEYFGQFT
Sbjct  1    MSVSYEKWIDGLQFSSLFWPPPQDEQQRQVQIMAYVEYFGQFT  43



>ref|XP_003556164.1| PREDICTED: protein GIGANTEA isoformX1 [Glycine max]
 ref|XP_006606175.1| PREDICTED: protein GIGANTEA isoform X2 [Glycine max]
 ref|XP_006606176.1| PREDICTED: protein GIGANTEA isoform X3 [Glycine max]
 ref|XP_006606177.1| PREDICTED: protein GIGANTEA isoform X4 [Glycine max]
 gb|ACA24489.1| gigantea-like protein 1 [Glycine max]
Length=1175

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  50



>gb|ACJ65312.1| GI1 protein [Glycine max]
Length=1176

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWIDRLQ+SSL WPPP D QQRKDQI AYVEYF QFT
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFT  50



>ref|XP_011042897.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042898.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042899.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1169

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL  PPPQDAQQRK QITAYVEYFGQ T
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCT  44



>ref|XP_002300901.2| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE80174.2| GIGANTEA family protein [Populus trichocarpa]
Length=1194

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL  PPPQDAQQRK QITAYVEYFGQ T
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCT  44



>gb|ABP96481.1| GIGANTEA [Arabidopsis lyrata subsp. petraea]
Length=1173

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWID LQFSSL+WPPP+D QQ KDQ+ AYV+YFGQFT
Sbjct  9    ERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVDYFGQFT  46



>ref|XP_006386299.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
 gb|ERP64096.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
Length=1171

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ++S ERWID LQFSSL  PPPQDAQQRK QITAYVEYFGQ T
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCT  44



>gb|EPS65289.1| hypothetical protein M569_09488 [Genlisea aurea]
Length=305

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA  E+W D LQFSSL WPPPQD  QRK Q+ A+VEYFGQFT
Sbjct  1    MAALTEKWTDSLQFSSLFWPPPQDEGQRKAQVAAFVEYFGQFT  43



>gb|KHG25928.1| Protein GIGANTEA [Gossypium arboreum]
 gb|KHG25929.1| Protein GIGANTEA [Gossypium arboreum]
Length=755

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   ERWID LQFSSL  PPPQD Q RK QITAYVEYFGQFT
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFT  43



>ref|XP_008786518.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786528.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786537.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1170

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQFSSL+WPPP D QQR+ QITAYVEYFGQFT
Sbjct  1    MSISYGKWIDGLQFSSLLWPPPHDEQQRQAQITAYVEYFGQFT  43



>dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale]
Length=1145

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA +  RW D LQFSSL WPPP D QQRK+QITAYV+YFGQFT
Sbjct  1    MADTSTRWTDSLQFSSLFWPPPLDTQQRKEQITAYVDYFGQFT  43



>ref|XP_009408935.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1163

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S E+WID LQFSSL WPPPQD  QR+ Q+ AYVEYF QFT
Sbjct  1    MAVSNEKWIDGLQFSSLFWPPPQDETQRQAQVLAYVEYFSQFT  43



>ref|XP_008793464.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1169

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S E+WID LQFSSL+W PPQD +QR+ QI AYVEYFGQFT
Sbjct  1    MSVSNEKWIDGLQFSSLLWRPPQDERQRQAQIVAYVEYFGQFT  43



>gb|KJB28963.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=970

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   ERWID LQFSSL  PPPQD Q RK QITAYVEYFGQFT
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFT  43



>gb|KJB28960.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1001

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   ERWID LQFSSL  PPPQD Q RK QITAYVEYFGQFT
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFT  43



>ref|XP_003564357.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230544.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230545.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230546.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230547.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
Length=1155

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS  +WID LQ+SSL WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  1    MSASNGKWIDGLQYSSLFWPPPHDAQQKQVQILAYVEYFGQFT  43



>gb|KJB28964.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1080

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   ERWID LQFSSL  PPPQD Q RK QITAYVEYFGQFT
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFT  43



