BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS157A07

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593931.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    323   2e-105   Nicotiana tomentosiformis
ref|XP_004252371.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    323   3e-105   Solanum lycopersicum
ref|XP_011072477.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    323   3e-105   Sesamum indicum [beniseed]
ref|XP_007024437.1|  Ubiquitin-specific protease 6                      322   8e-105   
gb|EYU21397.1|  hypothetical protein MIMGU_mgv1a005447mg                322   1e-104   Erythranthe guttata [common monkey flower]
ref|XP_009776740.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    320   4e-104   Nicotiana sylvestris
ref|XP_006367701.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    320   7e-104   Solanum tuberosum [potatoes]
ref|XP_009593930.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    318   3e-103   Nicotiana tomentosiformis
ref|XP_009776739.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    315   5e-102   Nicotiana sylvestris
gb|KDP40803.1|  hypothetical protein JCGZ_24802                         313   2e-101   Jatropha curcas
gb|KJB35024.1|  hypothetical protein B456_006G096100                    311   8e-101   Gossypium raimondii
gb|KJB35023.1|  hypothetical protein B456_006G096100                    311   1e-100   Gossypium raimondii
ref|XP_002281000.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    310   3e-100   Vitis vinifera
ref|XP_011012175.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    308   2e-99    Populus euphratica
ref|XP_011012174.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    308   2e-99    Populus euphratica
ref|XP_010088378.1|  Ubiquitin carboxyl-terminal hydrolase 6            313   5e-99    
ref|XP_011008463.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    307   7e-99    Populus euphratica
ref|XP_006393007.1|  hypothetical protein EUTSA_v10011383mg             303   5e-98    
gb|KDO58642.1|  hypothetical protein CISIN_1g011408mg                   304   9e-98    Citrus sinensis [apfelsine]
emb|CDO97936.1|  unnamed protein product                                304   1e-97    Coffea canephora [robusta coffee]
ref|XP_007215300.1|  hypothetical protein PRUPE_ppa005074mg             303   1e-97    Prunus persica
ref|XP_011012176.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    303   1e-97    Populus euphratica
ref|XP_011012177.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    303   1e-97    Populus euphratica
ref|XP_010062585.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    303   1e-97    Eucalyptus grandis [rose gum]
ref|XP_010545626.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    301   2e-97    Tarenaya hassleriana [spider flower]
ref|XP_010062586.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    302   3e-97    Eucalyptus grandis [rose gum]
gb|KCW69715.1|  hypothetical protein EUGRSUZ_F03104                     303   7e-97    Eucalyptus grandis [rose gum]
ref|XP_011008464.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    301   7e-97    Populus euphratica
ref|XP_010545625.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    301   9e-97    Tarenaya hassleriana [spider flower]
ref|XP_007215301.1|  hypothetical protein PRUPE_ppa005074mg             301   1e-96    Prunus persica
ref|NP_001077698.1|  ubiquitin carboxyl-terminal hydrolase 6            300   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393006.1|  hypothetical protein EUTSA_v10011383mg             302   2e-96    
ref|XP_010693148.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    301   2e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006369258.1|  UBIQUITIN-SPECIFIC PROTEASE 6 family protein       301   3e-96    
ref|XP_002894329.1|  ubiquitin-specific protease 6                      300   3e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_010462008.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    299   9e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010500755.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    298   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010479669.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    298   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009344441.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    298   1e-95    Pyrus x bretschneideri [bai li]
ref|XP_010262220.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    298   1e-95    Nelumbo nucifera [Indian lotus]
gb|AAG50872.1|AC025294_10  tRNA-guaninine transglycosylase, putative    298   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002534122.1|  Ubiquitin carboxyl-terminal hydrolase, putative    298   1e-95    Ricinus communis
gb|AAG42751.1|AF302660_1  ubiquitin-specific protease 6                 298   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564596.1|  ubiquitin carboxyl-terminal hydrolase 6               298   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KEH18288.1|  ubiquitin carboxyl-terminal hydrolase                   298   1e-94    Medicago truncatula
ref|XP_006466082.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    296   1e-94    Citrus sinensis [apfelsine]
ref|XP_009344440.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    295   2e-94    Pyrus x bretschneideri [bai li]
gb|AGH62007.1|  ubiquitin carboxyl-terminal hydrolase 6                 295   2e-94    Arachis hypogaea [goober]
ref|XP_008462369.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    295   2e-94    Cucumis melo [Oriental melon]
ref|XP_006307372.1|  hypothetical protein CARUB_v10008998mg             295   4e-94    Capsella rubella
gb|AGH61998.1|  ubiquitin carboxyl-terminal hydrolase 6                 294   5e-94    Arachis hypogaea [goober]
ref|XP_011463339.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    294   5e-94    Fragaria vesca subsp. vesca
gb|AFK43690.1|  unknown                                                 294   6e-94    Medicago truncatula
ref|XP_004510349.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    292   9e-94    
ref|XP_008391450.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    291   1e-93    
ref|XP_009367530.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    292   3e-93    
ref|XP_004510348.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    292   4e-93    Cicer arietinum [garbanzo]
gb|EPS62411.1|  ubiquitin carboxyl-terminal hydrolase                   291   5e-93    Genlisea aurea
ref|XP_010528930.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    291   6e-93    Tarenaya hassleriana [spider flower]
ref|XP_004141674.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    291   7e-93    Cucumis sativus [cucumbers]
ref|XP_006385327.1|  UBIQUITIN-SPECIFIC PROTEASE 6 family protein       291   9e-93    Populus trichocarpa [western balsam poplar]
ref|XP_007135584.1|  hypothetical protein PHAVU_010G141700g             290   1e-92    Phaseolus vulgaris [French bean]
ref|XP_009367529.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    290   3e-92    
ref|XP_011463340.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    290   3e-92    Fragaria vesca subsp. vesca
gb|KHN11308.1|  Ubiquitin carboxyl-terminal hydrolase 6                 291   4e-92    Glycine soja [wild soybean]
ref|XP_009107168.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    288   8e-92    Brassica rapa
ref|XP_003529967.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    288   9e-92    Glycine max [soybeans]
gb|AAG42752.1|AF302661_1  ubiquitin-specific protease 7                 288   9e-92    Arabidopsis thaliana [mouse-ear cress]
sp|Q84WC6.1|UBP7_ARATH  RecName: Full=Ubiquitin carboxyl-terminal...    288   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006583027.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    288   1e-91    Glycine max [soybeans]
