BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS158A10

Length=435
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    154   6e-40   Tarenaya hassleriana [spider flower]
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    151   5e-39   
emb|CBI39439.3|  unnamed protein product                                149   1e-38   Vitis vinifera
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    149   2e-38   Vitis vinifera
ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    149   2e-38   Sesamum indicum [beniseed]
ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    149   2e-38   Solanum tuberosum [potatoes]
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    149   4e-38   Solanum lycopersicum
emb|CDP14623.1|  unnamed protein product                                148   4e-38   Coffea canephora [robusta coffee]
ref|XP_004156987.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    147   1e-37   
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    147   1e-37   Cucumis sativus [cucumbers]
gb|KJB37929.1|  hypothetical protein B456_006G227000                    147   1e-37   Gossypium raimondii
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    146   3e-37   Cucumis melo [Oriental melon]
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             146   3e-37   Phaseolus vulgaris [French bean]
ref|XP_006840189.1|  hypothetical protein AMTR_s00089p00108500          145   7e-37   
ref|XP_002518223.1|  receptor protein kinase, putative                  143   4e-36   Ricinus communis
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    142   7e-36   Glycine soja [wild soybean]
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    142   7e-36   Glycine max [soybeans]
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    142   8e-36   Nicotiana tomentosiformis
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    141   1e-35   Nicotiana sylvestris
gb|KHG00472.1|  hypothetical protein F383_20103                         141   1e-35   Gossypium arboreum [tree cotton]
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    140   2e-35   
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    140   3e-35   
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    140   4e-35   Glycine soja [wild soybean]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    140   4e-35   Glycine max [soybeans]
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    140   4e-35   Populus euphratica
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    140   4e-35   Eucalyptus grandis [rose gum]
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    140   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    139   8e-35   Populus euphratica
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    139   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    138   1e-34   Medicago truncatula
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    138   2e-34   Citrus sinensis [apfelsine]
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                138   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             137   2e-34   Citrus clementina [clementine]
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             135   1e-33   Eutrema salsugineum [saltwater cress]
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    135   2e-33   Arabis alpina [alpine rockcress]
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    133   1e-32   Malus domestica [apple tree]
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    132   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-32   Brassica rapa
emb|CDY20032.1|  BnaA09g02190D                                          132   2e-32   Brassica napus [oilseed rape]
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    132   2e-32   Fragaria vesca subsp. vesca
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    132   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    130   6e-32   Tarenaya hassleriana [spider flower]
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    130   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             129   2e-31   Capsella rubella
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    129   2e-31   Brassica rapa
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    129   2e-31   Cicer arietinum [garbanzo]
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    129   3e-31   Tarenaya hassleriana [spider flower]
emb|CDY00141.1|  BnaC09g01600D                                          128   7e-31   
gb|EPS70115.1|  hypothetical protein M569_04636                         127   1e-30   Genlisea aurea
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    126   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             125   4e-30   
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    123   2e-29   Elaeis guineensis
gb|KJB67930.1|  hypothetical protein B456_010G218400                    122   4e-29   Gossypium raimondii
gb|KJB67929.1|  hypothetical protein B456_010G218400                    122   9e-29   Gossypium raimondii
ref|XP_008350571.1|  PREDICTED: probably inactive leucine-rich re...    119   1e-28   
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    121   1e-28   Populus euphratica
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             121   1e-28   Populus trichocarpa [western balsam poplar]
gb|KJB73018.1|  hypothetical protein B456_011G209800                    121   1e-28   Gossypium raimondii
gb|KHG09451.1|  hypothetical protein F383_09289                         121   1e-28   Gossypium arboreum [tree cotton]
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    121   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-28   Citrus sinensis [apfelsine]
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-28   Vitis vinifera
gb|KDO67528.1|  hypothetical protein CISIN_1g002321mg                   120   2e-28   Citrus sinensis [apfelsine]
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg             120   2e-28   
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g             120   3e-28   
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein       120   3e-28   Arabis alpina [alpine rockcress]
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    120   4e-28   Cucumis sativus [cucumbers]
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...    119   5e-28   Populus euphratica
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...    119   5e-28   Populus euphratica
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg             119   5e-28   
gb|KDP37890.1|  hypothetical protein JCGZ_05772                         119   6e-28   Jatropha curcas
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...    119   6e-28   Cucumis melo [Oriental melon]
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079             119   7e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    119   7e-28   Prunus mume [ume]
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg             119   9e-28   Prunus persica
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein       119   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KHG03607.1|  hypothetical protein F383_26757                         119   1e-27   Gossypium arboreum [tree cotton]
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...    119   1e-27   Prunus mume [ume]
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg             118   1e-27   
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg             118   1e-27   Capsella rubella
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...    118   1e-27   Cucumis sativus [cucumbers]
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    118   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...    118   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...    117   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...    117   3e-27   Cucumis melo [Oriental melon]
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...    117   3e-27   Elaeis guineensis
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    117   4e-27   
ref|XP_002520879.1|  ATP binding protein, putative                      117   4e-27   Ricinus communis
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...    117   5e-27   Phoenix dactylifera
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...    117   5e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...    116   6e-27   
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    116   7e-27   Nicotiana tomentosiformis
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...    116   7e-27   
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg             116   8e-27   Eutrema salsugineum [saltwater cress]
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...    116   8e-27   
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598              116   9e-27   Selaginella moellendorffii
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...    116   9e-27   
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...    116   9e-27   Populus euphratica
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...    115   1e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|AAL49790.1|  unknown protein                                         115   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...    115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...    115   2e-26   
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...    115   2e-26   Elaeis guineensis
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...    115   2e-26   Solanum tuberosum [potatoes]
gb|KDP21644.1|  hypothetical protein JCGZ_03315                         115   2e-26   Jatropha curcas
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...    115   2e-26   Ricinus communis
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...    114   3e-26   Glycine max [soybeans]
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...    114   3e-26   Brassica rapa
ref|XP_008388889.1|  PREDICTED: probably inactive leucine-rich re...    112   3e-26   
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...    114   4e-26   Setaria italica
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...    114   5e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...    114   6e-26   
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160          114   6e-26   Sorghum bicolor [broomcorn]
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    113   8e-26   Vitis vinifera
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...    113   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    113   8e-26   Populus euphratica
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...    113   9e-26   Populus euphratica
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...    113   1e-25   Glycine max [soybeans]
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...    113   1e-25   Solanum lycopersicum
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g             113   1e-25   Phaseolus vulgaris [French bean]
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    113   1e-25   
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688              112   1e-25   
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...    112   1e-25   Morus notabilis
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    112   1e-25   Solanum tuberosum [potatoes]
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    112   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    112   1e-25   Nicotiana sylvestris
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...    112   2e-25   
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    112   2e-25   
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...    112   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...    112   2e-25   Pyrus x bretschneideri [bai li]
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    112   2e-25   Glycine max [soybeans]
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    112   2e-25   Glycine max [soybeans]
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    112   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...    112   2e-25   Cicer arietinum [garbanzo]
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...    112   3e-25   Solanum lycopersicum
gb|EPS70735.1|  hypothetical protein M569_04020                         112   3e-25   Genlisea aurea
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...    112   3e-25   
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg             112   3e-25   
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...    112   3e-25   Eucalyptus grandis [rose gum]
ref|XP_006842493.1|  hypothetical protein AMTR_s00077p00091370          111   3e-25   Amborella trichopoda
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...    111   3e-25   Citrus sinensis [apfelsine]
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                   111   3e-25   Citrus sinensis [apfelsine]
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...    110   6e-25   Glycine soja [wild soybean]
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...    110   6e-25   Glycine max [soybeans]
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg                110   6e-25   Erythranthe guttata [common monkey flower]
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...    110   1e-24   Eucalyptus grandis [rose gum]
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...    110   1e-24   Cicer arietinum [garbanzo]
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...    109   2e-24   Tarenaya hassleriana [spider flower]
gb|AES79844.2|  LRR receptor-like kinase family protein                 109   2e-24   Medicago truncatula
ref|XP_003623626.1|  Receptor-like protein kinase                       109   2e-24   
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g             109   2e-24   Phaseolus vulgaris [French bean]
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...    109   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...    108   3e-24   Solanum lycopersicum
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...    108   4e-24   Sesamum indicum [beniseed]
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...    108   4e-24   Cucumis sativus [cucumbers]
ref|XP_004173348.1|  PREDICTED: probably inactive leucine-rich re...    108   4e-24   
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    108   4e-24   Fragaria vesca subsp. vesca
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...    108   5e-24   Nicotiana sylvestris
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...    108   5e-24   Nicotiana tomentosiformis
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg                108   6e-24   Erythranthe guttata [common monkey flower]
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...    107   8e-24   
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...    107   9e-24   Cucumis melo [Oriental melon]
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g             107   1e-23   Phaseolus vulgaris [French bean]
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg             107   1e-23   
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...    107   1e-23   Prunus mume [ume]
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...    107   1e-23   Solanum tuberosum [potatoes]
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...    107   1e-23   
dbj|BAB92869.1|  putative receptor-like protein kinase                  107   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EAY77289.1|  hypothetical protein OsI_05265                          107   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...    106   2e-23   Fragaria vesca subsp. vesca
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...    106   2e-23   
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...    106   3e-23   Pyrus x bretschneideri [bai li]
gb|KJB71525.1|  hypothetical protein B456_011G127000                    106   3e-23   Gossypium raimondii
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein        105   4e-23   Medicago truncatula
gb|EEC75203.1|  hypothetical protein OsI_11455                          105   6e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    105   6e-23   Sesamum indicum [beniseed]
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...    105   7e-23   Tarenaya hassleriana [spider flower]
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    104   1e-22   
dbj|BAK06250.1|  predicted protein                                      104   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    103   2e-22   Morus notabilis
ref|XP_003605286.1|  Receptor-like protein kinase                       103   3e-22   Medicago truncatula
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    102   5e-22   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI25352.3|  unnamed protein product                                102   6e-22   Vitis vinifera
ref|XP_001771841.1|  predicted protein                                  102   8e-22   
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...    101   1e-21   Brachypodium distachyon [annual false brome]
ref|NP_001050035.1|  Os03g0335500                                       100   2e-21   
emb|CDX72142.1|  BnaC08g27320D                                          100   2e-21   
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...    100   2e-21   
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...    100   3e-21   Nicotiana sylvestris
emb|CDY27220.1|  BnaA09g35820D                                          100   3e-21   Brassica napus [oilseed rape]
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...    100   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             100   3e-21   Eutrema salsugineum [saltwater cress]
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             100   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             100   4e-21   
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...  99.8    5e-21   Oryza brachyantha
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...  99.4    6e-21   
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...  99.4    6e-21   
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189           99.4    7e-21   
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...  99.4    7e-21   
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...  99.0    8e-21   Brassica rapa
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg           99.0    8e-21   Capsella rubella
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...  99.0    9e-21   Elaeis guineensis
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                  98.2    2e-20   Arabis alpina [alpine rockcress]
gb|EAZ26832.1|  hypothetical protein OsJ_10748                        98.2    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...  98.2    2e-20   
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...  98.2    2e-20   Setaria italica
gb|ACN33819.1|  unknown                                               97.8    2e-20   Zea mays [maize]
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350        97.8    2e-20   
ref|XP_001769840.1|  predicted protein                                97.4    3e-20   
emb|CBI18033.3|  unnamed protein product                              96.7    5e-20   Vitis vinifera
ref|NP_001170194.1|  uncharacterized protein LOC100384143 precursor   93.6    8e-20   
dbj|BAF79960.1|  receptor-like kinase                                 95.5    1e-19   Marchantia polymorpha
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  95.5    1e-19   
emb|CDP13903.1|  unnamed protein product                              94.4    3e-19   Coffea canephora [robusta coffee]
ref|XP_002990527.1|  hypothetical protein SELMODRAFT_131809           89.4    5e-19   
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  93.6    6e-19   Sesamum indicum [beniseed]
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...  93.2    1e-18   Zea mays [maize]
dbj|BAJ85468.1|  predicted protein                                    92.8    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB85306.1|  putative receptor-like protein kinase                92.0    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76307.1|  hypothetical protein OsI_04242                        92.0    2e-18   Oryza sativa Indica Group [Indian rice]
emb|CDY04822.1|  BnaAnng00040D                                        92.0    2e-18   
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...  89.7    1e-17   Brachypodium distachyon [annual false brome]
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...  85.1    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240        81.3    1e-14   Sorghum bicolor [broomcorn]
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...  80.9    2e-14   Brachypodium distachyon [annual false brome]
emb|CBI22599.3|  unnamed protein product                              77.4    4e-14   Vitis vinifera
emb|CDX85183.1|  BnaC07g24940D                                        79.0    6e-14   
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480        79.0    7e-14   Sorghum bicolor [broomcorn]
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...  78.6    9e-14   Setaria italica
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...  78.6    9e-14   
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...  77.4    2e-13   
ref|XP_010662782.1|  PREDICTED: probable LRR receptor-like serine...  77.4    2e-13   Vitis vinifera
ref|XP_010662779.1|  PREDICTED: LRR receptor-like serine/threonin...  72.8    7e-13   
ref|XP_001759642.1|  predicted protein                                74.7    2e-12   
ref|XP_002980098.1|  hypothetical protein SELMODRAFT_30384            74.7    2e-12   
ref|NP_001055909.1|  Os05g0491400                                     71.2    2e-12   
gb|EAY98521.1|  hypothetical protein OsI_20433                        71.2    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_002992683.1|  hypothetical protein SELMODRAFT_40400            73.6    4e-12   
ref|XP_010103492.1|  Receptor-like protein kinase HSL1                73.2    5e-12   Morus notabilis
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...  72.8    8e-12   Zea mays [maize]
ref|NP_001055847.2|  Os05g0478300                                     72.8    9e-12   
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg           72.4    1e-11   Citrus clementina [clementine]
dbj|BAK02926.1|  predicted protein                                    72.8    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007148036.1|  hypothetical protein PHAVU_006G175100g           72.0    1e-11   Phaseolus vulgaris [French bean]