>gb|KJB28961.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1155

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   ERWID LQFSSL  PPPQD Q RK QITAYVEYFGQFT
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFT  43



>gb|KJB28962.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1147

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA   ERWID LQFSSL  PPPQD Q RK QITAYVEYFGQFT
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFT  43



>gb|ADP92454.1| GIGANTEA 1 [x Doritaenopsis hybrid cultivar]
Length=1160

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M++S ++WID LQFSSL+WPPPQD QQR+ QI AYVEYF QFT
Sbjct  1    MSSSSQKWIDGLQFSSLLWPPPQDEQQRQVQIMAYVEYFAQFT  43



>gb|AIC83986.1| gigantea-like protein [Festuca pratensis]
Length=1149

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS  +WID LQFSSL WPPP DAQQ++ Q  AYVEYFGQFT
Sbjct  1    MSASNGKWIDGLQFSSLFWPPPHDAQQKQAQTLAYVEYFGQFT  43



>gb|KCW69153.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1167

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  316  ASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A+CERWID LQ+SSL WPPPQD  Q+K Q+ AYVE FGQFT
Sbjct  2    AACERWIDGLQYSSLFWPPPQDILQKKAQVNAYVELFGQFT  42



>ref|XP_010062087.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062088.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062089.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 gb|KCW69154.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1166

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  316  ASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A+CERWID LQ+SSL WPPPQD  Q+K Q+ AYVE FGQFT
Sbjct  2    AACERWIDGLQYSSLFWPPPQDILQKKAQVNAYVELFGQFT  42



>ref|XP_009381150.1| PREDICTED: protein GIGANTEA-like [Musa acuminata subsp. malaccensis]
Length=1171

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S E+WID LQFSSL WPPPQD  QR+ Q+ AYVEYF QFT
Sbjct  1    MSISNEKWIDGLQFSSLFWPPPQDENQRQAQVLAYVEYFSQFT  43



>gb|AGU91438.1| GIGANTEA-like protein, partial [Chrysanthemum boreale]
Length=949

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERWID LQFSSL  PPPQD  QRK QITAYV+YF QFT
Sbjct  1    MAATSERWIDGLQFSSLFRPPPQDPDQRKAQITAYVDYFAQFT  43



>ref|XP_008456743.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456744.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456745.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
Length=1170

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWIDRLQFSSL W PP+D QQRK +IT YVE  GQFT
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFT  44



>ref|XP_009610493.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
 ref|XP_009610494.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
Length=1158

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  316  ASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            A+ ERWID L FSSL WPPPQDAQQRK Q TAYV+YFGQ T
Sbjct  6    AASERWIDGLHFSSLFWPPPQDAQQRKAQTTAYVKYFGQST  46



>ref|XP_004140955.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
 gb|KGN46115.1| hypothetical protein Csa_6G055360 [Cucumis sativus]
Length=1170

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWIDRLQFSSL W PP+D QQRK +IT YVE  GQFT
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFT  44



>ref|XP_010681263.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
 ref|XP_010681268.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
Length=1178

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQF  435
            ERWID LQFSSL WPPPQ+ QQRK Q TAYVEYFGQF
Sbjct  6    ERWIDGLQFSSLFWPPPQETQQRKAQTTAYVEYFGQF  42



>gb|AAQ11738.1| gigantea [Triticum aestivum]
Length=1155

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQFSSL WPPP D QQ++ QI AYVEYFGQFT
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFT  43



>ref|XP_004160322.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=994

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S ERWIDRLQFSSL W PP+D QQRK +IT YVE  GQFT
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFT  44



>gb|AAT79487.1| gigantea 3 [Triticum aestivum]
Length=1155

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQFSSL WPPP D QQ++ QI AYVEYFGQFT
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFT  43



>gb|AAT79486.1| gigantea 2 [Triticum aestivum]
Length=1153

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQFSSL WPPP D QQ++ QI AYVEYFGQFT
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFT  43



>emb|CDM81775.1| unnamed protein product [Triticum aestivum]
Length=1155

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQFSSL WPPP D QQ++ QI AYVEYFGQFT
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFT  43