dbj|BAB01721.1|  ubiquitin specific protease; queuine tRNA-ribosy...    288   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KHN39286.1|  Ubiquitin carboxyl-terminal hydrolase 6                 288   5e-91    Glycine soja [wild soybean]
ref|NP_566680.2|  ubiquitin-specific protease 7                         288   5e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147740.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    285   2e-90    Brassica rapa
emb|CDY52954.1|  BnaC03g77920D                                          288   2e-90    Brassica napus [oilseed rape]
ref|XP_006585534.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    285   1e-89    
emb|CDY33876.1|  BnaC06g04770D                                          281   6e-89    Brassica napus [oilseed rape]
ref|XP_006426475.1|  hypothetical protein CICLE_v10025482mg             279   4e-88    Citrus clementina [clementine]
ref|XP_006406291.1|  hypothetical protein EUTSA_v10020636mg             278   1e-87    Eutrema salsugineum [saltwater cress]
ref|XP_002885433.1|  ubiquitin carboxyl-terminal hydrolase 7            276   3e-87    
ref|XP_006393005.1|  hypothetical protein EUTSA_v10011383mg             275   3e-86    
gb|ABK24394.1|  unknown                                                 273   9e-86    Picea sitchensis
ref|XP_008797867.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    271   2e-85    
ref|XP_006853983.1|  hypothetical protein AMTR_s00036p00226440          270   8e-85    Amborella trichopoda
ref|XP_008797866.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    270   1e-84    Phoenix dactylifera
ref|XP_010912089.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    270   1e-84    Elaeis guineensis
ref|XP_010912082.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    270   2e-84    
ref|XP_004968945.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    269   3e-84    Setaria italica
ref|NP_001043299.1|  Os01g0550100                                       268   4e-84    
ref|XP_003638631.1|  Ubiquitin carboxyl-terminal hydrolase              261   1e-83    
tpg|DAA59027.1|  TPA: hypothetical protein ZEAMMB73_534205              263   4e-82    
ref|XP_006644280.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    263   5e-82    Oryza brachyantha
ref|NP_001148768.1|  ubiquitin carboxyl-terminal hydrolase 6            263   5e-82    
ref|XP_002455783.1|  hypothetical protein SORBIDRAFT_03g025180          255   5e-79    Sorghum bicolor [broomcorn]
ref|XP_010231906.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    255   7e-79    Brachypodium distachyon [annual false brome]
ref|XP_009410802.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    254   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ94932.1|  predicted protein                                      251   2e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008656578.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    250   6e-77    
gb|EEE54783.1|  hypothetical protein OsJ_02180                          246   7e-76    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70862.1|  hypothetical protein OsI_02374                          244   7e-75    Oryza sativa Indica Group [Indian rice]
gb|AFW82988.1|  hypothetical protein ZEAMMB73_925418                    238   5e-71    
ref|XP_002986111.1|  hypothetical protein SELMODRAFT_157786             229   5e-69    Selaginella moellendorffii
ref|XP_002989662.1|  hypothetical protein SELMODRAFT_184724             227   3e-68    
ref|XP_006297746.1|  hypothetical protein CARUB_v10013781mg             217   1e-64    
ref|XP_001760451.1|  predicted protein                                  217   3e-64    
gb|AFW82989.1|  hypothetical protein ZEAMMB73_925418                    195   1e-56    
emb|CDY32369.1|  BnaC01g36880D                                          185   6e-52    Brassica napus [oilseed rape]
tpg|DAA59025.1|  TPA: hypothetical protein ZEAMMB73_534205              181   2e-51    
dbj|BAD94710.1|  ubiquitin-specific protease 6                          158   4e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005645914.1|  ubiquitin carboxyl-terminal hydrolase 6            165   1e-44    Coccomyxa subellipsoidea C-169
emb|CEG00589.1|  Ubiquitin supergroup                                   164   3e-44    Ostreococcus tauri
ref|XP_003083921.1|  putative ubiquitin-specific protease UBP6 (ISS)    164   3e-44    
ref|XP_005098967.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    161   5e-43    
ref|XP_011399658.1|  Ubiquitin carboxyl-terminal hydrolase 7            160   8e-43    Auxenochlorella protothecoides
gb|EJY81667.1|  Ubiquitin carboxyl-terminal hydrolase                   160   1e-42    Oxytricha trifallax
gb|EJY84462.1|  Ubiquitin carboxyl-terminal hydrolase                   159   2e-42    Oxytricha trifallax
ref|XP_005845420.1|  hypothetical protein CHLNCDRAFT_25814              157   1e-41    Chlorella variabilis
ref|XP_001697158.1|  hypothetical protein CHLREDRAFT_58437              155   3e-41    Chlamydomonas reinhardtii
ref|XP_003286293.1|  hypothetical protein DICPUDRAFT_54181              156   4e-41    Dictyostelium purpureum
gb|ESA17055.1|  hypothetical protein GLOINDRAFT_345257                  155   5e-41    
tpe|CBF78212.1|  TPA: ubiquitin C-terminal hydrolase, putative (A...    155   1e-40    Aspergillus nidulans FGSC A4
ref|XP_004986707.1|  PREDICTED: uncharacterized protein LOC101772707    158   1e-40    
ref|XP_001823882.1|  ubiquitin carboxyl-terminal hydrolase 6            155   2e-40    Aspergillus oryzae RIB40
ref|XP_002380939.1|  ubiquitin C-terminal hydrolase, putative           155   2e-40    Aspergillus flavus NRRL3357
ref|XP_001209899.1|  hypothetical protein ATEG_07213                    154   2e-40    Aspergillus terreus NIH2624
ref|XP_001257424.1|  ubiquitin C-terminal hydrolase, putative           153   9e-40    Aspergillus fischeri NRRL 181
dbj|BAE42125.1|  unnamed protein product                                147   1e-39    Mus musculus [mouse]
gb|KFH72121.1|  hypothetical protein MVEG_02414                         151   2e-39    Mortierella verticillata NRRL 6337
ref|XP_681968.1|  hypothetical protein AN8699.2                         154   2e-39    Aspergillus nidulans FGSC A4
ref|XP_001270293.1|  ubiquitin C-terminal hydrolase, putative           151   2e-39    Aspergillus clavatus NRRL 1
ref|XP_002946055.1|  hypothetical protein VOLCADRAFT_78675              151   3e-39    Volvox carteri f. nagariensis
gb|KEY76508.1|  ubiquitin hydrolase                                     151   4e-39    Aspergillus fumigatus var. RP-2014
ref|XP_747839.1|  ubiquitin C-terminal hydrolase                        150   6e-39    Aspergillus fumigatus Af293
ref|XP_001421889.1|  predicted protein                                  149   6e-39    Ostreococcus lucimarinus CCE9901
ref|XP_010294811.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    150   8e-39    Phaethon lepturus
ref|XP_008825184.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    149   9e-39    
gb|EMS46093.1|  Ubiquitin carboxyl-terminal hydrolase 6                 149   1e-38    Triticum urartu
gb|ERE83866.1|  ubiquitin carboxyl-terminal hydrolase 14 isoform 1      144   1e-38    Cricetulus griseus [Chinese hamsters]
ref|XP_008573933.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    149   1e-38    Galeopterus variegatus [Malayan flying lemur]
gb|EFA81974.1|  ubiquitin domain-containing protein                     149   1e-38    Heterostelium album PN500
ref|XP_004683832.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    149   1e-38    
ref|XP_004368318.1|  peptidase C19 family protein                       149   1e-38    Acanthamoeba castellanii str. Neff