dbj|BAJ86449.1|  predicted protein                                    72.4    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD15537.1|  hypothetical protein                                 69.3    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007023498.1|  Serine-threonine protein kinase, plant-type,...  71.6    1e-11   
ref|XP_009769350.1|  PREDICTED: probable inactive leucine-rich re...  71.6    1e-11   Nicotiana sylvestris
gb|KDO45821.1|  hypothetical protein CISIN_1g002063mg                 71.6    2e-11   Citrus sinensis [apfelsine]
gb|KDO45819.1|  hypothetical protein CISIN_1g002063mg                 71.6    2e-11   Citrus sinensis [apfelsine]
ref|XP_007023499.1|  Serine-threonine protein kinase, plant-type,...  68.9    2e-11   
emb|CDY14823.1|  BnaC04g48200D                                        70.9    3e-11   Brassica napus [oilseed rape]
ref|XP_011101396.1|  PREDICTED: probable LRR receptor-like serine...  70.9    3e-11   Sesamum indicum [beniseed]
ref|XP_011101397.1|  PREDICTED: probable LRR receptor-like serine...  70.9    3e-11   Sesamum indicum [beniseed]
gb|KDP21105.1|  hypothetical protein JCGZ_21576                       70.9    3e-11   Jatropha curcas
ref|XP_006478192.1|  PREDICTED: receptor-like protein kinase HAIK...  70.9    3e-11   Citrus sinensis [apfelsine]
ref|XP_006595408.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  70.1    5e-11   
ref|XP_009142052.1|  PREDICTED: probable inactive leucine-rich re...  70.1    5e-11   Brassica rapa
emb|CDY47962.1|  BnaA04g24400D                                        70.1    5e-11   Brassica napus [oilseed rape]
ref|XP_002268246.1|  PREDICTED: LRR receptor-like serine/threonin...  70.5    5e-11   
ref|NP_001047431.1|  Os02g0615500                                     70.1    6e-11   
gb|EEE57372.1|  hypothetical protein OsJ_07527                        70.1    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010242337.1|  PREDICTED: LRR receptor-like serine/threonin...  69.7    7e-11   Nelumbo nucifera [Indian lotus]
gb|KJB34896.1|  hypothetical protein B456_006G089100                  69.3    1e-10   Gossypium raimondii
emb|CAI64397.1|  putative leucine-rich repeat protein                 65.5    1e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010999746.1|  PREDICTED: probable LRR receptor-like serine...  69.3    1e-10   Populus euphratica
ref|XP_006372760.1|  hypothetical protein POPTR_0017s04790g           68.9    1e-10   
ref|XP_006293827.1|  hypothetical protein CARUB_v10022811mg           68.6    2e-10   Capsella rubella
ref|XP_004246027.1|  PREDICTED: LRR receptor-like serine/threonin...  68.6    2e-10   Solanum lycopersicum
ref|XP_006293826.1|  hypothetical protein CARUB_v10022811mg           68.6    2e-10   
ref|XP_003636791.1|  Protein STRUBBELIG-RECEPTOR FAMILY               68.6    2e-10   
ref|XP_006384063.1|  hypothetical protein POPTR_0004s05680g           68.6    2e-10   Populus trichocarpa [western balsam poplar]
gb|KEH36609.1|  LRR receptor-like kinase                              68.2    2e-10   Medicago truncatula
dbj|BAJ84911.1|  predicted protein                                    68.6    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004508778.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    2e-10   Cicer arietinum [garbanzo]
gb|EEE64100.1|  hypothetical protein OsJ_18931                        68.6    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EPS73511.1|  hypothetical protein M569_01245                       68.2    2e-10   Genlisea aurea
ref|XP_004508779.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    2e-10   
ref|XP_009410928.1|  PREDICTED: probable LRR receptor-like serine...  68.2    2e-10   
ref|XP_006586717.1|  PREDICTED: LRR receptor-like serine/threonin...  68.2    2e-10   
ref|XP_010915498.1|  PREDICTED: probable LRR receptor-like serine...  68.2    2e-10   
ref|NP_001239788.1|  LRR receptor-like serine/threonine-protein k...  67.8    2e-10   
ref|XP_002966565.1|  hypothetical protein SELMODRAFT_407578           68.2    3e-10   
tpg|DAA47958.1|  TPA: putative leucine-rich repat protein kinase ...  67.4    3e-10   
ref|XP_007141566.1|  hypothetical protein PHAVU_008G206700g           65.1    3e-10   
ref|XP_007158112.1|  hypothetical protein PHAVU_002G125100g           67.8    3e-10   
emb|CDO96809.1|  unnamed protein product                              67.8    3e-10   
ref|XP_002994468.1|  hypothetical protein SELMODRAFT_432388           65.9    3e-10   
ref|XP_010508595.1|  PREDICTED: probable inactive leucine-rich re...  67.8    3e-10   
gb|KHN38434.1|  BRASSINOSTEROID INSENSITIVE 1-associated receptor...  64.7    3e-10   
ref|XP_004504296.1|  PREDICTED: probable LRR receptor-like serine...  67.8    3e-10   
ref|XP_009589224.1|  PREDICTED: probably inactive leucine-rich re...  67.8    4e-10   
gb|ACI95776.1|  PAN1                                                  67.4    4e-10   
emb|CDP14870.1|  unnamed protein product                              67.4    4e-10   
ref|XP_008646984.1|  PREDICTED: uncharacterized protein LOC100501...  67.4    4e-10   
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...  67.4    4e-10   
gb|ACU19288.1|  unknown                                               64.7    4e-10   
emb|CBI30696.3|  unnamed protein product                              67.4    4e-10   
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...  67.4    4e-10   
ref|XP_001777608.1|  predicted protein                                67.4    4e-10   
ref|XP_003519488.1|  PREDICTED: somatic embryogenesis receptor ki...  64.7    4e-10   
gb|AIZ46839.1|  leucine-rich repeat receptor-like protein CLAVATA2    67.4    4e-10   
ref|XP_008664633.1|  PREDICTED: probable LRR receptor-like serine...  67.4    4e-10   
ref|XP_006394359.1|  hypothetical protein EUTSA_v10003855mg           67.4    4e-10   
ref|XP_010662800.1|  PREDICTED: leucine-rich repeat receptor prot...  67.4    4e-10   
ref|NP_001241394.1|  somatic embryogenesis receptor kinase 1-like...  64.7    4e-10   
gb|ACU22741.1|  unknown                                               64.7    5e-10   
ref|XP_004491185.1|  PREDICTED: somatic embryogenesis receptor ki...  64.7    5e-10   
ref|XP_002266057.1|  PREDICTED: probable LRR receptor-like serine...  67.4    5e-10   
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...  67.4    5e-10   
gb|EYU29140.1|  hypothetical protein MIMGU_mgv1a022602mg              67.0    5e-10   
ref|XP_010525796.1|  PREDICTED: putative leucine-rich repeat rece...  67.4    5e-10   
ref|XP_008453173.1|  PREDICTED: LRR receptor-like serine/threonin...  67.0    5e-10   
ref|XP_008789160.1|  PREDICTED: inactive receptor-like serine/thr...  67.4    5e-10   
ref|XP_002982402.1|  hypothetical protein SELMODRAFT_116152           67.4    5e-10   
ref|XP_008789989.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  67.0    5e-10   
gb|EPS67146.1|  hypothetical protein M569_07630                       67.0    5e-10   
ref|XP_010662638.1|  PREDICTED: probable leucine-rich repeat rece...  67.4    6e-10   
ref|XP_010057110.1|  PREDICTED: probable LRR receptor-like serine...  67.0    6e-10   
ref|XP_010057112.1|  PREDICTED: probable LRR receptor-like serine...  67.0    6e-10   
ref|XP_010057111.1|  PREDICTED: probable LRR receptor-like serine...  67.0    6e-10   
ref|XP_004138149.1|  PREDICTED: LRR receptor-like serine/threonin...  67.0    6e-10   
ref|XP_004512361.1|  PREDICTED: LRR receptor-like serine/threonin...  66.6    6e-10   
gb|AEW49518.1|  putative LRR-RLK protein XIAO                         67.0    7e-10   
ref|XP_009776550.1|  PREDICTED: inactive receptor-like serine/thr...  66.6    7e-10   
emb|CAH66725.1|  H0404F02.1                                           67.0    7e-10   
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...  67.0    7e-10   
gb|EEE61543.1|  hypothetical protein OsJ_15867                        67.0    7e-10   
ref|XP_010265781.1|  PREDICTED: probable inactive leucine-rich re...  66.6    7e-10   
ref|XP_007141567.1|  hypothetical protein PHAVU_008G206700g           64.7    8e-10   
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg              66.6    8e-10   
gb|ACJ86048.1|  unknown                                               63.9    8e-10   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051            67.0    8e-10   
ref|XP_010922598.1|  PREDICTED: inactive receptor-like serine/thr...  66.2    8e-10   
gb|KHG29212.1|  LRR receptor-like serine/threonine-protein kinase...  66.2    8e-10   
ref|XP_003568840.1|  PREDICTED: LRR receptor-like serine/threonin...  66.6    8e-10   
ref|XP_002534282.1|  receptor protein kinase, putative                66.6    8e-10   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558            66.6    8e-10   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  66.6    8e-10   
ref|XP_011085985.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  66.6    8e-10   
gb|KHN41747.1|  LRR receptor-like serine/threonine-protein kinase...  66.2    9e-10   
ref|XP_006656945.1|  PREDICTED: LRR receptor-like serine/threonin...  66.6    9e-10   
ref|NP_181758.1|  leucine-rich repeat protein kinase family protein   66.2    9e-10   
gb|KJB68378.1|  hypothetical protein B456_010G241800                  66.6    9e-10   
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...  66.6    1e-09   
gb|KJB34897.1|  hypothetical protein B456_006G089100                  66.2    1e-09   
ref|XP_007136453.1|  hypothetical protein PHAVU_009G046600g           66.2    1e-09   
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like           66.6    1e-09   
ref|XP_004299405.1|  PREDICTED: LRR receptor-like serine/threonin...  65.9    1e-09   
ref|XP_003553344.2|  PREDICTED: probably inactive leucine-rich re...  66.2    1e-09   
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  63.2    1e-09   
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...  66.2    1e-09   
ref|XP_001781758.1|  predicted protein                                66.2    1e-09   
ref|XP_010506042.1|  PREDICTED: probable inactive leucine-rich re...  66.2    1e-09   
ref|XP_010517745.1|  PREDICTED: probable inactive leucine-rich re...  65.9    1e-09   
ref|XP_003569550.1|  PREDICTED: probable LRR receptor-like serine...  65.9    1e-09   
gb|KJB68379.1|  hypothetical protein B456_010G241800                  65.9    1e-09   
ref|XP_006449513.1|  hypothetical protein CICLE_v10014435mg           65.9    1e-09   
ref|XP_002268170.2|  PREDICTED: probable LRR receptor-like serine...  66.2    1e-09   
emb|CAN64389.1|  hypothetical protein VITISV_018647                   66.2    1e-09   
ref|XP_006467639.1|  PREDICTED: probable LRR receptor-like serine...  65.9    1e-09   
gb|KDO77873.1|  hypothetical protein CISIN_1g005734mg                 65.9    1e-09   
ref|XP_002978660.1|  hypothetical protein SELMODRAFT_109190           65.9    2e-09   
gb|KFK32683.1|  hypothetical protein AALP_AA6G275300                  65.9    2e-09   
gb|KJB79706.1|  hypothetical protein B456_013G063100                  65.5    2e-09   
ref|XP_008804971.1|  PREDICTED: probable LRR receptor-like serine...  65.1    2e-09   
ref|XP_002519895.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  65.5    2e-09   
gb|EMT16678.1|  LRR receptor-like serine/threonine-protein kinase...  65.9    2e-09   
ref|XP_010276978.1|  PREDICTED: probable LRR receptor-like serine...  65.9    2e-09   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...  65.9    2e-09   
gb|KJB68376.1|  hypothetical protein B456_010G241800                  65.9    2e-09   
ref|XP_010276980.1|  PREDICTED: probable LRR receptor-like serine...  65.9    2e-09   
ref|XP_009421476.1|  PREDICTED: receptor-like protein kinase HSL1     65.9    2e-09   
ref|XP_009614181.1|  PREDICTED: LRR receptor-like serine/threonin...  65.5    2e-09   
ref|XP_011047703.1|  PREDICTED: receptor-like protein kinase HSL1     65.9    2e-09   
ref|XP_002303477.2|  hypothetical protein POPTR_0003s10410g           65.5    2e-09   
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...  65.1    2e-09   
gb|AIY22766.1|  somatic embryogenesis receptor kinase like 1 vari...  65.5    2e-09   
ref|XP_006412696.1|  hypothetical protein EUTSA_v10024678mg           65.1    2e-09   
ref|XP_010276982.1|  PREDICTED: probable LRR receptor-like serine...  65.5    2e-09   
ref|XP_006377415.1|  hypothetical protein POPTR_0011s05710g           65.9    2e-09   
ref|XP_008804963.1|  PREDICTED: inactive receptor-like serine/thr...  65.5    2e-09   
ref|XP_007210873.1|  hypothetical protein PRUPE_ppa003105mg           65.5    2e-09   
gb|KHG10910.1|  Receptor-like protein kinase HSL1                     65.9    2e-09   
ref|XP_002984595.1|  hypothetical protein SELMODRAFT_120629           65.5    2e-09   
ref|XP_002301998.2|  leucine-rich repeat family protein               65.9    2e-09   
ref|XP_008239850.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    2e-09   
gb|KHG00778.1|  hypothetical protein F383_20723                       65.5    2e-09   
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  65.5    2e-09   
ref|XP_008394281.1|  PREDICTED: putative leucine-rich repeat rece...  65.5    2e-09   
ref|XP_011082273.1|  PREDICTED: LRR receptor-like serine/threonin...  65.1    2e-09   
ref|XP_002994469.1|  hypothetical protein SELMODRAFT_432389           65.5    2e-09   
gb|KDO62658.1|  hypothetical protein CISIN_1g047929mg                 65.5    2e-09   
ref|XP_008456679.1|  PREDICTED: receptor-like protein kinase HAIKU2   65.5    2e-09   
ref|XP_004969518.1|  PREDICTED: probable LRR receptor-like serine...  65.1    2e-09   
ref|XP_007028918.1|  Leucine-rich repeat protein kinase family pr...  65.1    2e-09   
ref|XP_004140933.1|  PREDICTED: LRR receptor-like serine/threonin...  65.5    2e-09   
emb|CBI22711.3|  unnamed protein product                              65.5    2e-09   
ref|XP_004159444.1|  PREDICTED: LRR receptor-like serine/threonin...  65.5    2e-09   
ref|XP_003602344.1|  Kinase-like protein                              65.5    2e-09   
ref|XP_001774556.1|  predicted protein                                65.5    2e-09   
ref|XP_007210869.1|  hypothetical protein PRUPE_ppa003168mg           65.1    2e-09   
emb|CAN61943.1|  hypothetical protein VITISV_017886                   65.1    3e-09   
ref|XP_009398826.1|  PREDICTED: probable LRR receptor-like serine...  65.5    3e-09   
gb|EYU37463.1|  hypothetical protein MIMGU_mgv1a003320mg              65.1    3e-09   
ref|XP_009419181.1|  PREDICTED: probably inactive leucine-rich re...  65.1    3e-09   
ref|XP_006412695.1|  hypothetical protein EUTSA_v10024678mg           65.1    3e-09   
gb|KJB25051.1|  hypothetical protein B456_004G175500                  64.3    3e-09   
ref|XP_006832864.1|  hypothetical protein AMTR_s00095p00075330        62.4    3e-09   
ref|XP_010112995.1|  LRR receptor-like serine/threonine-protein k...  61.6    3e-09   
ref|XP_011086853.1|  PREDICTED: somatic embryogenesis receptor ki...  62.4    3e-09   
ref|XP_009607758.1|  PREDICTED: probable LRR receptor-like serine...  65.1    3e-09   
ref|XP_009124332.1|  PREDICTED: somatic embryogenesis receptor ki...  62.4    3e-09   
ref|XP_010247922.1|  PREDICTED: receptor-like protein kinase HSL1     65.1    3e-09   
ref|XP_009416848.1|  PREDICTED: somatic embryogenesis receptor ki...  62.4    3e-09   
gb|KEH28345.1|  somatic embryogenesis receptor kinase-like protein    61.6    3e-09   
gb|KHN08427.1|  Putative LRR receptor-like serine/threonine-prote...  64.7    3e-09   
ref|XP_004974753.1|  PREDICTED: leucine-rich repeat receptor-like...  64.7    3e-09   
ref|XP_007040925.1|  Leucine-rich repeat protein kinase family pr...  64.3    3e-09   
ref|XP_010420958.1|  PREDICTED: somatic embryogenesis receptor ki...  62.4    3e-09   
ref|XP_006579547.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    3e-09   
ref|XP_006657091.1|  PREDICTED: probable LRR receptor-like serine...  65.1    3e-09   
ref|XP_002283683.1|  PREDICTED: somatic embryogenesis receptor ki...  62.0    3e-09   
ref|XP_011028007.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    3e-09   
gb|EYU37129.1|  hypothetical protein MIMGU_mgv1a003448mg              64.7    3e-09   
ref|XP_006850125.1|  hypothetical protein AMTR_s00022p00229730        64.7    3e-09   
ref|XP_011028003.1|  PREDICTED: LRR receptor-like serine/threonin...  64.7    4e-09   
ref|XP_007040924.1|  Leucine-rich repeat protein kinase family pr...  64.7    4e-09   
ref|XP_002456123.1|  hypothetical protein SORBIDRAFT_03g030925        62.0    4e-09   
gb|KJB25050.1|  hypothetical protein B456_004G175500                  64.3    4e-09   
gb|KHN09275.1|  Leucine-rich repeat receptor-like protein CLAVATA2    61.6    4e-09   
ref|XP_003617092.1|  Somatic embryogenesis receptor kinase            61.2    4e-09   
gb|KCW51007.1|  hypothetical protein EUGRSUZ_J00633                   61.6    4e-09   
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...  64.7    4e-09   
ref|XP_008669002.1|  PREDICTED: probable LRR receptor-like serine...  64.7    4e-09   
ref|XP_002437981.1|  hypothetical protein SORBIDRAFT_10g005850        64.7    4e-09   
ref|NP_197608.1|  leucine-rich repeat-containing protein              62.0    4e-09   
ref|XP_008675205.1|  PREDICTED: probable LRR receptor-like serine...  64.3    4e-09   
ref|XP_002885082.1|  hypothetical protein ARALYDRAFT_897815           61.2    4e-09   
gb|KHG13399.1|  hypothetical protein F383_10003                       64.7    4e-09   
gb|KJB25049.1|  hypothetical protein B456_004G175500                  64.3    4e-09   
ref|XP_008675203.1|  PREDICTED: probable LRR receptor-like serine...  64.3    4e-09   
ref|XP_006400679.1|  hypothetical protein EUTSA_v10014631mg           62.0    4e-09   
ref|XP_006428064.1|  hypothetical protein CICLE_v10024775mg           64.7    4e-09   
ref|XP_004970305.1|  PREDICTED: somatic embryogenesis receptor ki...  61.6    4e-09   
emb|CBI32849.3|  unnamed protein product                              63.2    4e-09   
ref|XP_009397143.1|  PREDICTED: inactive receptor-like serine/thr...  64.3    4e-09   
ref|XP_011028955.1|  PREDICTED: probable LRR receptor-like serine...  64.7    4e-09   
ref|XP_004231550.1|  PREDICTED: probable LRR receptor-like serine...  64.3    4e-09   
ref|XP_010525273.1|  PREDICTED: probably inactive leucine-rich re...  62.4    4e-09   
gb|KHN29479.1|  Receptor-like protein 12                              64.7    4e-09   
ref|XP_010315618.1|  PREDICTED: probable LRR receptor-like serine...  64.3    4e-09   
ref|XP_010662637.1|  PREDICTED: probable leucine-rich repeat rece...  63.2    5e-09   
gb|EPS73860.1|  hypothetical protein M569_00895                       61.6    5e-09   
gb|KDP39728.1|  hypothetical protein JCGZ_02748                       64.3    5e-09   
ref|XP_008238033.1|  PREDICTED: LRR receptor-like serine/threonin...  64.3    5e-09   
ref|XP_003534623.2|  PREDICTED: LRR receptor-like serine/threonin...  64.3    5e-09   
ref|XP_004976562.1|  PREDICTED: probable LRR receptor-like serine...  64.7    5e-09   
ref|XP_010662622.1|  PREDICTED: putative leucine-rich repeat rece...  63.9    5e-09   
gb|EYU34317.1|  hypothetical protein MIMGU_mgv1a0033341mg             61.2    5e-09   
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  64.3    5e-09   
gb|KHG30701.1|  hypothetical protein F383_11023                       62.0    5e-09   
gb|AET00051.2|  somatic embryogenesis receptor kinase-like protein    61.2    5e-09   
emb|CAN66410.1|  hypothetical protein VITISV_020977                   63.9    5e-09   
ref|XP_009395715.1|  PREDICTED: probable LRR receptor-like serine...  64.3    5e-09   
emb|CDX71991.1|  BnaC08g28830D                                        62.0    5e-09   
gb|KDO59946.1|  hypothetical protein CISIN_1g0130042mg                63.5    5e-09   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820        63.9    5e-09   
ref|XP_009786947.1|  PREDICTED: probable LRR receptor-like serine...  63.9    5e-09   
ref|XP_002449087.1|  hypothetical protein SORBIDRAFT_05g004560        64.3    6e-09   
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...  63.9    6e-09   
ref|XP_007159453.1|  hypothetical protein PHAVU_002G238900g           63.9    6e-09   
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...  64.3    6e-09   
ref|XP_009343456.1|  PREDICTED: LRR receptor-like serine/threonin...  63.9    6e-09   
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...  64.3    6e-09   
ref|XP_008385628.1|  PREDICTED: somatic embryogenesis receptor ki...  61.2    6e-09   
dbj|BAK04048.1|  predicted protein                                    60.8    6e-09   
emb|CBI22585.3|  unnamed protein product                              63.5    6e-09   
ref|XP_006452329.1|  hypothetical protein CICLE_v10010752mg           63.9    6e-09   
ref|XP_003617091.1|  Somatic embryogenesis receptor kinase            61.2    6e-09   
gb|ACJ85954.1|  unknown                                               61.2    6e-09   
ref|XP_002318612.2|  hypothetical protein POPTR_0012s07290g           63.5    6e-09   
ref|XP_010454429.1|  PREDICTED: somatic embryogenesis receptor ki...  61.2    6e-09   
ref|XP_009773743.1|  PREDICTED: LRR receptor-like serine/threonin...  63.9    6e-09   
ref|XP_009358564.1|  PREDICTED: putative leucine-rich repeat rece...  63.9    6e-09   
ref|XP_010325645.1|  PREDICTED: LRR receptor-like serine/threonin...  63.5    6e-09   
ref|XP_006493855.1|  PREDICTED: somatic embryogenesis receptor ki...  63.9    7e-09   
ref|XP_006432830.1|  hypothetical protein CICLE_v10000648mg           63.5    7e-09   
gb|KDP34452.1|  hypothetical protein JCGZ_11923                       63.9    7e-09   
gb|AFK45363.1|  unknown                                               61.2    7e-09   
ref|XP_010092461.1|  putative LRR receptor-like serine/threonine-...  63.9    7e-09   
gb|KDO47825.1|  hypothetical protein CISIN_1g0076682mg                63.5    7e-09   
ref|XP_010414844.1|  PREDICTED: receptor-like protein kinase HSL1...  63.9    7e-09   
ref|XP_010414842.1|  PREDICTED: receptor-like protein kinase HSL1...  63.9    7e-09   
ref|XP_009339518.1|  PREDICTED: somatic embryogenesis receptor ki...  61.2    7e-09   
gb|AFO67894.1|  leucine-rich repeat receptor-like kinase              63.5    7e-09   
ref|XP_002864814.1|  leucine-rich repeat family protein               63.5    7e-09   
gb|ABK93925.1|  unknown                                               63.5    7e-09   
emb|CDX72249.1|  BnaC07g42710D                                        63.5    7e-09   
gb|KDO47823.1|  hypothetical protein CISIN_1g0076682mg                63.5    7e-09   