>gb|EMS55238.1| hypothetical protein TRIUR3_30834 [Triticum urartu]
Length=1126

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQFSSL WPPP D QQ++ QI AYVEYFGQFT
Sbjct  38   MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFT  80



>emb|CAY26028.1| GIGANTEA [Lolium perenne]
 gb|ABF83898.2| GIGANTEA [Lolium perenne]
Length=1148

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQFSSL WPPP DAQQ++ Q  AYVEYFGQFT
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDAQQKQAQTLAYVEYFGQFT  43



>emb|CDY04787.1| BnaC05g18020D [Brassica napus]
Length=1170

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  319  SCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            S ERW D LQFSSL+W PP+D QQ KDQ+ AYVEYFGQFT
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|XP_009115601.1| PREDICTED: protein GIGANTEA [Brassica rapa]
Length=1171

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  319  SCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            S ERW D LQFSSL+W PP+D QQ KDQ+ AYVEYFGQFT
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFT  45



>emb|CDY21388.1| BnaA09g30390D [Brassica napus]
Length=1171

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  319  SCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            S ERW D LQFSSL+W PP+D QQ KDQ+ AYVEYFGQFT
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFT  45



>ref|NP_001288824.1| protein GIGANTEA [Brassica rapa]
 gb|AEB33730.1| GIGANTEA [Brassica rapa]
Length=1183

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  319  SCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            S ERW D LQFSSL+W PP+D QQ KDQ+ AYVEYFGQFT
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFT  45



>dbj|BAD97869.1| GI homologue [Lemna gibba]
Length=1116

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M +S ERWID LQF SL WPPPQD QQR+ Q TAYVEYF QFT
Sbjct  1    MPSSTERWIDGLQFPSLFWPPPQDEQQRQAQTTAYVEYFVQFT  43



>ref|XP_009408933.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408934.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1205

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA S E+WID LQFSSL WPPPQD  QR+ Q+ AYVEYF QFT
Sbjct  1    MAVSNEKWIDGLQFSSLFWPPPQDETQRQAQVLAYVEYFSQFT  43



>gb|EMT06342.1| hypothetical protein F775_28583 [Aegilops tauschii]
Length=1146

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQFSSL WPPP D QQ++ QI AYVEYFGQFT
Sbjct  60   MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFT  102



>ref|XP_009335139.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
 ref|XP_009335140.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1169

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERW DRLQ SSL  PPPQD   RK QITAYV+YFGQFT
Sbjct  1    MAATSERWFDRLQCSSLFGPPPQDTLPRKAQITAYVDYFGQFT  43



>gb|AGL61504.1| gigantea-like protein [Chrysanthemum x morifolium]
Length=1145

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA +  RW D LQFSSL WPPP D QQ K+QITAYV+YFGQFT
Sbjct  1    MADTSTRWTDSLQFSSLFWPPPLDTQQCKEQITAYVDYFGQFT  43



>ref|XP_008386373.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1169

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MAA+ ERW DRLQFSSL  PPP D  +RK +ITAYV+YFGQFT
Sbjct  1    MAATSERWFDRLQFSSLFGPPPPDNLRRKAEITAYVDYFGQFT  43



>dbj|BAD97864.1| GI homologue 1 [Lemna paucicostata]
Length=1115

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M AS ERWID LQFSSL WPPP D QQR+ Q  AYVEYF QFT
Sbjct  1    MVASTERWIDGLQFSSLFWPPPPDEQQRQAQTMAYVEYFVQFT  43



>gb|ABZ81992.1| gigantea [Zea mays]
Length=1162

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQF+SL WPPP DA+Q++ QI AYVEYFGQFT
Sbjct  1    MSESNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFT  43



>ref|XP_004968438.1| PREDICTED: protein GIGANTEA-like [Setaria italica]
Length=1160

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQF+SL  PPPQD  Q++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFTSLFCPPPQDVAQKQAQILAYVEYFGQFT  43



>ref|NP_001140728.1| uncharacterized protein LOC100272803 [Zea mays]
 tpg|DAA06171.1| TPA_inf: gigantea 1B [Zea mays]
Length=1160