gb|EPS28429.1|  hypothetical protein PDE_03375                          149   1e-38    Penicillium oxalicum 114-2
gb|EYE96936.1|  cysteine proteinase                                     149   1e-38    Aspergillus ruber CBS 135680
ref|XP_004683831.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    149   1e-38    Condylura cristata
ref|XP_006901353.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    149   2e-38    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EZF11496.1|  hypothetical protein H100_07530                         149   2e-38    Trichophyton rubrum MR850
ref|XP_003238118.1|  ubiquitin C-terminal hydrolase                     149   2e-38    Trichophyton rubrum CBS 118892
gb|EZG02502.1|  hypothetical protein H106_07348                         149   2e-38    Trichophyton rubrum CBS 735.88
gb|EZF70124.1|  hypothetical protein H105_07524                         149   2e-38    Trichophyton soudanense CBS 452.61
ref|XP_006901354.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   2e-38    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008825183.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   2e-38    Nannospalax galili
ref|XP_005355804.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   2e-38    Microtus ochrogaster [prairie voles]
gb|KFQ70323.1|  Ubiquitin carboxyl-terminal hydrolase 14                148   2e-38    Phaethon lepturus
ref|XP_002162819.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   2e-38    
ref|XP_005355802.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   2e-38    Microtus ochrogaster [prairie voles]
ref|XP_006901352.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   2e-38    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008825182.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   3e-38    Nannospalax galili
ref|XP_645688.1|  ubiquitin domain-containing protein                   148   3e-38    Dictyostelium discoideum AX4
ref|XP_011358769.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   3e-38    
gb|KFP59504.1|  Ubiquitin carboxyl-terminal hydrolase 14                148   3e-38    Cariama cristata
ref|XP_009701995.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   3e-38    Cariama cristata
ref|XP_010124044.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   3e-38    Chlamydotis macqueenii
gb|KFP44522.1|  Ubiquitin carboxyl-terminal hydrolase 14                148   3e-38    Chlamydotis macqueenii
ref|XP_010827208.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   4e-38    Bison bison bison
ref|XP_008158392.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   4e-38    
emb|CDW77022.1|  UNKNOWN                                                147   4e-38    Stylonychia lemnae
dbj|GAM17761.1|  hypothetical protein SAMD00019534_009360               147   4e-38    Acytostelium subglobosum LB1
ref|XP_008158399.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   5e-38    
ref|XP_011358768.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   5e-38    Pteropus vampyrus
ref|XP_006254460.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   5e-38    Rattus norvegicus [brown rat]
gb|KFM11864.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   5e-38    Aptenodytes forsteri
ref|XP_006920103.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   5e-38    Pteropus alecto
gb|ELR54146.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   5e-38    Bos mutus
gb|ESZ98521.1|  ubiquitin C-terminal hydrolase                          148   5e-38    Sclerotinia borealis F-4128
ref|XP_005898963.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   5e-38    Bos mutus
ref|XP_006079265.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   5e-38    
ref|XP_003474162.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   5e-38    
ref|XP_008158387.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   5e-38    Eptesicus fuscus
ref|XP_009283956.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   6e-38    
ref|XP_002194731.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   6e-38    Taeniopygia guttata
gb|EPZ34611.1|  Peptidase C19, ubiquitin carboxyl-terminal hydrol...    147   6e-38    Rozella allomycis CSF55
ref|XP_009946819.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   6e-38    Leptosomus discolor
ref|NP_001068657.1|  ubiquitin carboxyl-terminal hydrolase 14           147   6e-38    Bos taurus [bovine]
ref|XP_003474161.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   6e-38    Cavia porcellus [guinea pig]
ref|NP_001008302.1|  ubiquitin carboxyl-terminal hydrolase 14           147   6e-38    Rattus norvegicus [brown rat]
gb|EMT25494.1|  Ubiquitin carboxyl-terminal hydrolase 6                 147   6e-38    
gb|KFQ28661.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   6e-38    Merops nubicus
ref|XP_004579771.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   7e-38    
ref|XP_006097447.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   7e-38    Myotis lucifugus
ref|XP_005517282.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   7e-38    
ref|XP_004020676.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   7e-38    
ref|XP_009645958.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   7e-38    Egretta garzetta
ref|XP_008937468.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   7e-38    Merops nubicus
ref|XP_001593749.1|  hypothetical protein SS1G_05177                    147   7e-38    Sclerotinia sclerotiorum 1980 UF-70
gb|KFR06410.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   7e-38    Opisthocomus hoazin [hoatzin]
ref|XP_003025841.1|  hypothetical protein TRV_05807                     147   8e-38    Trichophyton verrucosum HKI 0517
ref|XP_006761938.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   8e-38    Myotis davidii
gb|KFP26821.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   8e-38    Colius striatus
gb|KFP73459.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   8e-38    Acanthisitta chloris
ref|XP_006526197.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   8e-38    Mus musculus [mouse]
ref|XP_009082327.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   8e-38    Acanthisitta chloris
gb|KFP23231.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   8e-38    Egretta garzetta
gb|KFQ08696.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   8e-38    Leptosomus discolor
gb|EOB08802.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   8e-38    Anas platyrhynchos [duck]
ref|XP_005861671.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   8e-38    
ref|XP_010205075.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   8e-38    Colius striatus
ref|XP_008926611.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   8e-38    
ref|XP_005861670.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   8e-38    Myotis brandtii
gb|KFV58557.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   8e-38    Gavia stellata
ref|XP_005009472.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   8e-38    
gb|KGL94606.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   9e-38    Charadrius vociferus
gb|KFO61551.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   9e-38    Corvus brachyrhynchos
ref|XP_004421094.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   9e-38    
ref|XP_010300379.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    Balearica regulorum gibbericeps
ref|XP_010080520.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    Pterocles gutturalis
gb|KFW84645.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   9e-38    Manacus vitellinus
gb|KFR03986.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   9e-38    Nipponia nippon
ref|XP_009489381.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    Pelecanus crispus