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G A S QLNDDVLGLIVFK  + DP+SHL +W+EDD SPC+W ++KC+PA GRVSE+ L 
Sbjct  23   GDAGSFQLNDDVLGLIVFKADINDPSSHLESWNEDDYSPCSWKYIKCNPATGRVSEISLD  82

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GLGLSGKIGRG++KL+HL VLSL+ NNF+G I PQ+GL+T LQ
Sbjct  83   GLGLSGKIGRGVQKLQHLKVLSLSDNNFTGNIIPQIGLITGLQ  125



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +3

Query  51   IYIMGFRsmlllvflsvlsvTSGAGGAE-SLQLNDDVLGLIVFKGGVQDPASHLATWSED  227
            + +MGFR +++ + LS+  +    G  + S+QLNDDVLGLIVFK  ++DP+S+L +W+ED
Sbjct  4    MVVMGFRQLVVFLLLSMAVLHGCMGNDDASIQLNDDVLGLIVFKSDIKDPSSYLDSWNED  63

Query  228  DDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQ  407
            D+SPC+W F++C+P NGRVSEV L+GLGLSGKIG+GL+KL++L VLSL+ NNFSG ISP+
Sbjct  64   DNSPCSWRFIQCNPVNGRVSEVSLNGLGLSGKIGKGLQKLQYLKVLSLSHNNFSGSISPE  123

Query  408  LGLLTNLQ  431
            LGL+ +L+
Sbjct  124  LGLIGSLE  131



>emb|CBI39439.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            +Q+NDDVLGLIVFK G+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  8    IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  67

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+
Sbjct  68   GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLE  105



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            +Q+NDDVLGLIVFK G+ DP+S L +WSEDDDSPC+W FV+C+P+ GRVSEV + GLGLS
Sbjct  34   IQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCNPSTGRVSEVSVDGLGLS  93

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GKIGRGLEKL++L VLSL+ NNFSG ISP+L L+T L+
Sbjct  94   GKIGRGLEKLQNLKVLSLSFNNFSGSISPELALITGLE  131



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +3

Query  114  SGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  293
            +G  G E+LQLNDDVLGLIV K G QDP   L +W+EDD+SPCAW F+KC+P N RVSEV
Sbjct  22   TGCFGGETLQLNDDVLGLIVLKSGFQDPFKSLDSWNEDDESPCAWKFIKCNPGNNRVSEV  81

Query  294  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             L GLGLSGKIGRGLEKL+ L VLSL+SNN +G I P+L L+ NL+
Sbjct  82   SLDGLGLSGKIGRGLEKLQSLKVLSLSSNNLTGSIIPELALIPNLE  127



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            ++QLNDDVLGLIVFK  + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVTELNLNGLSL  86

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+
Sbjct  87   SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLE  125



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            ++QLNDDVLGLIVFK  + DP S L +WSEDD+SPCAW ++KC+P NGRV+E++L+GL L
Sbjct  27   TMQLNDDVLGLIVFKSALLDPYSKLLSWSEDDNSPCAWEYIKCNPMNGRVNELNLNGLSL  86

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SGKIGRGLEKL+ L VLSL++NNF+G ISP+L LLTNL+
Sbjct  87   SGKIGRGLEKLQSLKVLSLSNNNFTGAISPELALLTNLE  125



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +3

Query  126  GAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  305
              +SL LNDDVLGLIVFK  + DP SHL +WSEDD SPCAW FVKC+P NGRVSEV L G
Sbjct  35   AEDSLPLNDDVLGLIVFKSAIYDPFSHLESWSEDDSSPCAWEFVKCNPRNGRVSEVSLDG  94

Query  306  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            LGLSGK+GRGLEKL+ L VLSL++NN +G ISP+  L+T L+
Sbjct  95   LGLSGKMGRGLEKLQDLKVLSLSNNNLTGSISPEFALITGLE  136



>ref|XP_004156987.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040-like [Cucumis 
sativus]
Length=1007

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
            QLNDD+LGLIVFK  +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGL  416
            +IGRGLEKL+HL VLSL+ NNF+G +SPQL L
Sbjct  91   RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVL  122



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
            QLNDD+LGLIVFK  +QDP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGLSG
Sbjct  31   QLNDDILGLIVFKSDLQDPSSVLSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGLSG  90

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGL  416
            +IGRGLEKL+HL VLSL+ NNF+G +SPQL L
Sbjct  91   RIGRGLEKLQHLKVLSLSGNNFTGNLSPQLVL  122



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +3

Query  117  GAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  296
            G   + S+QLNDDVLGLIVFK  ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  28   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  87

Query  297  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            L GLGLSGKIG+GL+KLE+L VLSL+ NNFSG+I    G+L +L+
Sbjct  88   LDGLGLSGKIGKGLQKLEYLKVLSLSRNNFSGIIGRAFGVLNSLE  132



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 81/94 (86%), Gaps = 0/94 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S QLNDD+LGLIVFK  + DP+S L++WSEDDDSPC+W F+KC+P NGRVSEV + GLGL
Sbjct  29   SPQLNDDILGLIVFKSDLHDPSSALSSWSEDDDSPCSWKFIKCNPINGRVSEVSIDGLGL  88

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGL  416
            SG+IGRGLEKL+HL VLSL+ NNF+G ++PQL L
Sbjct  89   SGRIGRGLEKLQHLKVLSLSGNNFTGNLNPQLAL  122



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
            QLNDDVLGLIVFK  +QDP+SHLA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLSG
Sbjct  43   QLNDDVLGLIVFKSDLQDPSSHLASWNEDDVNPCSWQFVQCNPESGRVSEVSLDGLGLSG  102

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            KIGRGLEKL+HL VLSL+ NN SG ISP L L   LQ
Sbjct  103  KIGRGLEKLQHLTVLSLSHNNLSGGISPSLTLSNTLQ  139



>ref|XP_006840189.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            SLQLNDDVLGLIVFK G+QDP S L++WSEDDDSPC WNFV+C   +GRV+EV L GL L
Sbjct  33   SLQLNDDVLGLIVFKAGIQDPTSSLSSWSEDDDSPCHWNFVQCDRNSGRVTEVSLDGLSL  92

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SGKIGRGLEKL++L  LSL++NNFSG I+P+L  + +L+
Sbjct  93   SGKIGRGLEKLQNLQALSLSNNNFSGTINPELARIESLR  131



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            ++QLNDDVLGLIVFK  + DP+S L++WSEDDDSPC+W F++C+ ANGRVS V L GLGL
Sbjct  27   TIQLNDDVLGLIVFKSDLVDPSSTLSSWSEDDDSPCSWKFIECNSANGRVSHVSLDGLGL  86

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            SGK+G+GL+KL+HL VLSL+ NNFSG ISP L L+ +L++
Sbjct  87   SGKLGKGLQKLQHLKVLSLSHNNFSGEISPDLPLIPSLES  126



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            +QLNDDVLGLIVFK  + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLE  128



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            +QLNDDVLGLIVFK  + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GKIGRGLEKL+HL VLSL+ NN SG ISP L L  +L+
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNNLSGSISPSLTLSNSLE  128



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  117  GAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  296
            G+   E+LQLNDDVLGLIVFK  + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLADETLQLNDDVLGLIVFKSALLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  297  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQ  407
            L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPE  120



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  117  GAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  296
            G+   E+LQLNDDVLGLIVFK  + DP S L +W+EDD+SPCAW F+KC+P NGRVSE++
Sbjct  24   GSLAGETLQLNDDVLGLIVFKSTLLDPNSKLLSWNEDDNSPCAWEFIKCNPMNGRVSELN  83

Query  297  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQ  407
            L+GL LSGKIGRGLEKL+ L VLSL++NNF+G ISP+
Sbjct  84   LNGLSLSGKIGRGLEKLQSLQVLSLSNNNFTGPISPE  120



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +3

Query  117  GAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  296
            G   + S+QLNDDVLGLIVFK  ++DP+S+L +W+EDD+SPC+W F+KC+P NGRVSEV 
Sbjct  29   GDDESSSVQLNDDVLGLIVFKSDIKDPSSYLESWNEDDNSPCSWRFIKCNPNNGRVSEVS  88

Query  297  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            L GLGLSGKIG+GL+KL +L VLSL+ N+FSG I    G+L +L+
Sbjct  89   LDGLGLSGKIGKGLQKLMYLKVLSLSRNDFSGTIGRAFGVLNSLE  133



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            ++QLNDDVLGLIVFK  +QDP+SHL++W+EDDD+PC+W FV+C+P   RVSE+ L  LGL
Sbjct  34   AVQLNDDVLGLIVFKSDIQDPSSHLSSWNEDDDTPCSWKFVRCNPVTNRVSEISLDNLGL  93

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQ-LGLLTN  425
            SG+IG+GLEKL+HL  LSL+ NNFSG ++P+ L L TN
Sbjct  94   SGRIGKGLEKLQHLKALSLSGNNFSGDVTPEKLALPTN  131



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +3

Query  57   IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKGGVQDPASHLATWSEDD  230
            +MG+  +LL + +S++    G  G++S  +Q+NDDV GLIVFK  + DP+S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSIVVSLEGCMGSDSVPIQINDDVFGLIVFKADLIDPSSYLSSWNEDD  65

Query  231  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQL  410
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISLEL  125

Query  411  GLLTNLQ  431
            G L+NL+
Sbjct  126  GFLSNLE  132



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            +QLNDDVLGLIVFK  + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLE  128



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            +QLNDDVLGLIVFK  + DP+S+LA+W+EDD +PC+W FV+C+P +GRVSEV L GLGLS
Sbjct  31   VQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCNPESGRVSEVSLDGLGLS  90

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GKIGRGLEKL+HL VLSL+ N+ SG ISP L L  +L+
Sbjct  91   GKIGRGLEKLQHLTVLSLSHNSLSGSISPSLTLSNSLE  128



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +3

Query  57   IMGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKGGVQDPASHLATWSEDD  230
            +MG+  +LL + +SV+    G  G++S  +Q+NDDV GLIVFK  + DP S+L++W+EDD
Sbjct  6    VMGYSHLLLYLLVSVVVSLKGCMGSDSGPIQMNDDVFGLIVFKADLIDPFSYLSSWNEDD  65

Query  231  DSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQL  410
            DSPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+HL  LSL+ NNFSG IS +L
Sbjct  66   DSPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHLKTLSLSQNNFSGGISHEL  125

Query  411  GLLTNLQ  431
            G L+NL+
Sbjct  126  GFLSNLE  132



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G   S QLNDDVLGLIVFK  + DP+S L +WSEDD SPC+W +V+C P  GRV++V L 
Sbjct  32   GDDVSAQLNDDVLGLIVFKSDLTDPSSSLVSWSEDDASPCSWRYVQCDPLTGRVAQVSLD  91

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GLGLSGKIGRGLEKL+ L VLSL+ NNF+G ISPQL L + LQ
Sbjct  92   GLGLSGKIGRGLEKLDRLKVLSLSRNNFTGSISPQLSLPSGLQ  134



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            SLQLNDDVLGLIVFK  + DP+S L +W+EDD++PC+W +V+C P++GRV+E+ L GLGL
Sbjct  32   SLQLNDDVLGLIVFKTDLHDPSSLLGSWNEDDNTPCSWKYVRCDPSSGRVTELSLDGLGL  91

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            SGKIGRGLEKL++L VLSL+ NNF+G ISP+L L+ +L T
Sbjct  92   SGKIGRGLEKLQNLQVLSLSHNNFTGDISPELSLIGSLTT  131



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +3

Query  60   MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKGGVQDPASHLATWSEDDD  233
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFK  ++DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLRDPSSYLSSWNEDDD  60

Query  234  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLG  413
            SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  414  LLTNLQT  434
            L+++L++
Sbjct  121  LISSLES  127



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +3

Query  60   MGFRsmlllvflsvlsvTSGAGGAES--LQLNDDVLGLIVFKGGVQDPASHLATWSEDDD  233
            MGF  +LL   +S ++   G  G++S  +Q+NDDVLGLIVFK  + DP+S+L++W+EDDD
Sbjct  1    MGFSHLLLYFLVSSVASLRGCTGSDSVPIQINDDVLGLIVFKSDLSDPSSYLSSWNEDDD  60

Query  234  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLG  413
            SPC+W F++C+P +GRVS+V L GLGLSG++G+GL+KL+H+  LSL+ NNFSG  S + G
Sbjct  61   SPCSWKFIECNPVSGRVSQVSLDGLGLSGRLGKGLQKLQHVKTLSLSHNNFSGDFSLEFG  120

Query  414  LLTNLQT  434
            L+++L++
Sbjct  121  LISSLES  127



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +3

Query  111  TSGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  290
            T  A    ++QLNDDVLGLIVFK  +QDP+S+L++W+EDD +PC+W +VKC+P   RVSE
Sbjct  52   TCFANNDVTIQLNDDVLGLIVFKSDLQDPSSYLSSWNEDDINPCSWQYVKCNPQTQRVSE  111

Query  291  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            + L GLGLSGK+GR LEKL+HL  LSL+ NNFSG ISP L L   LQ
Sbjct  112  LSLDGLGLSGKLGRSLEKLQHLVTLSLSHNNFSGTISPSLTLSNTLQ  158



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S++LNDD+LGLIVFK  ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPVNGRVSHVSLDGLGL  99

Query  315  SGKIG-RGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+
Sbjct  100  SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLE  139



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +3

Query  111  TSGAGGAES-LQLNDDVLGLIVFKGGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRV  284
            T  AGGA + LQLNDDVLGLIVFK G   DP   L +W+EDDDSPCAW FVKC+  N RV
Sbjct  19   TFPAGGATTTLQLNDDVLGLIVFKSGFHSDPLKSLDSWNEDDDSPCAWRFVKCNAGNSRV  78

Query  285  SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SEV L GL LSGKIGRGLEKL+ L VLSL++NN +G ++P L L+ NL+
Sbjct  79   SEVSLDGLSLSGKIGRGLEKLQSLKVLSLSNNNLTGAVNPGLALIPNLE  127



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S++LNDD+LGLIVFK  ++DP+S+L +W EDD+SPC+W F++C+P NGRVS V L GLGL
Sbjct  40   SIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCNPINGRVSHVSLDGLGL  99

Query  315  SGKIG-RGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SGKIG RGL KL+HL VLSL+ N+F+G I+P+LGL+ +L+
Sbjct  100  SGKIGTRGLRKLQHLKVLSLSHNDFTGNINPELGLIASLE  139



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G  +S+QLNDDVLGLIVFK  + DP+SHL +W+EDDDSPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDDSPCSWSYVKCNPKTSRVTELSLD  84

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVI  398
            GL L+GKIGRG++KL+HL VLSL++NNF+G I
Sbjct  85   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGSI  116



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S+QLNDDVLGLIVFK  +QDP+SHL++W+EDD+SPC+W++VKC+P   RV+E+ L+GL L
Sbjct  30   SIQLNDDVLGLIVFKSDLQDPSSHLSSWNEDDNSPCSWSYVKCNPKTSRVTELSLNGLSL  89

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVI  398
            +GKIGRG++KL+HL VLSL++NNF+G I
Sbjct  90   TGKIGRGIQKLQHLKVLSLSNNNFTGNI  117



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
            QLN+DVLGL+VFK  + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLKG  91

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQ-LGLLTNLQ  431
            KIG+GL+ L++L VLSL+SNNFSG ISP+ L L  NL+
Sbjct  92   KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPPNLE  129



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
            QLN DVLGL+VFK  + DP+S+LA+W+ED++SPC+W +V+C+PA GRVS++ L GLGL G
Sbjct  32   QLNSDVLGLLVFKSDIHDPSSYLASWNEDENSPCSWEYVQCNPATGRVSQLSLEGLGLRG  91