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID L F+SL WPPPQD +Q++ QI AYVEYFGQFT
Sbjct  1    MSESNVKWIDGLHFTSLYWPPPQDVEQKQAQILAYVEYFGQFT  43



>ref|XP_008672375.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672376.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672377.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 tpg|DAA53146.1| TPA: gigantea1B [Zea mays]
Length=1160

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID L F+SL WPPPQD +Q++ QI AYVEYFGQFT
Sbjct  1    MSESNVKWIDGLHFTSLYWPPPQDVEQKQAQILAYVEYFGQFT  43



>gb|AFW80282.1| gigantea1A [Zea mays]
Length=1085

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQF+SL WPPP DA+Q++ QI AYVEYFGQFT
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFT  43



>ref|NP_001288586.1| gigantea like1a [Zea mays]
 ref|XP_008655715.1| PREDICTED: protein GIGANTEA [Zea mays]
 ref|XP_008655716.1| PREDICTED: protein GIGANTEA [Zea mays]
 tpg|DAA06172.1| TPA_inf: gigantea 1A [Zea mays]
 gb|AFW80283.1| gigantea isoform 1 [Zea mays]
 gb|AFW80284.1| gigantea isoform 2 [Zea mays]
Length=1162

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQF+SL WPPP DA+Q++ QI AYVEYFGQFT
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFT  43



>gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium]
Length=1151

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA +  RW D LQ SSL  PPP D QQRK+QITAYV+YFGQFT
Sbjct  2    MADTSTRWTDSLQLSSLFSPPPLDTQQRKEQITAYVDYFGQFT  44



>gb|AFW80279.1| gigantea1A isoform 1 [Zea mays]
 gb|AFW80280.1| gigantea1A isoform 2 [Zea mays]
Length=968

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQF+SL WPPP DA+Q++ QI AYVEYFGQFT
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFT  43



>gb|AFW80281.1| gigantea1A [Zea mays]
Length=1086

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S  +WID LQF+SL WPPP DA+Q++ QI AYVEYFGQFT
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFT  43



>ref|XP_009802612.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
 ref|XP_009802613.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1156

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  325  ERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ERWID L  SSL WPPPQDAQQRK Q  AYV+YFGQ T
Sbjct  9    ERWIDGLHVSSLFWPPPQDAQQRKAQTAAYVKYFGQST  46



>gb|ADR51711.1| GI [Secale cereale]
Length=1142

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +1

Query  334  IDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            ID LQFSSL WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  1    IDGLQFSSLFWPPPHDAQQKQAQILAYVEYFGQFT  35



>ref|XP_010097648.1| hypothetical protein L484_023788 [Morus notabilis]
 gb|EXB70603.1| hypothetical protein L484_023788 [Morus notabilis]
Length=1195

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA + ERWIDRLQFSSL   P QDA Q+K Q+ AYV+YFGQFT
Sbjct  1    MADTRERWIDRLQFSSLFCHPSQDAHQKKAQVIAYVDYFGQFT  43



>ref|XP_009380419.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380420.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380421.1| PREDICTED: protein GIGANTEA-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS  +W + LQFSSL WPPP   QQ++ Q+ AYVEYFGQFT
Sbjct  1    MSASHGKWTNGLQFSSLFWPPPLGEQQKQAQVMAYVEYFGQFT  43



>gb|ABR18021.1| unknown [Picea sitchensis]
Length=1179

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S ++WI  LQ SSLV PPPQDAQQR+ +I AYVE F QFT
Sbjct  1    MSISEQKWIHGLQSSSLVRPPPQDAQQRQAEILAYVELFAQFT  43



>dbj|BAP76055.1| putative GI [Cryptomeria japonica]
Length=1197

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+   ++WI+ LQ SSL  PPPQDAQQR+ +I AYVE FGQ+T
Sbjct  1    MSLPRQKWIEGLQSSSLFRPPPQDAQQRQIEILAYVELFGQYT  43