ref|XP_005243360.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    
ref|XP_004421093.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   9e-38    
ref|XP_005517281.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    Pseudopodoces humilis [Tibetan ground-jay]
gb|KFP03853.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   9e-38    Calypte anna
ref|NP_001033678.1|  ubiquitin carboxyl-terminal hydrolase 14 iso...    146   9e-38    Mus musculus [mouse]
gb|KFU96567.1|  Ubiquitin carboxyl-terminal hydrolase 14                147   9e-38    Chaetura pelagica
ref|XP_006097449.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   9e-38    
ref|XP_010168639.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    
ref|XP_009816187.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    Gavia stellata
ref|XP_009907147.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    Picoides pubescens
ref|XP_006097446.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   9e-38    Myotis lucifugus
gb|KFO10715.1|  Ubiquitin carboxyl-terminal hydrolase 14                146   9e-38    Balearica regulorum gibbericeps
gb|KFZ60526.1|  Ubiquitin carboxyl-terminal hydrolase 14                146   1e-37    Antrostomus carolinensis
gb|KFV75662.1|  Ubiquitin carboxyl-terminal hydrolase 14                146   1e-37    Picoides pubescens
gb|KFV01007.1|  Ubiquitin carboxyl-terminal hydrolase 14                146   1e-37    Pterocles gutturalis
gb|AAH50197.1|  Ubiquitin specific peptidase 14                         146   1e-37    Mus musculus [mouse]
ref|XP_005490782.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   1e-37    
gb|EMC79416.1|  Ubiquitin carboxyl-terminal hydrolase 14                146   1e-37    
emb|CCX08485.1|  Similar to Ubiquitin carboxyl-terminal hydrolase...    147   1e-37    Pyronema omphalodes CBS 100304
ref|XP_009969702.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    Tyto alba [Schleiereule]
ref|NP_067497.2|  ubiquitin carboxyl-terminal hydrolase 14 isoform 1    146   1e-37    Mus musculus [mouse]
ref|XP_005329083.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    
ref|XP_008635078.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   1e-37    
ref|XP_005042102.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    Ficedula albicollis
ref|XP_006761937.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    Myotis davidii
ref|XP_005976794.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   1e-37    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004939814.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    
gb|EHA25517.1|  hypothetical protein ASPNIDRAFT_201896                  147   1e-37    Aspergillus niger ATCC 1015
ref|XP_005697176.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    
ref|XP_010572708.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   1e-37    Haliaeetus leucocephalus
ref|XP_419150.1|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    146   1e-37    Gallus gallus [bantam]
ref|XP_005329084.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    
ref|XP_004421091.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_001395888.1|  ubiquitin carboxyl-terminal hydrolase 6            147   1e-37    Aspergillus niger CBS 513.88
ref|XP_005418407.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    
ref|XP_005329082.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    Ictidomys tridecemlineatus
ref|XP_004389752.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    
ref|XP_004389753.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    
ref|XP_004421092.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|EDL23001.1|  ubiquitin specific peptidase 14, isoform CRA_a          146   1e-37    Mus musculus [mouse]
ref|XP_009088152.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    
ref|XP_007076005.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    Panthera tigris altaica
ref|XP_009029748.1|  hypothetical protein HELRODRAFT_89960              146   1e-37    Helobdella robusta
ref|XP_003697574.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   1e-37    
ref|XP_003011757.1|  hypothetical protein ARB_01985                     146   1e-37    Trichophyton benhamiae CBS 112371
ref|XP_009884951.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   1e-37    Charadrius vociferus
ref|XP_005153567.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   1e-37    Melopsittacus undulatus
ref|XP_005153566.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    Melopsittacus undulatus
ref|XP_010013439.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    Nestor notabilis
gb|KFQ50118.1|  Ubiquitin carboxyl-terminal hydrolase 14                146   2e-37    Nestor notabilis
ref|XP_008495855.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    Calypte anna
gb|KFZ67686.1|  Ubiquitin carboxyl-terminal hydrolase 14                146   2e-37    Podiceps cristatus
ref|XP_006027990.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
gb|KFQ89599.1|  Ubiquitin carboxyl-terminal hydrolase 14                146   2e-37    Phoenicopterus ruber ruber
ref|XP_007435378.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    Python bivittatus
ref|XP_003697573.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    Apis florea [dwarf honeybee]
ref|XP_004742868.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_007537143.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    Erinaceus europaeus [common hedgehog]
ref|XP_004389750.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_003406411.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
gb|ELW63800.1|  Ubiquitin carboxyl-terminal hydrolase 14                145   2e-37    
ref|XP_001367917.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
gb|KFO79313.1|  Ubiquitin carboxyl-terminal hydrolase 14                145   2e-37    
ref|XP_004389751.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
gb|KFV79959.1|  Ubiquitin carboxyl-terminal hydrolase 14                145   2e-37    
ref|XP_395043.3|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    145   2e-37    
ref|XP_007933794.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_007064848.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca...    145   2e-37    
ref|XP_004899990.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_007933793.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_009563446.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|NP_001075726.1|  ubiquitin carboxyl-terminal hydrolase 14           145   2e-37    
ref|XP_006733101.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_009329771.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    
ref|XP_010956366.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_007933791.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_005513025.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    
ref|XP_010005221.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    
ref|XP_004635842.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_004853361.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_007933792.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   2e-37    
ref|XP_009929744.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   2e-37    
ref|XP_009670802.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_006867345.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_004742867.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_010637046.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_004899989.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_011136849.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_003365559.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_003734674.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
pdb|2AYN|A  Chain A, Structure Of Usp14, A Proteasome-Associated ...    144   3e-37    