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQ-LGLLTNLQ  431
            KIG+GL+ L++L VLSL+SNNFSG ISP+ L L +NL+
Sbjct  92   KIGKGLQNLQNLKVLSLSSNNFSGDISPEKLALPSNLE  129



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G   S+QLNDDVLGLIV K  + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVI  398
            GLGL+GKIGRG++KL+HL  LSL++NNF+G I
Sbjct  85   GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNI  116



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G   S+QLNDDVLGLIV K  + DP+SHLA+W+EDD SPC+W++VKC+P   RV+E+ L 
Sbjct  25   GDTNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTELSLS  84

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVI  398
            GLGL+GKIGRG++KL+HL  LSL++NNF+G I
Sbjct  85   GLGLTGKIGRGIQKLQHLKTLSLSNNNFTGNI  116



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            +QLN DVLGL+VFK  + DP+S+L++W+EDDDSPC+WNF++C+P+ GRVS+++L GLGL 
Sbjct  26   VQLNYDVLGLLVFKSDLHDPSSYLSSWNEDDDSPCSWNFIQCNPSTGRVSQLNLDGLGLK  85

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQ-LGLLTNLQT  434
            GK G+GL+ L+HL VLSL+ NNF+G +SP+ L L  +LQT
Sbjct  86   GKPGKGLQNLQHLKVLSLSGNNFTGELSPEKLALPPSLQT  125



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G  +S+QLNDDVLGLIVFK  + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVIS  401
            GL L+GKIGRG++KL+HL VLSL++NNF+G I+
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFTGNIN  119



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L GL LSGK
Sbjct  32   LNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSLDGLALSGK  91

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRG++KL++L VLSL+ N+F+G+I   LG +++L+
Sbjct  92   IGRGIQKLQYLKVLSLSDNDFTGIIPASLGSISSLK  127



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G  +++QLNDDVLGLIVFK  + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDTIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSG  392
            GL L+GKIGRG++KL+HL VLSL++NNF+G
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFTG  116



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G  +S+QLNDDVLGLIVFK  + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVIS  401
            GL L+GKI RG++KL+HL VLSL++NNF+G I+
Sbjct  87   GLALTGKINRGIQKLQHLKVLSLSNNNFTGNIN  119



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G  +S QLNDDVLGLIVFK  + DP+SHL++W+EDD SPC+W +VKC+P   RV+E+ L 
Sbjct  25   GDLDSTQLNDDVLGLIVFKSDLHDPSSHLSSWNEDDISPCSWTYVKCNPKTSRVTELSLS  84

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVIS  401
            GL L+GKIGRG++KL+HL VLSL++NN +G I+
Sbjct  85   GLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA  117



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            ++QLNDDVLGLI+FK  + DP SHL++W+EDD +PC+W ++KC+P N RV EV L GL L
Sbjct  33   AIQLNDDVLGLILFKSDLHDPFSHLSSWNEDDANPCSWQYIKCNPQNTRVIEVSLDGLSL  92

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SGK+GRG EKL+HL  LSL+ NN SG ISP L L   LQ
Sbjct  93   SGKLGRGFEKLQHLVSLSLSHNNLSGNISPFLTLSNTLQ  131



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP+S+L +W+EDD SPC+W ++KC+P  GR+SEV L GL LSGK
Sbjct  32   LNDDVLGLIVFKADIEDPSSNLESWNEDDYSPCSWKYIKCNPVTGRISEVSLDGLALSGK  91

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLG  413
            IGRG++KL++L VLSL+ N+F+G + P++G
Sbjct  92   IGRGIQKLQYLKVLSLSDNDFTGNVIPEIG  121



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G   S+QLNDDVLGLIV K  + DP+SHLA+W+EDD SPC+W++VKC+P   RV+++ L 
Sbjct  25   GDNNSIQLNDDVLGLIVLKSDLHDPSSHLASWNEDDASPCSWSYVKCNPKTSRVTDLSLS  84

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVI  398
            GLGL+G IGRG++KL+HL  LSL++NNF+G I
Sbjct  85   GLGLTGTIGRGIQKLQHLKTLSLSNNNFTGNI  116



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK  V D  + LA+W+EDD+SPCAW FV+C P +GRV+ V L G+GLSGK
Sbjct  1    FNDDVLGLIVFKSAVVDARNRLASWNEDDESPCAWRFVECDPGSGRVTAVSLDGVGLSGK  60

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQ  407
            IGRGLEKL++L  LSL+ NNFSG +SP+
Sbjct  61   IGRGLEKLQYLRTLSLSGNNFSGSVSPE  88



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G  +S+QLNDDVLGLIVFK  + DP SHL +W+EDD++PC+W++VKC+P   RV E+ L 
Sbjct  26   GDTDSIQLNDDVLGLIVFKSDLNDPFSHLESWTEDDNTPCSWSYVKCNPKTSRVIELSLD  85

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVIS  401
            GL L+GKI RG++KL+ L VLSL++NNF+G I+
Sbjct  86   GLALTGKINRGIQKLQRLKVLSLSNNNFTGNIN  118



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  132  ESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  311
            +S+QLNDDVLGLIVFK  + DP SHL +W+EDD++PC+W++VKC+P   RV+E+ L+GL 
Sbjct  29   DSIQLNDDVLGLIVFKSDLNDPFSHLQSWNEDDNTPCSWSYVKCNPKTSRVTELSLNGLA  88

Query  312  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            L+GKI RG++KL+ L VLSL++NNF+G I+  L    NLQ
Sbjct  89   LTGKINRGIQKLQRLKVLSLSNNNFTGNIN-ALSTNNNLQ  127



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            A S  LNDDVLGLIVFK  +QDPAS LA+W+EDDD PC W  VKC P   RV+E++L G 
Sbjct  19   ATSGALNDDVLGLIVFKADLQDPASKLASWNEDDDDPCGWTGVKCSPRTNRVTELNLDGF  78

Query  309  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
             LSGKIGRGL +L+ L  LSL+ NNFSG ++P L  L +L
Sbjct  79   SLSGKIGRGLLQLQSLRKLSLSRNNFSGSLNPNLSHLESL  118



>gb|KJB67930.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=698

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S  LNDDVLGLIVFK  +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  L
Sbjct  35   SPSLNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSL  94

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            SG+IGRGL +LE L  LSLA+NN SG ISP +  L +L
Sbjct  95   SGRIGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESL  132



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S  LNDDVLGLIVFK  +QDP   L++W+EDDD+PC W  +KC+P + RV+E++L G  L
Sbjct  37   SPSLNDDVLGLIVFKADIQDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSL  96

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            SG+IGRGL +LE L  LSLA+NN SG ISP +  L +L
Sbjct  97   SGRIGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESL  134



>ref|XP_008350571.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=485

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L++L  LSL+ NNF+G I+P L  L +LQ 
Sbjct  83   IGRGLLRLQNLKKLSLSDNNFTGFINPDLPHLGSLQV  119



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            +NDDVLGLIVFK G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23   INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L VLSLA+NNF+G I+P L  L  LQ 
Sbjct  83   IGRGLLRLQFLQVLSLANNNFNGTINPDLPRLGGLQV  119



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            +NDDVLGLIVFK G+QDP S L++W+EDDDSPC W  VKC P   RV+E+ L G  LSG 
Sbjct  23   INDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCNWVGVKCDPNTHRVTELVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L VLSLA+NNF+G I+P L  L  LQ 
Sbjct  83   IGRGLLRLQFLQVLSLANNNFNGTINPDLPRLGGLQV  119



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S  LNDDVLGLIVFK  +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  L
Sbjct  28   SPSLNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTL  87

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+IGRGL +L+ L  LSLA NN SG ISP L  L +L+
Sbjct  88   SGRIGRGLLQLKFLRKLSLARNNLSGTISPNLAKLESLR  126



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S  LNDDVLGLIVFK  +QDP+  L++W+EDDD+PC W  VKC+P + RV+E++L G  L
Sbjct  28   SPSLNDDVLGLIVFKADIQDPSQKLSSWNEDDDTPCNWFGVKCNPRSSRVTELNLDGFTL  87

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+IGRGL +L+ L  LSLA NN SG ISP L  L +L+
Sbjct  88   SGRIGRGLLQLKFLRKLSLARNNLSGTISPNLAKLESLR  126



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 82/126 (65%), Gaps = 23/126 (18%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G  +S+QLNDDVLGLIVFK  + DP+SHL +W+EDD+SPC+W++VKC+P   RV+++ L 
Sbjct  27   GEIDSIQLNDDVLGLIVFKSDLDDPSSHLESWNEDDNSPCSWSYVKCNPKTSRVTDLTLD  86

Query  303  GLGLSGKIGRGLEKLEHLNV-----------------------LSLASNNFSGVISPQLG  413
            GL L+GKIGRG++KL+HL V                       L L+ NN SG I   LG
Sbjct  87   GLALTGKIGRGIQKLQHLKVLSLSNNNFNGNLNALSTNNNLRKLDLSHNNLSGQIPSSLG  146

Query  414  LLTNLQ  431
             +++LQ
Sbjct  147  SISSLQ  152



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+SNN +G ISP L  L NL+
Sbjct  92   IGRGLLQLQFLRKLSLSSNNLTGSISPNLAKLQNLR  127



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSLA NN +G I P L  L NL+
Sbjct  86   IGRGLLQLQFLRKLSLAKNNITGSIGPNLARLQNLR  121



>gb|KDO67528.1| hypothetical protein CISIN_1g002321mg [Citrus sinensis]
Length=936

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  32   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  91

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+SNN +G ISP L  L NL+
Sbjct  92   IGRGLLQLQFLRKLSLSSNNLTGSISPNLAKLQNLR  127



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   L++WSEDDD+PC W  VKC P + RV E+ L+GL L+G+
Sbjct  54   LNDDVLGLIVFKADIQDPNGKLSSWSEDDDTPCNWFGVKCSPRSNRVIELTLNGLSLTGR  113

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+SNN +G ISP L  L NL+
Sbjct  114  IGRGLLQLQFLRKLSLSSNNLTGSISPNLAKLQNLR  149



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   FNDDVLGLIVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L VLSLA+N F+G I+P L  L  LQ 
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTINPDLPRLGGLQV  120



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP   LA+WSEDD SPC+WN VKCHP   RV+E+ L G  LSG+
Sbjct  26   LNDDVLGLIVFKADLRDPEQKLASWSEDDYSPCSWNGVKCHPRTNRVTELTLDGFSLSGR  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +L+ L+ LS+++NN +G+I+P L L L NL+
Sbjct  86   IGRGLLQLQFLHKLSMSNNNLTGIINPNLLLSLVNLK  122



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 ref|XP_004160330.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L +LSLA+NNF+G I+  L  L NLQ 
Sbjct  83   IGRGLLRLQFLQILSLANNNFTGTINSALSHLGNLQV  119



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGL+VFK G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L VLSLA+N F+G ++P L  L  LQ 
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTVNPDLPRLGGLQV  120



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGL+VFK G+QDP S L++W+EDDDSPC+W  VKC P   RV+E+ L G  LSG 
Sbjct  24   LNDDVLGLMVFKAGLQDPESKLSSWNEDDDSPCSWVGVKCEPNTHRVTELFLDGFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L VLSLA+N F+G ++P L  L  LQ 
Sbjct  84   IGRGLLRLQFLQVLSLANNKFNGTVNPDLPRLGGLQV  120



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  25   LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L  LSL+ NN +G ++P +  + NL+ 
Sbjct  85   IGRGLLQLQSLRKLSLSKNNLTGSLTPNIAHIDNLRA  121



>gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +3

Query  114  SGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  293
            + A     ++LNDDVLGLIVFK  + DP S L +W+EDDDSPC+W F+ C+P  GRVS V
Sbjct  22   AKANDEVPIKLNDDVLGLIVFKYDLIDPFSSLTSWNEDDDSPCSWKFISCNPVTGRVSHV  81

Query  294  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             L  L LSGK+ +GL+KL+HL VLSL+ NNFSG I     ++  L+
Sbjct  82   LLDNLSLSGKLSKGLQKLQHLEVLSLSYNNFSGEIITDFPVIPTLE  127



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            +L LN DVLGLIVFK  VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG++GRGL +LE L  LSL++NN SG ISP    + NLQ
Sbjct  88   SGRLGRGLFQLEFLQRLSLSNNNLSGNISPNFARVENLQ  126



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +L+ L+ LSL++NN +G+I+P L L L NL+
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNLLLSLVNLK  121



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   LATWSEDDDSPC W+ VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLATWSEDDDSPCKWDGVKCHPRSNRVIELSLDDFSLSGH  90

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +L+ L  LSL+ NN +G ++P +  + NL+ 
Sbjct  91   VGRGLLQLQSLRKLSLSKNNLTGSLTPNIAHIDNLRA  127



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +L+ L +LSLA+NNF+G I+P L  L +LQ 
Sbjct  83   VGRGLLRLQFLQILSLANNNFTGTINPDLPHLGSLQV  119



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +L+ L+ LSL++NN +G+I+P + L L NL+
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLK  121



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S  LNDDVLGLIVFK  + DP   L++W+EDDD+PC W  +KC+P + RV+E++L G  L
Sbjct  41   SPSLNDDVLGLIVFKADILDPTQKLSSWNEDDDTPCNWKGIKCNPRSNRVTELNLDGFSL  100

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            SG+IGRGL +LE L  LSLA+NN SG ISP +  L +L
Sbjct  101  SGRIGRGLLQLEFLRKLSLANNNLSGTISPNMVKLESL  138



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G++DP + L +WSEDD++PC+W  VKC P   RVSE+ L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLRDPKAKLTSWSEDDNNPCSWVGVKCDPRTNRVSELVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +L+ L +LSLA+NNF+G I+P L  L +LQ 
Sbjct  83   VGRGLLRLQFLQILSLANNNFTGTINPDLPHLGSLQV  119



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +LE L+ LSL++NN +G+I+P L L L NL+
Sbjct  87   IGRGLLQLEFLHKLSLSNNNLTGIINPNLLLSLVNLK  123



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP   LA+W+EDD +PC+W  VKCHP   RV+E++L G  LSG+
Sbjct  27   LNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDGFSLSGR  86

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +LE L+ LSL++NN +G+I+P L L L NL+
Sbjct  87   IGRGLLQLEFLHKLSLSNNNLTGIINPNLLLSLVNLK  123



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            +L LN DVLGLIVFK  VQDP   LA+W+EDDDSPC W  V+C P + RV E++L+G  L
Sbjct  28   NLSLNGDVLGLIVFKAAVQDPKLKLASWNEDDDSPCNWTGVQCSPRSKRVIELNLNGFSL  87

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            SG++GRGL +LE L  LSL++NN +G ISP    + NLQ 
Sbjct  88   SGRLGRGLFQLEFLQRLSLSNNNLTGNISPNFARVDNLQV  127



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPESKLISWNEDDDSPCNWVGVKCDPRTNRVSELVLDGFSLSGR  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL++NNF+G I+P L  L  L+
Sbjct  85   IGRGLLQLQFLRKLSLSNNNFTGSINPNLARLEGLR  120



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP S L +W+EDDDSPC W  VKC P   RVSE+ L G  LSG+
Sbjct  25   LNDDVLGLIVFKADLQDPDSKLISWNEDDDSPCNWVGVKCDPKTNRVSELVLEGFSLSGR  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRG+ +L+ L  LSL++NNF+G I+P L  L  L+ 
Sbjct  85   IGRGVLQLKFLRKLSLSNNNFTGTINPNLARLEGLRV  121



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP + LA+WSEDD SPC W  VKC P  GRV+EV L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLSDPEAKLASWSEDDGSPCNWAGVKCDPTTGRVAEVVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L++L  LSL+ NNF+G I+P L  L +L+ 
Sbjct  83   IGRGLLRLQNLQKLSLSDNNFTGFINPDLPHLGSLRV  119



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             +DDVLGLIVFK G+QDP   L TW+EDD++PC W  VKC+P   RVSE+ L G  LSG 
Sbjct  23   FSDDVLGLIVFKAGLQDPMGKLVTWNEDDETPCNWFGVKCNPKTNRVSELVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L +LSLA+NNF+G I+  L  L NLQ 
Sbjct  83   IGRGLLRLQFLQILSLANNNFTGTINSALSHLGNLQV  119



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            A S  LNDDVLGLIVFK  +QDP S L +W+EDD+ PC W  + C+P   RV+E++L G 
Sbjct  19   AMSGALNDDVLGLIVFKADLQDPTSKLTSWNEDDNDPCGWMGITCNPTTNRVTELNLDGF  78

Query  309  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
             LSGKIGRGL +L+ L  LSL+ NNFSG ++P L  L +L T
Sbjct  79   SLSGKIGRGLLQLQSLRKLSLSKNNFSGSLNPNLSRLESLWT  120



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIV K  +QDP S L +WSEDDD PC W  VKC+P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLQDPTSKLLSWSEDDDDPCGWIGVKCNPRTNRVTELNLDGFSLSGK  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            IGRGL +L+ L  LSL+ NNFSG ++P L  L +L
Sbjct  84   IGRGLLQLQSLRKLSLSRNNFSGSLNPNLSQLESL  118



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  126  GAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  305
            G+ +  LNDDVLGLIVFK  +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L  
Sbjct  22   GSLTPSLNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTELTLDD  81

Query  306  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
              LSG+IGRGL +L+ L+ LSLA NN SG ISP L  L NL+
Sbjct  82   FSLSGRIGRGLLQLQFLHKLSLARNNLSGNISPNLARLANLR  123



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIV K  ++DPAS LA+W+EDDD PC W  V C P   RV+E++L G  LSGK
Sbjct  24   LNDDVLGLIVLKADLEDPASKLASWNEDDDDPCGWVGVTCSPRTNRVTELNLDGFSLSGK  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L  LSL+ NNFSG ++P L  L +L +
Sbjct  84   IGRGLLQLQSLRKLSLSKNNFSGSLNPNLSQLESLSS  120