>gb|AGH20049.1| GI [Picea abies]
Length=1179

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+ S ++WI  LQ SSL  PPPQDAQQR+ +I AYVE F QFT
Sbjct  1    MSISEQKWIHGLQSSSLFRPPPQDAQQRQAEILAYVELFAQFT  43



>emb|CDP21210.1| unnamed protein product [Coffea canephora]
Length=26

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQ  387
            MAASCERWID LQFSSL WPPP+DA+
Sbjct  1    MAASCERWIDGLQFSSLFWPPPKDAE  26



>gb|AEK05812.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05817.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05822.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05827.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05832.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05837.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05842.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05847.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05852.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05857.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05862.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05867.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05872.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05877.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05882.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05887.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05892.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05897.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05902.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05907.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05912.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05917.1| gigantea-5, partial [Populus balsamifera]
Length=26

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +1

Query  319  SCERWIDRLQFSSLVWPPPQDAQQRK  396
            S ERWID LQFSSL WPPPQDAQQRK
Sbjct  1    SSERWIDGLQFSSLFWPPPQDAQQRK  26



>ref|XP_010535090.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535098.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535104.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
Length=1167

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            MA+S E+WID LQFSSL WPPPQD QQR+DQ+ AYVEYFGQFT
Sbjct  1    MASSSEKWIDGLQFSSLFWPPPQDPQQRQDQVIAYVEYFGQFT  43



>gb|ADX35845.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  364  WPPPQDAQQRKDQITAYVEYFGQFT  438
            WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  2    WPPPHDAQQKQVQILAYVEYFGQFT  26



>gb|ADX35837.1| gigantea, partial [Brachypodium rupestre]
 gb|ADX35838.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35840.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35841.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35842.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35843.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35850.1| gigantea, partial [Brachypodium sylvaticum subsp. glaucovirens]
 gb|ADX35851.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35852.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35853.1| gigantea, partial [Brachypodium sylvaticum]
 gb|ADX35854.1| gigantea, partial [Brachypodium sylvaticum]
 gb|AFB78140.1| gigantea, partial [Brachypodium arbuscula]
 gb|AFB78141.1| gigantea, partial [Brachypodium arbuscula]
Length=110

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  364  WPPPQDAQQRKDQITAYVEYFGQFT  438
            WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  2    WPPPHDAQQKQVQILAYVEYFGQFT  26



>gb|ADX35846.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35847.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  364  WPPPQDAQQRKDQITAYVEYFGQFT  438
            WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  2    WPPPHDAQQKQVQILAYVEYFGQFT  26



>gb|AFB78142.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  364  WPPPQDAQQRKDQITAYVEYFGQFT  438
            WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  2    WPPPHDAQQKQVQILAYVEYFGQFT  26



>gb|ADX35848.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35849.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  364  WPPPQDAQQRKDQITAYVEYFGQFT  438
            WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  2    WPPPHDAQQKQVQILAYVEYFGQFT  26



>gb|ACJ09479.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  310  MAASCERWIDRLQFSSLVWPPPQDAQQRKDQITAYVEYFGQFT  438
            M+AS E+WID LQFSSL WPPPQD QQ++ QI AYVEYFGQFT
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDPQQKQAQILAYVEYFGQFT  43



>gb|ADX35839.1| gigantea, partial [Brachypodium retusum]
 gb|AFB78143.1| gigantea, partial [Brachypodium boissieri]
 gb|AFB78144.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  364  WPPPQDAQQRKDQITAYVEYFGQFT  438
            WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  2    WPPPHDAQQKQVQILAYVEYFGQFT  26



>gb|ADX35844.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +1

Query  364  WPPPQDAQQRKDQITAYVEYFGQFT  438
            WPPP DAQQ++ QI AYVEYFGQFT
Sbjct  2    WPPPHDAQQKQVQILAYVEYFGQFT  26



>gb|AGW52153.1| GI [Populus tomentosa]
Length=1241

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  313  AASCERWIDRLQFSSLVWPPPQDAQQRK  396
            ++S ERWID LQFSSL  PPPQDAQQRK
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRK  30



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840