ref|XP_002850465.1|  ubiquitin carboxyl-terminal hydrolase 6            145   3e-37    
ref|XP_009469530.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_004411265.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_008716965.1|  hypothetical protein HMPREF1541_04397              145   3e-37    
ref|XP_006733102.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_003924841.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_003784842.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_003995106.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_003924840.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_010975020.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_006633925.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_004635843.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_006733100.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_006151667.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_006194514.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
dbj|BAB27544.1|  unnamed protein product                                145   3e-37    
ref|XP_006613175.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_006867346.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   3e-37    
gb|KGL72493.1|  Ubiquitin carboxyl-terminal hydrolase 14                145   3e-37    
ref|XP_002757155.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   3e-37    
ref|XP_005372740.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   4e-37    
ref|XP_004411264.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
gb|KFP75064.1|  Ubiquitin carboxyl-terminal hydrolase 14                145   4e-37    
ref|XP_009865208.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_010707116.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_001519267.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   4e-37    
ref|XP_005372739.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_001492900.3|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
emb|CDH59535.1|  ubiquitin carboxyl-terminal hydrolase 14 isoform1      145   4e-37    
ref|XP_007606181.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_004742866.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_004635841.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_007645889.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_003435066.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_002922669.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   4e-37    
ref|XP_003507182.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_002922668.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_003784841.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   4e-37    
ref|XP_004606173.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_004654710.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_006867344.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   4e-37    
ref|XP_010707115.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   5e-37    
ref|XP_537306.2|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    145   5e-37    
dbj|BAA93551.1|  deubiquitinating enzyme                                144   5e-37    
ref|XP_003784840.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   5e-37    
ref|XP_004742869.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   5e-37    
ref|XP_008688753.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   5e-37    
gb|EFB26510.1|  hypothetical protein PANDA_011655                       144   5e-37    
ref|XP_007448676.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   5e-37    
ref|XP_007607799.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   5e-37    
ref|XP_002675850.1|  ubiquitin hydrolase                                144   5e-37    
ref|XP_004484269.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   6e-37    
gb|KDD75798.1|  ubiquitin carboxyl-terminal hydrolase                   144   6e-37    
ref|XP_007607801.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   6e-37    
ref|XP_003396740.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   6e-37    
ref|XP_004702952.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   6e-37    
ref|XP_003487136.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   6e-37    
ref|XP_007448677.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   6e-37    
ref|XP_004484267.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   7e-37    
gb|EHB12684.1|  Ubiquitin carboxyl-terminal hydrolase 14                144   7e-37    
ref|XP_007191642.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   7e-37    
gb|EAX01735.1|  ubiquitin specific peptidase 14 (tRNA-guanine tra...    144   7e-37    
ref|XP_003396739.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   7e-37    
ref|XP_006277252.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   7e-37    
ref|XP_003487135.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   8e-37    
ref|XP_007448675.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   8e-37    
gb|KIW12463.1|  hypothetical protein PV08_09740                         144   8e-37    
ref|NP_001272257.1|  uncharacterized protein LOC101867254               144   8e-37    
ref|XP_004702953.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   8e-37    
ref|XP_007115911.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   8e-37    
dbj|BAH12624.1|  unnamed protein product                                144   8e-37    
ref|XP_003914268.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   9e-37    
dbj|GAD97881.1|  ubiquitin C-terminal hydrolase, putative               144   9e-37    
ref|XP_006994266.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   9e-37    
ref|XP_004273815.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   9e-37    
ref|XP_004322065.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   9e-37    
ref|XP_004273816.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   9e-37    
ref|NP_001032411.1|  ubiquitin carboxyl-terminal hydrolase 14 iso...    143   1e-36    
ref|XP_003914267.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   1e-36    
ref|XP_007115910.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   1e-36    
ref|XP_004484268.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   1e-36    
ref|XP_786966.1|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    144   1e-36    
ref|XP_004702951.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   1e-36    
ref|XP_005587128.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-36    
ref|XP_005083091.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-36    
gb|EHH29208.1|  hypothetical protein EGK_09569                          144   1e-36    
gb|AAP36966.1|  Homo sapiens ubiquitin specific protease 14 (tRNA...    144   1e-36    
emb|CEG71985.1|  Putative Ubiquitin carboxyl-terminal hydrolase         143   1e-36    
ref|XP_008068431.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   1e-36    
ref|XP_010210036.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   1e-36    
ref|NP_005142.1|  ubiquitin carboxyl-terminal hydrolase 14 isoform a    144   1e-36    
ref|XP_004322064.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   1e-36    
ref|XP_005083090.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   1e-36    
dbj|BAG37826.1|  unnamed protein product                                144   1e-36    
ref|NP_001038961.1|  ubiquitin carboxyl-terminal hydrolase 14           144   1e-36    
emb|CEJ01980.1|  Putative Ubiquitin carboxyl-terminal hydrolase         143   1e-36    
ref|XP_006994263.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-36    
ref|XP_002428382.1|  ubiquitin carboxyl-terminal hydrolase, putative    143   1e-36    
ref|XP_004484266.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   2e-36    