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = +3

Query  111  TSGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  290
            +  A     + LNDDVLGLIVFK  + DP + L++W+EDD S C+W +++C+P+ GRV  
Sbjct  22   SQAANEDSEVGLNDDVLGLIVFKSDLHDPPA-LSSWTEDDGSSCSWKYIQCNPSTGRVIG  80

Query  291  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + L GLGLSG++G+GL+KL+ L VLSLA NN +G ISP+L  L  L T
Sbjct  81   LSLTGLGLSGRLGKGLQKLQELKVLSLAKNNLTGEISPELAQLPKLHT  128



>ref|XP_010921155.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Elaeis guineensis]
Length=945

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLR  121



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  126  GAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  305
            GA +  LNDDVLGLIVFK  V+DP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVEDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  306  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             GLSG+I RGL +L+ L+ LSLA+NN +G IS  L  L NL+
Sbjct  79   FGLSGRISRGLLRLKFLHKLSLANNNLTGSISVSLSQLANLK  120



>ref|XP_010921154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Elaeis guineensis]
Length=969

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCCWTGIKCDPKTNRVTELSLNGFSLSGK  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLR  121



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP   LA+W+EDD SPC+WN VKCH    RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCSWNGVKCHTRTNRVTELTLDGFSLSGR  87

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +L+ L+ LSL++NN +G+I+P L L L NL+
Sbjct  88   IGRGLLQLQFLHKLSLSNNNLTGIINPNLLLSLVNLK  124



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28   LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L+ LSL+ NN +G I+P L  L NL+
Sbjct  88   IGRGLLQLQFLHKLSLSRNNLTGSINPNLTRLENLR  123



>ref|XP_002972654.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
 gb|EFJ25875.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
Length=927

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  126  GAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  305
            G E++  NDDVLGL+VFK G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L G
Sbjct  40   GDETVSWNDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDG  99

Query  306  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQL  410
            L LSG IGRGL KLE L  LSL++NN SG + P+L
Sbjct  100  LALSGTIGRGLLKLERLKTLSLSANNLSGNVVPEL  134



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            S  LNDDVLGLIVFK  + DP   L++W+EDDD+PC W  VKC+P   RV+E++L G  L
Sbjct  35   SPSLNDDVLGLIVFKADILDPNQKLSSWNEDDDTPCNWFGVKCNPRLNRVTELNLDGFSL  94

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+IGRGL +LE L  LSLA NN +G ISP L  L +L+
Sbjct  95   SGRIGRGLLQLEFLRKLSLAKNNLTGSISPNLAKLESLR  133



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  28   LNDDVLGLIVFKADLQDPMRKLSSWNQDDDTPCNWFGVKCNPRSNRVAELTLDGLSLSGR  87

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L+ LSL+ NN +G I P L  L NL+
Sbjct  88   IGRGLLQLQFLHKLSLSRNNLTGSIDPNLTRLENLR  123



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK GV+DP + L +W+E DD PC WN VKC P   RV+E+ L G  LSG+
Sbjct  25   FNDDVLGLIVFKAGVKDPDAKLVSWNESDDKPCKWNGVKCDPTTNRVTEITLDGFSLSGQ  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            I R L +L+ L  +SL++NN SG ++P+   L NLQ+
Sbjct  85   ISRSLLRLQFLQKISLSNNNLSGTVNPEFAHLWNLQS  121



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LN DVLGLIVFK  ++DP   LA+W+EDD +PC+WN VKCHP   RV+E++L G  LSG+
Sbjct  25   LNGDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWNGVKCHPRTNRVTELNLDGFSLSGR  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +L+ L+ LSL++NN +G+I+P + L L NL+
Sbjct  85   IGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLK  121



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLI FK G++DP S LA+W+E+D+ PC W+ +KC P + RV+ V L G  LSGK
Sbjct  26   LNDDVLGLIAFKAGIEDPRSKLASWNENDNDPCNWDGIKCDPKSNRVAVVALDGFALSGK  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +L+ L+ LSL+ NNFSG ++P    L +L+T
Sbjct  86   LGRGLLRLQFLDTLSLSVNNFSGSVTPAFLRLESLRT  122



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +L+ L+ LSL++NN +GVI+P   L L NL+
Sbjct  88   IGRGLLQLQFLHKLSLSNNNLTGVINPNFLLSLVNLK  124



>ref|NP_001290509.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040 precursor [Elaeis guineensis]
 gb|AAO26311.1| receptor-like protein kinase [Elaeis guineensis]
Length=938

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +++P S L +W+EDDD PC W  +KC P   RV+E+ L+G  LSGK
Sbjct  26   LNDDVLGLIVFKADLREPDSKLVSWNEDDDEPCCWTGIKCEPKTNRVTELSLNGFSLSGK  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLR  121



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            A +L  NDD+LGL+VFK  VQDP   L +W+E+DDSPC WN + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWNGIHCNPRSNRVSQIVLDGF  82

Query  309  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GLSGKI RGL +L+ L  LSLA NNF+G IS  +  L  L+
Sbjct  83   GLSGKISRGLMRLQFLRKLSLAKNNFTGSISSSVVQLAYLR  123



>gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = +3

Query  111  TSGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  290
             S + G+ +  LNDDVLGLIVFK  +QDP   L++W++DDD+PC W  VKC+P + RV+E
Sbjct  14   VSNSVGSLNPSLNDDVLGLIVFKADLQDPKGKLSSWNQDDDTPCNWVGVKCNPRSNRVTE  73

Query  291  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            V L G  LSG+IGRGL +L+ L+ LSLA NN +G IS  L  L NL+
Sbjct  74   VMLDGFSLSGRIGRGLLQLQFLHKLSLARNNLTGSISLNLSRLENLR  120



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+QDP S L +W+ED ++PC W  VKC P   RV+E+ L G  LSG 
Sbjct  26   FNDDVLGLIVFKAGLQDPESKLTSWNEDSENPCNWVGVKCDPKTQRVTELALDGFFLSGH  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L +LSL++NNF+G I+P L  L  LQ 
Sbjct  86   IGRGLIRLQFLQILSLSNNNFTGTINPDLSQLGGLQV  122



>ref|XP_003521989.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=970

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            L  NDDVLGLI+FK G+QDP   L+TW+EDD SPC W  VKC PAN RVS + L G  LS
Sbjct  28   LSFNDDVLGLIMFKAGLQDPKGKLSTWNEDDYSPCHWVGVKCDPANNRVSSLVLDGFSLS  87

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQL  410
            G I RGL +L+ L +LSL+ NNF+G I+P L
Sbjct  88   GHIDRGLLRLQFLQILSLSRNNFTGTIAPDL  118



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGL+ FK  ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQL  410
            IGRGL +L+ L+ LSL++NN +G ++P L
Sbjct  89   IGRGLLQLQSLHKLSLSNNNLTGTVNPNL  117



>ref|XP_008388889.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=469

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
             LNDDVLGLIVFK  +QDP   L +WSEDDDS C+W  VKCHP + RV E++L    LSG
Sbjct  30   SLNDDVLGLIVFKANIQDPKGKLXSWSEDDDSACSWVGVKCHPRSNRVIELNLDDFSLSG  89

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             IGRGL +L+ L  LSL+ NN +G ++P +  + NL+
Sbjct  90   HIGRGLLQLQALRKLSLSKNNLTGSLTPNIAHIDNLR  126



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVLGLIVFK  V DP   LATWSEDD+  CAW+ V C P  GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPEGRLATWSEDDERACAWDGVTCEPRTGRVSALSLAGFGLSGKLG  91

Query  330  RGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            RGL +LE L  L+LA NN SG +  +L  L  LQT
Sbjct  92   RGLLRLEALQSLNLAHNNLSGDVPAELARLPALQT  126



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK GV+DP S LA+W+EDD  PC W  V+C   + RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKAGVEDPRSKLASWNEDDVDPCNWAGVRCDAKSNRVTELALDGFALSGK  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL  L+ L  LSL+ NNFSG +SP L  L +L+T
Sbjct  86   LGRGLLWLQFLETLSLSMNNFSGSLSPDLLRLESLRT  122



>ref|XP_008681357.1| PREDICTED: uncharacterized protein LOC100304322 isoform X1 [Zea 
mays]
 tpg|DAA45233.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=972

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVLGLIVFK  V DP   LATWSEDD+ PCAW+ V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWDGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  330  RGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            RGL +LE L  LSLA NN SG +   L  L  LQT
Sbjct  92   RGLLRLEALQSLSLARNNLSGDVPADLARLPALQT  126



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVLGLIVFK  V DP   LATWSEDD+ PCAW  V C    GRVS + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVSDPDGRLATWSEDDERPCAWGGVTCDARTGRVSALSLAGFGLSGKLG  91

Query  330  RGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            RGL +LE L  LSLA NN SG +  +L  L  LQT
Sbjct  92   RGLLRLEALQSLSLARNNLSGDVPAELARLPALQT  126



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+
Sbjct  50   FNDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGR  109

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L +LSL+ NNF+G I+P L  + +L+ 
Sbjct  110  IGRGLLRLQFLRILSLSKNNFTGTINPSLARIASLRV  146



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVF+  ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLIVFEADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  88

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRGL +L+ L+ LSL++NN +G+I+P   L L NL+
Sbjct  89   IGRGLLQLQFLHKLSLSNNNLTGIINPNFLLSLVNLK  125



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL
Sbjct  90   IGRGLMQLQFLDKLSLSRNCLTGSINPNLTRLENL  124



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   L++W++DDD+PC W  VKC+P   RV+E+ L GL LSG+
Sbjct  30   LNDDVLGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRTNRVTELSLDGLSLSGQ  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL
Sbjct  90   IGRGLMQLQFLDKLSLSRNCLTGSINPNLTRLENL  124



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG 
Sbjct  27   FNDDVLGLIVFKAGLDDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGH  86

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + RGL +L+ L +LSL+ NNF+G I+P L LL +LQ 
Sbjct  87   VDRGLLRLQSLQILSLSRNNFTGSINPDLPLLGSLQV  123



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            A +L  NDD+LGL+VFK  VQDP   L +W+E+DDSPC W+ + C+P + RVS++ L G 
Sbjct  23   ALNLSFNDDILGLMVFKADVQDPQGKLVSWNEEDDSPCGWDGIHCNPRSNRVSQIVLDGF  82

Query  309  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GLSGKI RGL +L+ L  LSLA NNF+G IS  +  L  L+
Sbjct  83   GLSGKISRGLMRLQFLRKLSLAKNNFTGSISSSVVQLAYLR  123



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G++DP   L++W+EDD+SPC W  VKC P++ RV+ + L G  LSG 
Sbjct  27   FNDDVLGLIVFKAGLEDPKRKLSSWNEDDNSPCNWEGVKCDPSSNRVTALVLDGFSLSGH  86

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + RGL +L+ L +LSL+ NNF+G+I+P L  L +LQ 
Sbjct  87   VDRGLLRLQFLQILSLSRNNFTGLINPDLPRLGSLQA  123



>ref|XP_008808300.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=939

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPDSKLVSWNEDDDDPCHWIGVKCDPKTNRVAELSLDGFSLSGK  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGSLSSDLLRLESLR  121



>ref|XP_002988156.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
 gb|EFJ10948.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
Length=864

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +3

Query  147  NDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  326
            NDDVLGL+VFK G+QDP   LA+WSE D SPC W  ++C  A+GRV  V L GL LSG I
Sbjct  1    NDDVLGLLVFKAGLQDPRGSLASWSEADSSPCNWTGIRCGSASGRVESVSLDGLALSGTI  60

Query  327  GRGLEKLEHLNVLSLASNNFSGVISPQL  410
            GRGL KLE L  LSL++NN SG + P+L
Sbjct  61   GRGLLKLERLKTLSLSANNLSGNVVPEL  88



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  VQDP   LA+W+EDD+SPC W  V+C+P + RV+E++L G  LSG+
Sbjct  32   LNDDVLGLIVFKADVQDPKGMLASWNEDDNSPCGWMGVRCNPRSKRVTELNLDGFSLSGR  91

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            +GRGL +L+ L  LSLA N+ +G IS  +  + NL+
Sbjct  92   LGRGLLQLQFLRKLSLARNSLNGSISSNIARIDNLR  127



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  VQDP   L +W+E+DDSPC W+ + C+P + RV+EV L G GLSG+
Sbjct  26   LNDDVLGLIVFKSDVQDPYGKLKSWNEEDDSPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            I RGL +L+ L+ LSLA NN +G IS  L  L  L+
Sbjct  86   ISRGLLRLQFLHRLSLAKNNLTGSISVSLAQLAYLK  121



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDV GLIVFK  +QDP   L++W++DDD+PC W  VKC+P + RV+E+ L GL LSG+
Sbjct  30   LNDDVFGLIVFKADLQDPKRKLSSWNQDDDTPCNWFGVKCNPRSNRVTELSLDGLSLSGQ  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L+ LSL+ N  +G I+P L  L NL+
Sbjct  90   IGRGLMQLQFLHKLSLSRNCLTGSINPNLTRLENLR  125



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 73/103 (71%), Gaps = 1/103 (1%)
 Frame = +3

Query  126  GAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  305
            GA +  LNDDVLGLIVFK  VQDP   L +W+E+DDSPC WN + C+P + RVS+V L G
Sbjct  19   GALNPSLNDDVLGLIVFKSDVQDPDGKLKSWNEEDDSPCNWNGINCNPRSNRVSDVVLDG  78

Query  306  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVIS-PQLGLLTNLQ  431
             GLSG+I RGL +L+ L  LSLA+NN +G IS   L  L NL+
Sbjct  79   FGLSGRISRGLLRLQFLYKLSLANNNLTGSISVVSLSQLANLK  121



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 73/97 (75%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLI+FK  ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L G  LSG+
Sbjct  28   LNDDVLGLILFKADLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLDGFSLSGR  87

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            IGRG+ +L+ L+ LSL++NN +G+I+P   L L NL+
Sbjct  88   IGRGILQLQFLHKLSLSNNNLTGIINPNFLLSLVNLK  124


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 3/104 (3%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLH  302
            G   SL+  D  L +  F G ++DP   LA+W+EDD +PC+W  VKCHP   RV+E+ L 
Sbjct  287  GEMRSLETLD--LSMNKFSGQLRDPEQKLASWNEDDYTPCSWTGVKCHPRTNRVTELTLD  344

Query  303  GLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGL-LTNLQ  431
            G  LSG+IGRG+ +L+ L+ LSL++NN +G+I+P   L L NL+
Sbjct  345  GFSLSGRIGRGILQLQFLHKLSLSNNNLTGIINPNFLLSLVNLK  388



>ref|XP_008782666.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=938

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP S L +W+EDDD PC W  VKC P   RV+E+ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADLRDPGSKLVSWNEDDDDPCHWLGVKCDPKTNRVTELSLVGFFLSGK  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NNFSG +S  L  L +L+
Sbjct  86   IGRGLLQLQSLRTLSLSKNNFSGTLSSDLLRLESLR  121



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NN  G ++P +  + NL+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLIGSLTPNIAHIDNLR  126



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   LA+WSEDDDS C+W  +KCHP + RV E++L    LSG 
Sbjct  31   LNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIELNLDDFSLSGH  90

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NN  G ++P +  + NL+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLIGSLTPNIAHIDNLR  126



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGL  314
             LNDDVLGLIVFK  ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  L
Sbjct  24   SLNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSL  83

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+IGRGL++L+ L  LSLA+NN +G I+P +  + NL+
Sbjct  84   SGRIGRGLQRLQFLRKLSLANNNLTGGINPNIARIDNLR  122



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGL  314
             LNDDVLGLIVFK  ++DP   LA+W+EDD+S C  +W  VKC+P + RV EV+L G  L
Sbjct  31   SLNDDVLGLIVFKADIRDPKGKLASWNEDDESACGGSWVGVKCNPRSNRVVEVNLDGFSL  90

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+IGRGL++L+ L  LSLA+NN +G I+P +  + NL+
Sbjct  91   SGRIGRGLQRLQFLRKLSLANNNLTGGINPNIARIDNLR  129



>ref|XP_009402208.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=974

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  + DP S LA+W+ED+D PC W  VKC+    RV+E+ L G  LSGK
Sbjct  32   LNDDVLGLIVFKADILDPLSKLASWNEDEDDPCGWTGVKCNAKTNRVTELSLVGFSLSGK  91

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ +  L L+ NNFSG ++P+L  L +L+
Sbjct  92   IGRGLLQLQSIQKLYLSKNNFSGSLNPKLSQLESLR  127



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRVSEVDLHGLGL  314
             LNDDVLGLIVFK  +QDP   L +W+EDD+S C  +W  VKC+P + RV E++L+G  L
Sbjct  22   SLNDDVLGLIVFKADIQDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRVVEINLNGFSL  81

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+IGRGL++L+ L  L LA+NN +G I+P + ++ NL+
Sbjct  82   SGRIGRGLQRLQFLRRLYLANNNLTGNIAPNIAIIDNLR  120



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   L +W+E+DD+PC W+ + C+P + RV+EV L G GLSG+
Sbjct  26   LNDDVLGLIVFKSDIQDPYKKLKSWNEEDDTPCNWDGINCNPRSNRVTEVVLDGFGLSGR  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            I RGL +L+ L+ LSLA NN +G IS  L  L  L+
Sbjct  86   ISRGLLRLQFLHRLSLAKNNLTGSISVSLAQLAYLK  121



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +3

Query  126  GAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  305
            G+ +  LNDDVLGLIVFK  +QDP   L++W+E+DDS C W  VKC P + RVSE+ L G
Sbjct  1    GSGTPSLNDDVLGLIVFKADIQDPEGKLSSWNEEDDSACNWVSVKCDPRSKRVSELSLDG  60

Query  306  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
              L+GK+GRGL +L+ L  LSLA NN +G +S  L  L NL+
Sbjct  61   FSLTGKLGRGLLQLQFLRKLSLAKNNLTGSLSLSLAQLPNLK  102



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP + LA+W+EDDDSPC+W  VKC P  GRV+EV L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLSDPEAKLASWNEDDDSPCSWVGVKCDPTTGRVAEVVLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L++L  LSL+ NNF+G I+P L  L +LQ 
Sbjct  83   IGRGLLRLQNLQRLSLSDNNFTGFINPDLPHLGSLQV  119



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  27   FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  86

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L VLSL++NNF+G I+  L     LQ 
Sbjct  87   IGRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQV  123



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
             LNDDVLGLIVFK  VQDP   LA+W EDDD+PC W   KC+P + RV E++L G  LSG
Sbjct  26   SLNDDVLGLIVFKADVQDPKGKLASWDEDDDNPCNWVGCKCNPRSNRVVELNLDGFSLSG  85

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             +GRGL +L+ L  LSLA NN +G IS  +  + NL+
Sbjct  86   HLGRGLLQLQFLRKLSLAKNNLTGSISSSIARIDNLR  122



>ref|XP_006842493.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
             LNDDVLGLIVFK  + DP + L++WSEDD+SPC W  ++C+P   RV+E+ L+ L LSG
Sbjct  28   SLNDDVLGLIVFKFDLHDPKNVLSSWSEDDNSPCNWFGIQCNPRTQRVTEILLNDLSLSG  87

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            KIGRGL +L+ L  LSL++N FSG ISP L  + +L+
Sbjct  88   KIGRGLVRLQFLRKLSLSNNYFSGTISPDLATIQSLR  124



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  25   FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L VLSL++NNF+G I+  L     LQ 
Sbjct  85   IGRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQV  121



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G++DP   L +WSEDDD+PC W  VKC P   RV  + L G  LSG 
Sbjct  25   FNDDVLGLIVFKAGLEDPKEKLTSWSEDDDNPCNWVGVKCDPKTKRVVGLTLDGFSLSGH  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            IGRGL +L+ L VLSL++NNF+G I+  L     LQ 
Sbjct  85   IGRGLLRLQFLQVLSLSNNNFTGTINADLASFGTLQV  121



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG 
Sbjct  30   FNDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGH  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            I RGL +L+ L +LSL+ NNF+G I+P L  + +LQ 
Sbjct  90   IDRGLLRLQFLQILSLSRNNFTGTIAPDLLSIGDLQV  126



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G++DP   L+TW+EDD SPC W  VKC  AN RVS + L G  LSG 
Sbjct  30   FNDDVLGLIVFKAGLEDPKGKLSTWNEDDYSPCNWVGVKCDLANNRVSSLVLDGFSLSGH  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            I RGL +L+ L +LSL+ NNF+G I+P L  + +LQ 
Sbjct  90   IDRGLLRLQFLQILSLSRNNFTGTIAPDLLSIGDLQV  126



>gb|EYU42026.1| hypothetical protein MIMGU_mgv1a000905mg [Erythranthe guttata]
Length=946

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S L +W+E+DDS C W  VKC P + RVSE+ L G  LSG 
Sbjct  27   FNDDVLGLIVFKAGLTDPQSRLTSWNEEDDSACNWVGVKCDPTSNRVSELLLDGFSLSGH  86

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GR L +L+ L VL L+ NNFSG I+P L  +  L+T
Sbjct  87   LGRSLIRLQSLKVLQLSRNNFSGTINPILTQIPYLET  123



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP   L+TW+ED + PC W  +KC P + RV+EV L G  LSG 
Sbjct  23   FNDDVLGLIVFKAGLHDPKDKLSTWNEDAEYPCDWVGIKCDPRSKRVTEVALDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L VLSL+ NNFSG I+  L  +  LQ
Sbjct  83   IGRGLLRLQFLQVLSLSKNNFSGPINTSLTHIGTLQ  118



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDD+LGLIVFK G++DP   L++W+EDD++PC W  VKC P+N +V+ + L G  LSG 
Sbjct  30   FNDDILGLIVFKAGLKDPNHKLSSWNEDDNTPCNWEGVKCDPSNNKVTSLVLDGFSLSGH  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + RGL +L+ L +LSL  NNF+G I+P L  L  LQ 
Sbjct  90   VDRGLLRLQFLQILSLKGNNFTGFINPDLPKLGTLQV  126



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  ++DP   LA+W+EDD SPC W  +KC+P   RV+E++L G  LSG+
Sbjct  28   LNDDVLGLIVFKADLRDPEQKLASWNEDDYSPCNWVGLKCNPRTNRVTELNLDGFSLSGR  87

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL++NN +G I+P L  L +L+
Sbjct  88   IGRGLLQLQFLRKLSLSNNNLTGNINPNLLSLQDLK  123



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDD+LGLIVFK G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG 
Sbjct  36   FNDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGH  95

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            I RGL +L+ L  LSL+ NNF+G I+P L  L +LQ 
Sbjct  96   IDRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQV  132



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDD+LGLIVFK G+QDP   L +W+EDD +PC W  VKC  +N RV+ V L G  LSG 
Sbjct  30   FNDDILGLIVFKAGLQDPKHKLISWNEDDYTPCNWEGVKCDSSNNRVTSVILDGFSLSGH  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            I RGL +L+ L  LSL+ NNF+G I+P L  L +LQ 
Sbjct  90   IDRGLLRLQFLQTLSLSGNNFTGFINPDLPKLGSLQV  126



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLI FK G++DP   L+TW+ DD SPC W  VKC P N RVS + L G  LSG 
Sbjct  39   FNDDVLGLITFKAGLEDPKGKLSTWNADDYSPCNWVGVKCDPVNNRVSSLVLDGFSLSGH  98

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            I RGL KL+ L +LSL+ NNF G I+P L  + +LQ 
Sbjct  99   IDRGLLKLQFLQILSLSRNNFKGTIAPDLLGIGDLQV  135



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LND+VLGLIVFK  ++DP + LA+W+EDD +PC+W  V+C PA  RVS + L  L LSG 
Sbjct  30   LNDEVLGLIVFKAALEDPTAALASWNEDDSTPCSWAHVECDPATSRVSRLALDSLSLSGP  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + RGL++L  L  LSL++NN SG I P L LL  L++
Sbjct  90   LPRGLDRLPALVALSLSNNNLSGPIPPGLSLLPALRS  126



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDV+GLIVFK G+ DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG 
Sbjct  23   FNDDVMGLIVFKAGLTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGR L +L+ L VLSL+ NNF+G I+P L  + +L+
Sbjct  83   IGRSLLRLQFLKVLSLSHNNFTGNINPILSQIPSLR  118



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  320
            LNDDVLGLIVFK  +QDP   L++W+E+DDSPC  W  VKC+P + RVS++ L G GLSG
Sbjct  25   LNDDVLGLIVFKADIQDPDGKLSSWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFGLSG  84

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            K+GRGL +L+ L  LSLA NN +G IS     L++L+
Sbjct  85   KLGRGLLQLQFLRKLSLAKNNLTGSISLSFSELSDLR  121



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LN+DVLGLIVFK  ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ 
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRV  121



>ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
Length=964

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LN+DVLGLIVFK  ++DP   LA+W+EDDD+PC W  +KC+P + RV E++L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELNLDGFSLNGR  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ 
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRV  121



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
             LNDDVLGLIVFK  +QDP + L +W+EDDDSPC W  V C+P +  V E++L G  LSG
Sbjct  25   SLNDDVLGLIVFKADIQDPKAKLGSWNEDDDSPCGWVGVNCNPRSNAVVELNLDGFSLSG  84

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
             IGRGL +L+ L  LSL+ NN +G +S ++  + NL+ 
Sbjct  85   HIGRGLLQLQSLRKLSLSKNNLTGSLSAKIAHIDNLRV  122



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDV+GLIVFK G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG 
Sbjct  23   FNDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGR L +L+ L VLSL++NNF+G I+P L  + +L+
Sbjct  83   IGRSLLRLQFLRVLSLSNNNFTGNINPILAQIPSLR  118



>ref|XP_009614707.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=980

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDV+GLIVFK G  DP S L +W+EDD +PC W  +KC P + RVSE+ L    LSG 
Sbjct  38   FNDDVMGLIVFKAGFTDPKSKLTSWTEDDATPCNWVGIKCDPYSNRVSEILLDNFSLSGH  97

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGR L +L+ L VLSL+ NNF+G I+P L  + +L+
Sbjct  98   IGRSLLRLQFLRVLSLSKNNFTGNINPILAQIPSLR  133



>gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Erythranthe guttata]
Length=967

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLG  311
            S  LNDDVLGLIVFK  VQDP   LA+W+E+DDSPC  W  VKC+P + RVS++ L G G
Sbjct  24   SPSLNDDVLGLIVFKADVQDPDGKLASWNEEDDSPCNNWVGVKCNPRSNRVSDLVLDGFG  83

Query  312  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            LSGK+GRGL +L+ L  LSL+ NN +G ++     L++L+ 
Sbjct  84   LSGKLGRGLLQLQFLRKLSLSKNNLTGSVTLSFAQLSDLRV  124



>ref|XP_004514781.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=946

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            +++   N+D+LGLIVFK G++DP + L+TW+EDD SPC W+ VKC P+  RVS + L G 
Sbjct  23   SQNQPFNEDMLGLIVFKAGLEDPKNKLSTWNEDDYSPCNWDGVKCDPSTNRVSSLILDGF  82

Query  309  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
             L G I RGL +L+ L +LSL+ NNF+G I   L  L NL+ 
Sbjct  83   SLYGHINRGLMRLQFLQILSLSRNNFTGTIKNDLLTLWNLKV  124



>ref|XP_008456780.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=964

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LN+DVLGLIVFK  ++DP   LA+W+EDDD+PC W  +KC+P + RV E+ L G  L+G+
Sbjct  25   LNEDVLGLIVFKADIEDPEGKLASWNEDDDNPCNWVGLKCNPRSNRVVELHLDGFALNGR  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +L+ L  LSLA+NN +G +SP      NL+ 
Sbjct  85   LGRGLLQLQFLRKLSLANNNLTGNLSPNNARFENLRV  121



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCA--WNFVKCHPANGRVSEVDLHGLGL  314
             LNDDVLGLIVFK  ++DP   LA+WSEDD+S C   W  VKC+P + RV E++L G  L
Sbjct  31   SLNDDVLGLIVFKADIRDPKGKLASWSEDDESACGAGWVGVKCNPRSNRVVEINLDGFSL  90

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+IGRGL++L+ L  LSLA+NN +G I+  +  + +L+
Sbjct  91   SGRIGRGLQRLQFLRKLSLANNNLTGGINSNIARIDSLR  129



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
            QLN+DVLGL+VFK  + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  9    QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  68

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQ-LGLLTNLQT  434
            +IG+GL+ L+HL VLSL++NNFSG IS + L L  NL++
Sbjct  69   RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLES  107



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 84/99 (85%), Gaps = 1/99 (1%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
            QLN+DVLGL+VFK  + DP+S+LA+W+EDDDSPC+W+FV+C+PA GRVS++ L GLGL G
Sbjct  32   QLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCNPATGRVSQLSLEGLGLLG  91

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQ-LGLLTNLQT  434
            +IG+GL+ L+HL VLSL++NNFSG IS + L L  NL++
Sbjct  92   RIGKGLQNLQHLKVLSLSNNNFSGDISTEKLALPPNLES  130



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDV+GLIV K G  DP S LA+W+EDD +PC W  + C+P + RVSE+ L    LSG 
Sbjct  40   FNDDVMGLIVLKAGFTDPKSKLASWTEDDPTPCNWVGINCYPQSNRVSEILLDNFSLSGH  99

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGR L +L+ L VLSL++NNF+G I+P L  + +L+
Sbjct  100  IGRSLLRLQFLKVLSLSNNNFTGNINPILSQIPSLR  135



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLI FK G+ DP + L +WSEDD+ PC W  VKC P   RV+E+ L GL LSG 
Sbjct  23   FNDDVLGLIFFKAGLDDPNAKLQSWSEDDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            +GRGL +L+ L VLSL++NN +G I+ +L  + +L+
Sbjct  83   VGRGLLRLQFLQVLSLSNNNLTGPINSELSHIGSLK  118



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = +3

Query  111  TSGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  290
             + A     + +N++VLGL+VFK  + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  291  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRS  122



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = +3

Query  111  TSGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSE  290
             + A     + +N++VLGL+VFK  + DP+  LATW+E D +PC W  V+C PA  RV  
Sbjct  15   AAAADSTMPMPVNEEVLGLVVFKSALSDPSGALATWTESDATPCGWAHVECDPATSRVLR  74

Query  291  VDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + L GLGLSG++ RGL++L  L  LS+A NN SG + P L LL +L++
Sbjct  75   LALDGLGLSGRMPRGLDRLAALQSLSVARNNLSGELPPGLSLLASLRS  122



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP + L++W+E+DD+PC W  VKC   + RVSE+ L G GLSG 
Sbjct  26   FNDDVLGLIVFKAGLLDPEAKLSSWNEEDDTPCHWVGVKCDVRSNRVSELALDGFGLSGH  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + RGL +L+ +  LSL++NNF+G I+P L  +  LQ 
Sbjct  86   VNRGLLRLQVIQRLSLSNNNFTGSINPDLAHIGTLQV  122



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP   LA+WSE D+SPC W  VKC+P + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVFKADIQDPKGKLASWSEVDNSPCNWVGVKCNPRSNRVIELSLDDFSLSGH  90

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NN +G ++P    + NL+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLR  126



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIV K  +QDP   LA+WSE D SPC W  VKCHP + RV E+ L    LSG 
Sbjct  31   LNDDVLGLIVLKADIQDPKGKLASWSEVDSSPCNWVGVKCHPRSNRVIELSLDDFSLSGH  90

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  LSL+ NN +G ++P    + NL+
Sbjct  91   IGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLR  126



>gb|KJB71525.1| hypothetical protein B456_011G127000 [Gossypium raimondii]
Length=967

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLI FK G++DP + L +WS DD+ PC W  VKC P   RV+E+ L GL LSG 
Sbjct  26   FNDDVLGLIFFKAGLKDPTAKLQSWSADDNDPCNWMGVKCDPTTYRVTELHLDGLSLSGH  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            +GRGL +L  L VLSL+ NN +G I+ +L  + +L+
Sbjct  86   VGRGLLRLPFLQVLSLSKNNLTGTINSELSRIGSLR  121



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = +3

Query  111  TSGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPC--AWNFVKCHPANGRV  284
            T  A  A +  LNDDVLGLIVFK  ++DP   L +W+EDD+S C  +W  VKC+P + RV
Sbjct  28   TVTAVKAVNPSLNDDVLGLIVFKADIKDPKGKLTSWNEDDESACGGSWVGVKCNPRSNRV  87

Query  285  SEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             EV+L+G  LSG+IGRGL++L+ L  L L +NN +G I+  +  + NL+
Sbjct  88   VEVNLNGFSLSGRIGRGLQRLQFLRRLYLGNNNLTGSINANIATIDNLR  136



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = +3

Query  117  GAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  296
            G G A +  L+DDVLGLIVFK  V DP   LATWSEDD+ PCAW  V C P  GRV+ + 
Sbjct  21   GGGPASAAALDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLS  80

Query  297  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            L G GLSGK+GRGL +LE L  LSL+ NNFSG +   L  L +LQ+
Sbjct  81   LAGFGLSGKLGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQS  126



>ref|XP_011095143.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=979

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S L +W+E+DDS C W  V+C     RVSE+ L G  LSG 
Sbjct  38   FNDDVLGLIVFKAGLTDPLSRLTSWNEEDDSACNWVGVRCDQDTNRVSELILDGFSLSGH  97

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            +GR L +L+ L VL L+ NNFSG ++P L  + +LQ
Sbjct  98   LGRSLIRLQFLRVLQLSRNNFSGSVNPILAQIPSLQ  133



>ref|XP_010553156.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=969

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLGLSG  320
             NDDVLGLIVFK G+ DP S LA+W+E+D+ PC  W  V C PA+ RV+E+ L G  LSG
Sbjct  28   FNDDVLGLIVFKAGLHDPGSKLASWNEEDNDPCINWVGVSCDPASNRVTELRLDGFSLSG  87

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             IGRGL +L+ L  L L++NN SG ++P+   + +LQ
Sbjct  88   HIGRGLLRLQSLQTLVLSNNNLSGALNPEFPHMGSLQ  124



>gb|EMT18823.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=973

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  147  NDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  326
            NDDVLGLIVFK  V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  327  GRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            GRGL +LE L  LSL++NNFSG I P L  L +LQ+
Sbjct  91   GRGLLRLESLPSLSLSANNFSGDIPPDLARLPDLQS  126



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  147  NDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  326
            NDDVLGLIVFK  V DP   LATWSEDD+  CAW  + C P  GRVS ++L G GLSGK+
Sbjct  31   NDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGITCDPRTGRVSGLNLAGFGLSGKL  90

Query  327  GRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            GRGL +LE L  LSL++NNFSG I P L  L +LQ+
Sbjct  91   GRGLLRLESLQSLSLSANNFSGDIPPDLARLPDLQS  126



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDV GLIVFK G+QDP   L +W+EDD++P  W  VKC     RVSE+ L G  LSG 
Sbjct  23   FNDDVWGLIVFKAGLQDPEEKLISWNEDDENPSKWVGVKCDSQTNRVSELSLDGFSLSGH  82

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            I +GL +L+ L  LSL+ NNFSG I+P L  L  LQ 
Sbjct  83   IDKGLLRLQFLQKLSLSKNNFSGTINPDLPHLGGLQV  119



>ref|XP_003605286.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES87483.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=866

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            +++   N+D+LGLIVFK G++DP + L++W+EDD SPC W  VKC P+  RVS + L G 
Sbjct  22   SQNQPFNEDMLGLIVFKAGLEDPKNKLSSWNEDDYSPCNWEGVKCDPSTNRVSSLVLDGF  81

Query  309  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQL  410
             LSG IG+ L +L+ L +LSL+ NNF+G I+  L
Sbjct  82   SLSGHIGKSLMRLQFLQILSLSRNNFTGRINHDL  115