ref|XP_008536217.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   2e-36    
gb|KEZ43014.1|  Ubiquitin carboxyl-terminal hydrolase 6                 143   2e-36    
emb|CEP19545.1|  hypothetical protein                                   143   2e-36    
ref|XP_002479773.1|  ubiquitin C-terminal hydrolase, putative           143   2e-36    
ref|XP_005309558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   2e-36    
ref|XP_006139107.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-36    
ref|XP_006139106.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-36    
ref|XP_007297517.1|  ubiquitin carboxyl-terminal hydrolase 14           143   2e-36    
ref|XP_008536216.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   2e-36    
ref|XP_004939813.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   2e-36    
ref|XP_004939812.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-36    
gb|EPQ04882.1|  Rho-associated protein kinase 1                         146   3e-36    
dbj|GAA87704.1|  ubiquitin C-terminal hydrolase                         143   3e-36    
ref|XP_010884751.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-36    
ref|XP_003362211.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-36    
ref|XP_004079464.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   4e-36    
ref|NP_001005641.1|  ubiquitin specific peptidase 14 (tRNA-guanin...    142   4e-36    
ref|XP_007784080.1|  ubiquitin thiolesterase                            142   5e-36    
ref|XP_008475189.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   7e-36    
dbj|GAN06878.1|  ubiquitin carboxyl-terminal hydrolase 14-like is...    141   8e-36    
emb|CDQ72406.1|  unnamed protein product                                141   8e-36    
ref|XP_006691679.1|  ubiquitin carboxyl-terminal hydrolase-like p...    141   8e-36    
gb|EPB90866.1|  hypothetical protein HMPREF1544_02284                   141   8e-36    
ref|XP_003760067.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   8e-36    
ref|XP_003219701.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   9e-36    
tpg|DAA59024.1|  TPA: hypothetical protein ZEAMMB73_534205              139   9e-36    
gb|KGO58754.1|  Peptidase C19, ubiquitin carboxyl-terminal hydrol...    143   1e-35    
ref|XP_005995774.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-35    
ref|XP_003387545.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-35    
gb|KFO27117.1|  Rho-associated protein kinase 1                         144   1e-35    
gb|ERE83867.1|  rho-associated protein kinase 1                         144   1e-35    
gb|KIN04429.1|  hypothetical protein OIDMADRAFT_142316                  141   1e-35    
gb|ELT88016.1|  hypothetical protein CAPTEDRAFT_159540                  140   2e-35    
ref|XP_008559288.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   2e-35    
ref|XP_003666304.1|  hypothetical protein MYCTH_2310867                 140   2e-35    
ref|XP_011313663.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   2e-35    
dbj|GAM39797.1|  ubiquitin C-terminal hydrolase                         140   2e-35    
ref|XP_969056.1|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    140   2e-35    
gb|EWG39861.1|  ubiquitin thiolesterase                                 140   2e-35    
ref|XP_003177316.1|  ubiquitin carboxyl-terminal hydrolase 6            140   2e-35    
gb|EIE88677.1|  hypothetical protein RO3G_13388                         139   3e-35    
ref|XP_009043729.1|  hypothetical protein LOTGIDRAFT_227857             139   3e-35    
ref|XP_004358345.1|  ubiquitin domain-containing protein                139   3e-35    
ref|XP_007917029.1|  putative ubiquitin carboxyl-terminal hydrola...    140   4e-35    
ref|XP_002732911.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   4e-35    
ref|XP_007899114.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   4e-35    
emb|CCT70734.1|  related to ubiquitin-specific protease 7               139   4e-35    
gb|ETE63323.1|  Ubiquitin carboxyl-terminal hydrolase 14                139   5e-35    
ref|XP_002143454.1|  ubiquitin hydrolase, putative                      139   6e-35    
gb|EXK31459.1|  ubiquitin thiolesterase                                 139   6e-35    
gb|EGU85458.1|  hypothetical protein FOXB_04025                         139   6e-35    
emb|CDS09198.1|  hypothetical protein LRAMOSA10558                      139   6e-35    
ref|XP_007683008.1|  hypothetical protein COCMIDRAFT_22123              139   6e-35    
gb|EWY89322.1|  ubiquitin thiolesterase                                 139   6e-35    
emb|CDM27318.1|  Peptidase C19, ubiquitin carboxyl-terminal hydro...    139   6e-35    
gb|EFX74497.1|  hypothetical protein DAPPUDRAFT_129179                  138   7e-35    
ref|XP_502344.1|  YALI0D02871p                                          138   7e-35    
gb|EMR90433.1|  putative ubiquitin carboxyl-terminal hydrolase 14...    139   8e-35    
ref|XP_007694164.1|  hypothetical protein COCSADRAFT_31963              139   8e-35    
gb|KFX49107.1|  Ubiquitin carboxyl-terminal hydrolase 6                 139   9e-35    
ref|XP_001547811.1|  hypothetical protein BC1G_13587                    139   9e-35    
ref|XP_006792164.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    138   1e-34    
ref|XP_007736386.1|  ubiquitin thiolesterase                            138   1e-34    
ref|XP_001903050.1|  hypothetical protein                               139   1e-34    
ref|XP_011168308.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    138   1e-34    
gb|EFZ12593.1|  hypothetical protein SINV_07381                         137   2e-34    
ref|XP_011168309.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   2e-34    
ref|XP_007706710.1|  hypothetical protein COCCADRAFT_32006              138   2e-34    
ref|XP_010765941.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   2e-34    
ref|XP_003064031.1|  predicted protein                                  137   2e-34    
gb|KIW09554.1|  hypothetical protein PV09_00427                         138   2e-34    
gb|EUN23035.1|  hypothetical protein COCVIDRAFT_30037                   138   2e-34    
ref|XP_005476503.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   2e-34    
ref|XP_003244666.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   2e-34    
ref|XP_007873522.1|  hypothetical protein PNEG_01569                    136   2e-34    
emb|CDQ56945.1|  unnamed protein product                                137   2e-34    
ref|XP_003438130.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   2e-34    
ref|XP_007806193.1|  hypothetical protein EPUS_05295                    137   2e-34    
ref|XP_001222721.1|  hypothetical protein CHGG_06626                    137   3e-34    
ref|XP_003836548.1|  similar to ubiquitin C-terminal hydrolase          137   3e-34    
ref|XP_005716993.1|  unnamed protein product                            137   3e-34    
ref|XP_005912615.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   3e-34    
ref|XP_005742643.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   4e-34    
ref|XP_011264794.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   4e-34    
ref|XP_011444593.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    136   4e-34    
gb|KEF61883.1|  ubiquitin thiolesterase                                 137   4e-34    
ref|XP_009220990.1|  ubiquitin carboxyl-terminal hydrolase 6            137   4e-34    
gb|EMD96050.1|  hypothetical protein COCHEDRAFT_1127469                 137   4e-34    
emb|CCJ30682.1|  unnamed protein product                                136   5e-34    
ref|XP_011117586.1|  hypothetical protein AOL_s00004g635                137   5e-34    
gb|EKG17979.1|  Ubiquitin                                               137   5e-34    