>ref|XP_010670069.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  156  VLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRG  335
            VLGLIVFK  ++DP   L +W+EDD+  C W  VKC+P + RVSE++L GL LSGK+GRG
Sbjct  36   VLGLIVFKADIKDPNGKLRSWNEDDNDSCKWYGVKCNPRSNRVSELNLDGLSLSGKLGRG  95

Query  336  LEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            L +L+ L  LSL++NN +G +S  L  LTNL+
Sbjct  96   LLQLQSLRKLSLSNNNLTGSLSSALVRLTNLR  127



>emb|CBI25352.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGLIVFK  +QDP S LA+W+EDDDSPC W  VKC+P + RV+++ L G  LSGK
Sbjct  26   LNDDVLGLIVFKADIQDPNSKLASWNEDDDSPCNWVGVKCNPRSNRVTDLVLDGFSLSGK  85

Query  324  IGRGLEKL-----EHLNVLSLASNNFSG  392
            IGRGL +L       L  +  +SN FSG
Sbjct  86   IGRGLLQLHVGSCSTLAAIDFSSNQFSG  113



>ref|XP_001771841.1| predicted protein [Physcomitrella patens]
 gb|EDQ63270.1| predicted protein [Physcomitrella patens]
Length=963

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            ++DDVLGL+ FK G+ DP   L +W +DD SPCAW  + C    GRVSE++L GL L+G+
Sbjct  4    MSDDVLGLMAFKAGLSDPTGALHSWRQDDASPCAWVGIVCDRLTGRVSELNLVGLFLAGQ  63

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL KL+ L +L+L+SNNF+G I  ++  L  L+
Sbjct  64   IGRGLAKLDELQILNLSSNNFTGSIDTEVAGLPMLR  99



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +3

Query  114  SGAGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEV  293
            +G G      LNDDVLGLIVFK  V DP   LATWSEDD+  CAW  V C P   RVS +
Sbjct  20   AGRGAGSVAALNDDVLGLIVFKADVVDPEGRLATWSEDDERACAWAGVTCDPRTSRVSGL  79

Query  294  DLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
             L G GLSGK+GRGL +LE L  LSL+ NNFSG +   L  L +LQ+
Sbjct  80   SLDGFGLSGKLGRGLLRLESLQSLSLSRNNFSGDLPADLARLPDLQS  126



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            L+DDVLGLIVFK  V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPLTGRVAGLSLAGFGLSGK  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +LE L  LSL+ NNFSG +   L  L +LQ+
Sbjct  90   LGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQS  126



>emb|CDX72142.1| BnaC08g27320D [Brassica napus]
Length=936

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 2/85 (2%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGL+ FK  ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  324  IGRGLEKLE--HLNVLSLASNNFSG  392
            IGRGL +L    L V+ L+ N  SG
Sbjct  89   IGRGLLQLHLVSLKVVDLSGNGLSG  113



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  L L++NN +G I+P+   L +LQ
Sbjct  84   IGRGLLRLQFLRALVLSNNNLTGTINPEFPHLGSLQ  119



>ref|XP_009789234.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=972

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            A +L  NDD+LGL+VFK  +QDP  +L +W+E+DDSPC WN +KC+P + RVS++ L G 
Sbjct  21   ALNLSFNDDILGLMVFKADIQDPLGNLVSWNEEDDSPCNWNGIKCNPRSNRVSQIVLDGF  80

Query  309  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            GLSGKI RGL +L+ L  LSLA NNF+G IS  +  L NL+
Sbjct  81   GLSGKISRGLLRLQLLRKLSLAKNNFTGSISSTVVQLDNLR  121



>emb|CDY27220.1| BnaA09g35820D [Brassica napus]
Length=936

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 60/85 (71%), Gaps = 2/85 (2%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LNDDVLGL+ FK  ++DP   LA+W+EDD +PCAWN VKCHP   RV+E+ L G  LSG+
Sbjct  29   LNDDVLGLVAFKSDLRDPDQKLASWNEDDYTPCAWNGVKCHPRTNRVTELTLDGFSLSGR  88

Query  324  IGRGLEKLE--HLNVLSLASNNFSG  392
            IGRGL +L    L V+ L+ N  SG
Sbjct  89   IGRGLLQLHLVSLKVVDLSGNGLSG  113



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = +3

Query  120  AGGAE-SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVD  296
            AGGA+    LND+VLGLIVFK  ++DPA  LATW+E D +PC W+ V+C  A+ RV  +D
Sbjct  31   AGGADLPTPLNDEVLGLIVFKSVLEDPAGALATWNEADATPCNWSHVECGVASSRVVRLD  90

Query  297  LHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISP  404
            L  L LSG + RGL++L  L  LSLA NN SG I P
Sbjct  91   LASLSLSGPLPRGLDRLPALASLSLADNNLSGPIPP  126



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S LA+W+ +D  PC W    C P + RV+E+ L G  LSG 
Sbjct  26   FNDDVLGLIVFKAGLDDPYSKLASWNAEDYDPCNWAGCVCDPGSNRVTELRLDGFSLSGH  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L+ L L++NN +G ++P+   L  LQ
Sbjct  86   IGRGLLRLQFLHTLVLSNNNLTGTLNPEFPHLGTLQ  121



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S L++W+ +D  PC W    C PA  RVSE+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLSSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L+ L L++NN +G ++P+   L +LQ
Sbjct  84   IGRGLLRLQFLHTLVLSNNNLTGTLNPEFPHLGSLQ  119



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S L++W+ +D  PC W    C PA+ RVSE+ L    LSG 
Sbjct  25   FNDDVLGLIVFKSGLDDPLSKLSSWNSEDYDPCNWVGCTCDPASNRVSELRLDSFSLSGH  84

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L+ L L++NN +G ++P+   L +LQ
Sbjct  85   IGRGLLRLQFLHTLVLSNNNLTGTLNPEFPHLGSLQ  120



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVLGLIVFK  V DP   LATWSEDD+ PCAW  V C P  GRV+ + L G GLSGK+G
Sbjct  32   DDVLGLIVFKADVVDPEGRLATWSEDDERPCAWASVTCDPLTGRVAGLSLAGFGLSGKLG  91

Query  330  RGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            RGL +LE L  LSL+ NNFSG +   L  L +LQ+
Sbjct  92   RGLLRLESLQSLSLSRNNFSGDLPADLARLPDLQS  126



>ref|XP_010424007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=955

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  L L++NN +G ++P+   L +LQ
Sbjct  84   IGRGLLRLQFLRALVLSNNNLTGTLNPEFPHLGSLQ  119



>ref|XP_010424006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
Length=959

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  L L++NN +G ++P+   L +LQ
Sbjct  84   IGRGLLRLQFLRALVLSNNNLTGTLNPEFPHLGSLQ  119



>ref|XP_002990711.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
 gb|EFJ08160.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
Length=908

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +3

Query  192  DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSL  371
            DP   LA+WSED  SPC W  ++C P +GRV++V L GL LSG +GRGL KL+HL VLSL
Sbjct  1    DPRRALASWSEDSASPCNWTGIQCSPQSGRVTQVTLDGLELSGPLGRGLLKLDHLQVLSL  60

Query  372  ASNNFSGVISPQLGLLTNLQ  431
            A NN SG ISPQ+ +L +L+
Sbjct  61   ARNNLSGSISPQIRVLKSLR  80



>ref|XP_010490496.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=967

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDSFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L  L L++NN +G ++P+   L +LQ
Sbjct  84   IGRGLLRLQFLRALVLSNNNLTGTLNPEFPHLGSLQ  119



>ref|XP_009125388.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=925

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 66/101 (65%), Gaps = 0/101 (0%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            AE    NDDVLGLIVFK G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  22   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  81

Query  309  GLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             LSG IGRGL +L+ L+ L L++NN +G ++ +L     LQ
Sbjct  82   SLSGHIGRGLLRLQSLHTLVLSNNNLTGALNSELTHRGTLQ  122



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+ DP S LA+W+ +D  PC W    C PA  RV+E+ L    LSG 
Sbjct  24   FNDDVLGLIVFKAGLDDPLSKLASWNSEDYDPCNWVGCICDPATNRVTELRLDAFSLSGH  83

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            IGRGL +L+ L+ L L++NN +G ++P+   L +LQ
Sbjct  84   IGRGLLRLQFLHTLVLSNNNLTGNLNPEFPRLGSLQ  119



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 0/105 (0%)
 Frame = +3

Query  120  AGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  299
            A G     LND+VLGLIVFK  ++DP + LA+WSE D +PC W  V+C PA   V  + L
Sbjct  27   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDANPCGWAHVECDPATSHVLRLYL  86

Query  300  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
              L LSG + RGL++L +L  LS+++NN SG++   L LL  L +
Sbjct  87   DSLSLSGPLPRGLDRLPYLETLSISNNNLSGLLPAGLSLLPRLHS  131



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +3

Query  120  AGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  299
            A   ++   NDDVLGLIVFK G+ DP S L++W+ +D  PC W    C P+  RV+E+ L
Sbjct  21   AAAGQNPTFNDDVLGLIVFKSGLHDPLSKLSSWNSEDLDPCNWLGCICDPSTNRVTELRL  80

Query  300  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             G  LSG IGRGL +L  L+ L L++NN +G ++P+   L +LQ
Sbjct  81   DGFSLSGHIGRGLLRLNFLHTLLLSNNNLTGTLNPEFPHLGSLQ  124



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            L+DDVLGLIVFK  V DP   LATWSEDD+ PCAW  V C P  GRV+ + L   GLSGK
Sbjct  30   LDDDVLGLIVFKADVVDPEGRLATWSEDDERPCAWAGVTCDPITGRVAGLSLACFGLSGK  89

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            +GRGL +LE L  LSL+ NNFSG +   L  L +LQ+
Sbjct  90   LGRGLLRLESLQSLSLSGNNFSGDLPADLARLPDLQS  126



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            + +N++VLGL+VFK  + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  141  MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  200

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISP  404
            G++ RGL++L  L  LSLA NN SG + P
Sbjct  201  GRMPRGLDRLGALQDLSLARNNLSGPLPP  229



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            + +N++VLGL+VFK  + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  38   MPVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWRRVECDPATSRVLRLSLDGLALS  97

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISP  404
            G + RGL++L  L  L+LA NN SG + P
Sbjct  98   GPMPRGLDRLPALQELTLARNNLSGPLPP  126



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            + +N++VLGL+VFK  + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  34   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  93

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISP  404
            G++ RGL++L  L  LSLA NN SG + P
Sbjct  94   GRMPRGLDRLGALQDLSLARNNLSGPLPP  122



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            + +N++VLGL+VFK  + DP   LATW+E D +PC W  V+C PA  RV  + L GL LS
Sbjct  33   MAVNEEVLGLVVFKSALSDPTGALATWTESDATPCGWARVECDPATSRVLRLALDGLALS  92

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISP  404
            G + RGL++L  L  LSLA NN SG + P
Sbjct  93   GSMPRGLDRLPALQDLSLARNNLSGPLPP  121



>ref|XP_001769840.1| predicted protein [Physcomitrella patens]
 gb|EDQ65402.1| predicted protein [Physcomitrella patens]
Length=947

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            ++DDVLGL+ FK G+ DP   L +W EDD SPCAW  + C    GRVSE++L G  L G+
Sbjct  13   MSDDVLGLMAFKAGLHDPTEALRSWREDDASPCAWAGIVCDRVTGRVSELNLVGFSLIGQ  72

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLL  419
            IGRGL KL+ L  L+L+ NN +G I  ++  L
Sbjct  73   IGRGLIKLDELQTLNLSFNNLTGSIDAEVARL  104



>emb|CBI18033.3| unnamed protein product [Vitis vinifera]
Length=808

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 59/86 (69%), Gaps = 3/86 (3%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
             NDDVLGLIVFK G+QDP S L +W+EDD++PC W  VKC     RVSE+ L    LSG+
Sbjct  23   FNDDVLGLIVFKAGLQDPESKLISWNEDDNNPCNWAGVKCDRQTNRVSELLLDNFSLSGR  82

Query  324  IGRGLEKLEHLNVLS---LASNNFSG  392
            IGRGL +L+ L +LS    +SN  SG
Sbjct  83   IGRGLLRLQFLRILSGVNFSSNQLSG  108



>ref|NP_001170194.1| uncharacterized protein LOC100384143 precursor [Zea mays]
 gb|ACN36181.1| unknown [Zea mays]
Length=403

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            + +N++VLGL+VFK  + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISP  404
            SG++ R L++L  L  LSLA NN SG + P
Sbjct  93   SGRMPRDLDRLPALQYLSLARNNISGPLPP  122



>dbj|BAF79960.1| receptor-like kinase [Marchantia polymorpha]
Length=979

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSG  320
            +++D+V+ L+VFK GV DP S L++W++ D  PC W  + C  A GRV+++ L GL LSG
Sbjct  35   RISDEVMALLVFKAGVIDPNSVLSSWNDIDMDPCHWTGITCSSATGRVTDITLVGLSLSG  94

Query  321  KIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             I R L KLE L  L+LA+NNF+G ++ +L   ++L+
Sbjct  95   TIARALVKLEELQTLTLANNNFTGPLNGELAEFSDLK  131



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 0/105 (0%)
 Frame = +3

Query  120  AGGAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  299
            A G     LND+VLGLIVFK  ++DP + LA+WSE D + C W  V+C PA   V  + L
Sbjct  25   ADGDLPTPLNDEVLGLIVFKSALEDPTAALASWSETDATACGWAHVECDPATSHVLRLYL  84

Query  300  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
              L LSG + RGL++L +L  LS+++NN SG++   L LL  L +
Sbjct  85   DSLSLSGPLPRGLDRLPYLESLSISNNNLSGLLPAGLSLLPRLHS  129



>emb|CDP13903.1| unnamed protein product [Coffea canephora]
Length=898

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG----  311
            +NDDVLGLIVFK  VQDP   LA+W+EDD+SPC WN V+C+P + RVSE+ L GL     
Sbjct  1    MNDDVLGLIVFKADVQDPQGKLASWNEDDESPCIWNGVQCNPRSNRVSELVLDGLSLADN  60

Query  312  -LSGKIGRGLEKLEHLNVLSLASNNFSGVIS  401
             L+G +   L +L +L  L L+ N+ SG IS
Sbjct  61   NLTGSLTLSLGQLPNLRTLDLSGNSLSGPIS  91



>ref|XP_002990527.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
 gb|EFJ08404.1| hypothetical protein SELMODRAFT_131809 [Selaginella moellendorffii]
Length=193

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 3/92 (3%)
 Frame = +3

Query  147  NDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKI  326
            NDDVLGLIVFK  + DP   LA+WSED  SP  W  ++C P +G V++V L GL LSG +
Sbjct  16   NDDVLGLIVFKADLHDPRRALASWSEDSASPRNWTGIQCSPQSGTVTQVTLDGLELSGPL  75

Query  327  GRGLEKLEHLN---VLSLASNNFSGVISPQLG  413
            GRGL KL+HL     L  + N  SG I   +G
Sbjct  76   GRGLLKLDHLQSLEALGASENRLSGSIPAGVG  107



>ref|XP_011076585.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Sesamum indicum]
Length=987

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCA-WNFVKCHPANGRVSEVDLHGLG  311
            S  LNDDVLGLIVFK  ++DP   L++W+EDDDSPC  W  VKC+P + RVSE+ L G G
Sbjct  22   SPSLNDDVLGLIVFKADIRDPDQKLSSWNEDDDSPCNNWIGVKCNPRSNRVSELVLDGFG  81

Query  312  LSGKIGRGLEKLEHLNVLSLASNNFSG  392
            LSGK+GRGL +L+ L  LSLA NN +G
Sbjct  82   LSGKLGRGLLQLQSLQKLSLAKNNLTG  108



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWS-EDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            + +N++VLGL+VFK  + DP S LATW+  D  +PCAW  V+C PA  RV  + L GL L
Sbjct  33   MPVNEEVLGLVVFKSALSDPTSALATWTGSDATTPCAWARVECDPATSRVLRLALDGLAL  92

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISP  404
            SG++ R L++L  L  LSLA NN SG + P
Sbjct  93   SGRMPRDLDRLPALQYLSLARNNISGPLPP  122



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            +N++VLGL+VF+  + DP+  LA W+E D +PC W  V+C PA  RV  + L GLGLS  
Sbjct  30   VNEEVLGLVVFRSALTDPSGALAAWAESDATPCGWPHVECDPATSRVLRLALDGLGLSSD  89

Query  324  IG--RGLEKLEHLNVLSLASNNFSGVISP  404
             G  RGL++L  L  LSLA NN SG + P
Sbjct  90   SGVPRGLDRLPRLQSLSLARNNLSGALRP  118



>dbj|BAB85306.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB86487.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=947

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVL L+VFK GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  330  RGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            R L +L+ L  LSL  NN SG + P  GLL  L
Sbjct  89   RALLRLDALASLSLPRNNLSGPVLP--GLLAAL  119



>gb|EAY76307.1| hypothetical protein OsI_04242 [Oryza sativa Indica Group]
Length=947

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVL L+VFK GV DP   LA W+EDDD PC+W  V C    GRV+ + L G  LSG++ 
Sbjct  29   DDVLALVVFKTGVADPMGRLAAWTEDDDRPCSWPGVGCDARAGRVTSLSLPGASLSGRLP  88

Query  330  RGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            R L +L+ L  LSL  NN SG + P  GLL  L
Sbjct  89   RALLRLDALASLSLPRNNLSGPVLP--GLLAAL  119



>emb|CDY04822.1| BnaAnng00040D [Brassica napus]
Length=928

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = +3

Query  129  AESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGL  308
            AE    NDDVLGLIVFK G+ DP S LA+W+ +D  PC+W    C PA  +V+E+ L G 
Sbjct  23   AEDPTFNDDVLGLIVFKAGLDDPFSKLASWNSEDYDPCSWVGCVCDPATNQVTELRLDGF  82

Query  309  GLSGKIGRGLEKLEHLNVLSL--ASNNFSGVI  398
             LSG IGRGL +L+ L+ L L  + NN SG I
Sbjct  83   SLSGHIGRGLLRLQSLHTLLLDFSGNNLSGRI  114



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 60/94 (64%), Gaps = 5/94 (5%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLS  317
            + +N++VLGL+VF+  + DP+  L+ WSE D +PC W  V+C PA  RV  + L  L LS
Sbjct  35   MPVNEEVLGLVVFRSALADPSGALSAWSESDATPCGWAHVECDPATSRVLRLSLDNLFLS  94

Query  318  -----GKIGRGLEKLEHLNVLSLASNNFSGVISP  404
                 G I RGL++L  L  LSLA NNFSG +SP
Sbjct  95   STSGTGGIPRGLDRLPALQSLSLAGNNFSGNLSP  128



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            LND+V+GLIVFK  ++DP + LA+W+E D +PC W  V+C P   RV  + L  L LSG 
Sbjct  49   LNDEVMGLIVFKAALEDPTAALASWNEADATPCGWAHVRCDPRTSRVVRLALDSLSLSGP  108

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            + RGL++L  L  LSL++NN SG + P L LL  L++
Sbjct  109  LPRGLDRLPALASLSLSNNNLSGPVPPGLSLLPALRS  145



>ref|XP_002458686.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
 gb|EES03806.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
Length=948

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            L DDVL L+VFK  V DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  26   LTDDVLALVVFKTDVSDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  85

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQL  410
            + R L +L+ L  L+L  NN SG + P L
Sbjct  86   LPRALLRLDALLSLALPRNNLSGPVLPNL  114



>ref|XP_010232495.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Brachypodium 
distachyon]
Length=947

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVL L+VFK GV DP   LA W+EDDD PC+W  V C    GRV+ + L    LSG++ 
Sbjct  29   DDVLALVVFKTGVADPLGRLAAWTEDDDRPCSWPGVGCDARTGRVTSLSLAAESLSGRLP  88

Query  330  RGLEKLEHLNVLSLASNNFSGVISPQ-LGLLTNLQT  434
            R L +L+ L  LSL  NN SG + P  LG LT L++
Sbjct  89   RALLRLDALLTLSLPGNNLSGPVLPSLLGSLTRLRS  124



>emb|CBI22599.3| unnamed protein product [Vitis vinifera]
Length=329

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +3

Query  162  GLIVFKGGVQDPASHLATWS--EDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRG  335
             L+ FK GV D    L++W   ED    C W  VKC+   G V  +DLH   L GKIG  
Sbjct  39   ALLHFKQGVVDDDGVLSSWGNGEDKRDCCKWRGVKCNNQTGHVIRLDLHAQSLGGKIGPS  98

Query  336  LEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            L +L+HL  L+L+SN+F G++  QLG L+NLQ+
Sbjct  99   LAELQHLKHLNLSSNDFEGILPTQLGNLSNLQS  131



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +3

Query  234  SPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVIS  401
            SPC+W +VKC+P   RV+E+ L GL L+GKIGRG++KL+HL VLSL++NN +G I+
Sbjct  2    SPCSWTYVKCNPKTSRVTELSLSGLSLTGKIGRGIQKLQHLKVLSLSNNNLTGNIA  57



>ref|XP_002439964.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
 gb|EES18394.1| hypothetical protein SORBIDRAFT_09g023480 [Sorghum bicolor]
Length=944

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            ++DDVL L+V K G+ DP+  LA WSED D  CAW  V C P  GRV+ +DL    L+G+
Sbjct  47   VSDDVLALVVLKSGLSDPSGRLAPWSEDADRACAWPGVSCDPRTGRVAALDLPAASLAGR  106

Query  324  IGR-GLEKLEHLNVLSLASNNFSGVI  398
            + R  L +L+ L  L+L  N  SG +
Sbjct  107  LPRSALLRLDALVSLALPGNRLSGAL  132



>ref|XP_004970391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=946

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVL L+VFK GV DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG++ 
Sbjct  26   DDVLALVVFKTGVSDPSGRLATWTEDDDRPCSWPGVGCDARTGRVTSLSLPAASLSGRLP  85

Query  330  RGLEKLEHLNVLSLASNNFSGVISPQL  410
              L +L+ L  L+L  NN SG + P L
Sbjct  86   PALLRLDALLSLALPRNNLSGPVLPNL  112



>tpg|DAA57062.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=949

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            L DDVL L+VFK  + DP+  LATW+EDDD PC+W  V C    GRV+ + L    LSG+
Sbjct  27   LTDDVLALVVFKMDISDPSGRLATWTEDDDRPCSWPAVGCDARTGRVTSLSLPAASLSGR  86

Query  324  IGRGLEKLEHLNVLSLASNNFSGVISPQL  410
            +   L +L+ L  L+L  NN SG + P L
Sbjct  87   LPHALLRLDALLSLALPRNNLSGPVPPNL  115



>ref|XP_004961741.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=942

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            ++DDVL L+V K G+ DPA  LA WSED D  C+W  V C P  GRV+ ++L    L+G+
Sbjct  46   VSDDVLALVVLKSGLSDPAGRLAPWSEDADRACSWPGVSCDPRTGRVAALELPAASLAGR  105

Query  324  IGR-GLEKLEHLNVLSLASNNFSGVI  398
            + R  L +L+ L  L+L  N  SG +
Sbjct  106  LPRSALLRLDALVSLALPGNRLSGAL  131



>ref|XP_010662782.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Vitis vinifera]
Length=966

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = +3

Query  162  GLIVFKGGVQDPASHLATWS--EDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRG  335
             L+ FK GV D    L++W   ED    C W  VKC+   G V  +DLH   L GKIG  
Sbjct  42   ALLHFKQGVVDDDGVLSSWGNGEDKRDCCKWRGVKCNNQTGHVIRLDLHAQSLGGKIGPS  101

Query  336  LEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            L +L+HL  L+L+SN+F G++  QLG L+NLQ+
Sbjct  102  LAELQHLKHLNLSSNDFEGILPTQLGNLSNLQS  134



>ref|XP_010662779.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Vitis vinifera]
Length=218

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 64/115 (56%), Gaps = 10/115 (9%)
 Frame = +3

Query  120  AGGAESLQLNDDVLG--------LIVFKGGVQDPASHLATWS--EDDDSPCAWNFVKCHP  269
            AG   SL++ D  +G        L+ FK GV D    L++W   ED    C W  V+C+ 
Sbjct  21   AGLGSSLRVGDAKVGCIERERQALLHFKQGVVDDYGMLSSWGNGEDKRDCCKWRGVECNN  80

Query  270  ANGRVSEVDLHGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
              G V  +DL G  L GKIG  L KL+HL  L+L+ N+F G++  QLG L+NLQ+
Sbjct  81   QTGHVIMLDLSGGYLGGKIGPSLAKLQHLKHLNLSWNDFEGILPTQLGNLSNLQS  135



>ref|XP_001759642.1| predicted protein [Physcomitrella patens]
 gb|EDQ75554.1| predicted protein [Physcomitrella patens]
Length=901

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +3

Query  126  GAESLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHG  305
            GAE++   D+   L+ FK  + D  S L TW  +D  PC W+ + C   N  V+ ++L  
Sbjct  30   GAEAIA-TDEGWALLDFKNAISDSRSTLRTWKSEDSYPCEWSGISCD-KNSHVTSINLRN  87

Query  306  LGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNL  428
             GLSG I   L +L  L +L L+ NNFSG I PQL  + +L
Sbjct  88   AGLSGTIALELHRLRKLRILILSENNFSGPIPPQLSEIGSL  128



>ref|XP_002980098.1| hypothetical protein SELMODRAFT_30384, partial [Selaginella moellendorffii]
 gb|EFJ18968.1| hypothetical protein SELMODRAFT_30384, partial [Selaginella moellendorffii]
Length=1051

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +3

Query  156  VLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRG  335
            V  LI  K  + DP+  L+TW+  D  PCAW  +KCH  + RV  + L  +GLSG +   
Sbjct  1    VASLIAIKSSLHDPSRSLSTWNASDACPCAWTGIKCHTRSLRVKSIQLQQMGLSGTLSPA  60

Query  336  LEKLEHLNVLSLASNNFSGVISPQLG  413
            +  L  L  L L+ N+ SG I P+LG
Sbjct  61   VGSLAQLVYLDLSLNDLSGEIPPELG  86



>ref|NP_001055909.1| Os05g0491400 [Oryza sativa Japonica Group]
 gb|AAT69645.1| unknown protein, contains LRR domain [Oryza sativa Japonica Group]
 dbj|BAF17823.1| Os05g0491400 [Oryza sativa Japonica Group]
 gb|EEE64195.1| hypothetical protein OsJ_19027 [Oryza sativa Japonica Group]
Length=216

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = +3

Query  162  GLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  341
             L  F+ G+ DP   LA+W  D  +PC W  V C+ A+ RV  +DL  + LSG +   L 
Sbjct  35   ALTEFRKGMSDPDGALASWDPDLVNPCTWFRVTCN-ADNRVIRLDLEEMNLSGHLSADLA  93

Query  342  KLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            +L+ L  + +ASNN  G I P+ G L NL
Sbjct  94   RLDQLQFMEIASNNIEGPIPPEFGNLENL  122



>gb|EAY98521.1| hypothetical protein OsI_20433 [Oryza sativa Indica Group]
Length=216

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 1/89 (1%)
 Frame = +3

Query  162  GLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLE  341
             L  F+ G+ DP   LA+W  D  +PC W  V C+ A+ RV  +DL  + LSG +   L 
Sbjct  35   ALTEFRKGMSDPDGALASWDPDLVNPCTWFRVTCN-ADNRVIRLDLEEMNLSGHLSADLA  93

Query  342  KLEHLNVLSLASNNFSGVISPQLGLLTNL  428
            +L+ L  + +ASNN  G I P+ G L NL
Sbjct  94   RLDQLQFMEIASNNIEGPIPPEFGNLENL  122



>ref|XP_002992683.1| hypothetical protein SELMODRAFT_40400, partial [Selaginella moellendorffii]
 gb|EFJ06268.1| hypothetical protein SELMODRAFT_40400, partial [Selaginella moellendorffii]
Length=1047

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +3

Query  165  LIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGRGLEK  344
            LI  K  + DP+  L+TW+  D  PCAW  +KCH  + RV  + L  +GLSG +   +  
Sbjct  1    LIAIKSSLHDPSRSLSTWNASDACPCAWTGIKCHTRSLRVKSIQLQQMGLSGTLSPAVGS  60

Query  345  LEHLNVLSLASNNFSGVISPQLG  413
            L  L  L L+ N+ SG I P+LG
Sbjct  61   LAQLVYLDLSLNDLSGEIPPELG  83



>ref|XP_010103492.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC46783.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=982

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +3

Query  138  LQLNDDVLGLIVFKGGVQDPASHLATW-SEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            + L  +   L+ FK  ++DP + L +W + D ++PC +  VKC P +G+V+E++L    L
Sbjct  28   MTLTVETEALLQFKKQLKDPLNFLDSWRASDQETPCRFFGVKCDPVSGKVTEINLDSKNL  87

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+I   +  LE L VLSL SN+ SG +  QL   TNL+
Sbjct  88   SGQISPSVSVLESLTVLSLPSNHISGKLPYQLSKCTNLR  126



>ref|XP_008649763.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Zea mays]
 gb|AFW78385.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=938

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  150  DDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIG  329
            DDVL L+V K G+ DPA  LA WSED D  CAW  V C     RV+ +DL    L+G++ 
Sbjct  44   DDVLALVVLKSGLFDPAGRLAPWSEDADRACAWPGVSCDSRTDRVAALDLPAASLAGRLP  103

Query  330  R-GLEKLEHLNVLSLASNNFSGVI  398
            R  L +L+ L  L+L  N  SG +
Sbjct  104  RAALLRLDALVSLALPGNRLSGTL  127



>ref|NP_001055847.2| Os05g0478300 [Oryza sativa Japonica Group]
 gb|AAT01367.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17761.2| Os05g0478300 [Oryza sativa Japonica Group]
Length=917

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            +NDDVL L+VFK GV DP   LA WSED D  CAW  V C    GRV  V L   GLSG+
Sbjct  23   VNDDVLALVVFKSGVSDPGGVLAAWSEDADRACAWPGVSCDARAGRVDAVALPSAGLSGR  82

Query  324  IGR  332
            + R
Sbjct  83   LPR  85



>ref|XP_006441549.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
 gb|ESR54789.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
Length=973

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (55%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            SL LN +   LI FK  ++DP   L +W E  DSPC ++ + C    GRV+E+      L
Sbjct  26   SLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSL  85

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+I   +  L+ L VLSL  N  SG +  +L   +NL+
Sbjct  86   SGEISSSISALQSLTVLSLPFNVLSGKLPSELSNCSNLK  124



>dbj|BAK02926.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1171

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  317
            ++  ++  L+ F+  ++DP + +A W     S PC+W  V C+ A+GRV E+ L  L L+
Sbjct  48   EVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWRGVACNAASGRVVELQLPRLRLA  107

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            G +   L  L HL  LSL SN  +G I P L  L +L+ 
Sbjct  108  GPVSPALASLRHLQKLSLRSNALTGAIPPALARLASLRA  146



>ref|XP_007148036.1| hypothetical protein PHAVU_006G175100g [Phaseolus vulgaris]
 ref|XP_007148037.1| hypothetical protein PHAVU_006G175100g [Phaseolus vulgaris]
 gb|ESW20030.1| hypothetical protein PHAVU_006G175100g [Phaseolus vulgaris]
 gb|ESW20031.1| hypothetical protein PHAVU_006G175100g [Phaseolus vulgaris]
Length=657

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 57/104 (55%), Gaps = 3/104 (3%)
 Frame = +3

Query  123  GGAESLQLNDDVLGLIVFKGGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDL  299
            G  +   +ND+ L L+ F+  +  DP + L  W+ +D  PC W  V C   +G+V  +DL
Sbjct  23   GIRDCWSVNDEGLALLAFQARITFDPFNALVNWNANDSDPCMWFGVHC--VDGKVQVLDL  80

Query  300  HGLGLSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
             GL L G +   L KL HLN + L  NNFSG I  +LG L  L+
Sbjct  81   KGLLLEGTLAPELGKLSHLNSIVLCKNNFSGAIPKELGDLRKLE  124



>dbj|BAJ86449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1135

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 55/99 (56%), Gaps = 1/99 (1%)
 Frame = +3

Query  141  QLNDDVLGLIVFKGGVQDPASHLATWSEDDDS-PCAWNFVKCHPANGRVSEVDLHGLGLS  317
            ++  ++  L+ F+  ++DP + +A W     S PC+W  V C+ A+GRV E+ L  L L+
Sbjct  12   EVQAEIDALLAFRAALRDPYAAMAGWDASSPSAPCSWRGVACNAASGRVVELQLPRLRLA  71

Query  318  GKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            G +   L  L HL  LSL SN  +G I P L  L +L+ 
Sbjct  72   GPVSPALASLRHLQKLSLRSNALTGAIPPALARLASLRA  110



>dbj|BAD15537.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD16121.1| hypothetical protein [Oryza sativa Japonica Group]
Length=260

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  144  LNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGK  323
            +NDDVL L+VFK GV DP   LA WSED D  CAW  V C    GRV  V L  +G  G+
Sbjct  146  VNDDVLALVVFKSGVSDPGGLLAPWSEDADRACAWPRVSCDARTGRVDVVALPAVGFFGR  205

Query  324  IGRG  335
            + R 
Sbjct  206  LPRA  209



>ref|XP_007023498.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
 gb|EOY26120.1| Serine-threonine protein kinase, plant-type, putative [Theobroma 
cacao]
Length=643

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +3

Query  153  DVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGLSGKIGR  332
            D   L+ FKG + DP S L+ W ED    C +  V C     RVS+++LH  GL GKI  
Sbjct  37   DKAALLEFKGSIYDPKSTLSNW-EDAVPVCNFTGVTCDMRYHRVSQINLHSFGLVGKISP  95

Query  333  GLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
             +  L  L VL+L  N+F G ISPQL  L +L+T
Sbjct  96   FISNLTGLRVLNLFENHFFGTISPQLSSLQHLRT  129



>ref|XP_009769350.1| PREDICTED: probable inactive leucine-rich repeat receptor-like 
protein kinase At1g66830 [Nicotiana sylvestris]
Length=656

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 55/101 (54%), Gaps = 1/101 (1%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQ-DPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLG  311
            +  LN D L L+  K  +  DP   LA+WSE D SPC WN +KC   N +V  + L    
Sbjct  22   TFALNSDGLSLLALKSAISSDPTEFLASWSESDSSPCHWNGIKCDDQNQKVISISLSAKN  81

Query  312  LSGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            L+G I   +  L +L++L+L+ NNFS  I   L   T+L +
Sbjct  82   LTGYIPSEIGALSNLSILTLSYNNFSKPIPIHLFNATSLHS  122



>gb|KDO45821.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45822.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45823.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
Length=851

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            SL LN +   LI FK  ++DP   L +W E  DSPC ++ + C    GRV+E+      L
Sbjct  26   SLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSL  85

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQT  434
            SG+I   +  L+ L VLSL  N  SG +  +L   +NL+ 
Sbjct  86   SGEISSSISALQSLTVLSLPFNVLSGKLPLELSNCSNLKV  125



>gb|KDO45819.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45820.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
Length=973

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (55%), Gaps = 0/99 (0%)
 Frame = +3

Query  135  SLQLNDDVLGLIVFKGGVQDPASHLATWSEDDDSPCAWNFVKCHPANGRVSEVDLHGLGL  314
            SL LN +   LI FK  ++DP   L +W E  DSPC ++ + C    GRV+E+      L
Sbjct  26   SLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSL  85

Query  315  SGKIGRGLEKLEHLNVLSLASNNFSGVISPQLGLLTNLQ  431
            SG+I   +  L+ L VLSL  N  SG +  +L   +NL+
Sbjct  86   SGEISSSISALQSLTVLSLPFNVLSGKLPLELSNCSNLK  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564667271820