>ref|XP_009593931.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X2 
[Nicotiana tomentosiformis]
Length=482

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSA+Y+KDSRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAVYVKDSRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPL LDV+D CS+DLRK+LEGPR+ LRD EGKK GL+ SGK+S
Sbjct  312  FWKRESNQKAKILRKVDYPLSLDVYDFCSEDLRKKLEGPRQVLRDAEGKKAGLKTSGKTS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SS D DVKMT+A ESSSGSGE+SK   QEGVLPEKE HLTGIYDLVAVLTHKGRSADSGH
Sbjct  372  SSTDGDVKMTEAEESSSGSGEASK-TTQEGVLPEKEHHLTGIYDLVAVLTHKGRSADSGH  430

Query  565  YVAWVKQENGKWI  603
            YVAWVKQENGKW+
Sbjct  431  YVAWVKQENGKWV  443



>ref|XP_004252371.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Solanum lycopersicum]
Length=483

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSA+Y+KDSRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAVYVKDSRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPL LDV+DLCSD+LRK+LEGPR+ LRD EGKK GL+ S K+ 
Sbjct  312  FWKRESNQKAKILRKVDYPLSLDVYDLCSDNLRKKLEGPRQVLRDAEGKKAGLKTSAKTP  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
             + DND KMTDA ESSSGSGE+SK   QEGVLPEKE  LTGIYDLVAVLTHKGRSADSGH
Sbjct  372  VTTDNDTKMTDAEESSSGSGEASKSTSQEGVLPEKEHQLTGIYDLVAVLTHKGRSADSGH  431

Query  565  YVAWVKQENGKWI  603
            YVAWVKQENGKW+
Sbjct  432  YVAWVKQENGKWV  444



>ref|XP_011072477.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Sesamum 
indicum]
Length=484

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 179/194 (92%), Gaps = 1/194 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGL+RGLKSELEK+SPSLGRSAIY KDSRIN LPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLRRGLKSELEKSSPSLGRSAIYTKDSRINDLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRE+NQKAKILRKVDYPLELDV+DLCSDDLRKRLE PR+ LRDEEGKKLGL+ +  SS
Sbjct  312  FWKRETNQKAKILRKVDYPLELDVYDLCSDDLRKRLEAPRRLLRDEEGKKLGLKTNEGSS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAP-QEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            SS DNDVKMTDA  SS+GSG SSK AP +E V PEKE+HLTGIYDLVAVLTHKGRSADSG
Sbjct  372  SSTDNDVKMTDAEGSSNGSGNSSKSAPGEEDVPPEKEKHLTGIYDLVAVLTHKGRSADSG  431

Query  562  HYVAWVKQENGKWI  603
            HYVAWVKQENGKWI
Sbjct  432  HYVAWVKQENGKWI  445



>ref|XP_007024437.1| Ubiquitin-specific protease 6 [Theobroma cacao]
 gb|EOY27059.1| Ubiquitin-specific protease 6 [Theobroma cacao]
Length=483

 Score =   322 bits (825),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASP+LGRSAIYLK+SRINGLPRYLTIQFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGLKHGLKSELEKASPALGRSAIYLKESRINGLPRYLTIQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+DLCSD+LRK+LEGPR+ LRDEEGKKLGL+A+ KSS +K
Sbjct  315  RESNQKAKILRKVDYPLELDVYDLCSDELRKQLEGPRQILRDEEGKKLGLKANEKSSGTK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS+ SGESS   PQEGVL +KE  LTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DDDVKMTDAEGSSNASGESSATTPQEGVLSDKESCLTGIYDLVAVLTHKGRSADSGHYVA  434

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  435  WVKQESGKWI  444



>gb|EYU21397.1| hypothetical protein MIMGU_mgv1a005447mg [Erythranthe guttata]
Length=483

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLK GLKSELEK+SP+LGR+AIY KDSRINGLPRYLT+QFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKHGLKSELEKSSPALGRTAIYSKDSRINGLPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRE+NQKAKILRKVDYPLELDV+D CSDDLRK LE PRK LRDEEGKKLGL+ +  SS
Sbjct  312  FWKRETNQKAKILRKVDYPLELDVYDFCSDDLRKVLEVPRKHLRDEEGKKLGLKTNENSS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            +S + DVKMTDA  SS+ +G+SSK AP EGV PEKE+HLTG+YDLVAVLTHKGRSADSGH
Sbjct  372  TSSNTDVKMTDAEGSSNETGDSSKSAPGEGVPPEKEKHLTGVYDLVAVLTHKGRSADSGH  431

Query  565  YVAWVKQENGKWI  603
            YVAWVKQENGKWI
Sbjct  432  YVAWVKQENGKWI  444



>ref|XP_009776740.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X2 
[Nicotiana sylvestris]
Length=482

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSA+Y+KDSRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAVYVKDSRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPL LDV+D CS+DLRK+LEGPR+ LRD EGKK GL+ S K+S
Sbjct  312  FWKRESNQKAKILRKVDYPLSLDVYDFCSEDLRKKLEGPRQVLRDAEGKKAGLKTSEKTS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SS D DVKMT+A ESSSGSGE+SK   QEGVLPEKE HLTGIYDLVAVLTHKGRSADSGH
Sbjct  372  SSTDGDVKMTEAEESSSGSGEASK-TTQEGVLPEKEHHLTGIYDLVAVLTHKGRSADSGH  430

Query  565  YVAWVKQENGKWI  603
            YVAWVKQENGKW+
Sbjct  431  YVAWVKQENGKWV  443



>ref|XP_006367701.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Solanum 
tuberosum]
Length=483

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSA+Y+KDSRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAVYVKDSRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPL LDV+DLCSD+LRK+LEGPR+ LRD EGKK GL+ S K+ 
Sbjct  312  FWKRESNQKAKILRKVDYPLSLDVYDLCSDNLRKKLEGPRQVLRDAEGKKAGLKTSAKTP  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
             S D+D KMT+A ESSSGSGE+SK   QEGVLPEKE  LTGIYDLVAVLTHKGRSADSGH
Sbjct  372  VSTDSDTKMTEAEESSSGSGEASKSTSQEGVLPEKEHQLTGIYDLVAVLTHKGRSADSGH  431

Query  565  YVAWVKQENGKWI  603
            YVAWVKQENGKW+
Sbjct  432  YVAWVKQENGKWV  444



>ref|XP_009593930.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X1 
[Nicotiana tomentosiformis]
Length=487

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 179/197 (91%), Gaps = 4/197 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSA+Y+KDSRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAVYVKDSRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPL LDV+D CS+DLRK+LEGPR+ LRD EGKK GL+ SGK+S
Sbjct  312  FWKRESNQKAKILRKVDYPLSLDVYDFCSEDLRKKLEGPRQVLRDAEGKKAGLKTSGKTS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQ----EGVLPEKEQHLTGIYDLVAVLTHKGRSA  552
            SS D DVKMT+A ESSSGSGE+SK   +     GVLPEKE HLTGIYDLVAVLTHKGRSA
Sbjct  372  SSTDGDVKMTEAEESSSGSGEASKTTQEVNSISGVLPEKEHHLTGIYDLVAVLTHKGRSA  431

Query  553  DSGHYVAWVKQENGKWI  603
            DSGHYVAWVKQENGKW+
Sbjct  432  DSGHYVAWVKQENGKWV  448



>ref|XP_009776739.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X1 
[Nicotiana sylvestris]
Length=487

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 178/197 (90%), Gaps = 4/197 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSA+Y+KDSRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAVYVKDSRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPL LDV+D CS+DLRK+LEGPR+ LRD EGKK GL+ S K+S
Sbjct  312  FWKRESNQKAKILRKVDYPLSLDVYDFCSEDLRKKLEGPRQVLRDAEGKKAGLKTSEKTS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQ----EGVLPEKEQHLTGIYDLVAVLTHKGRSA  552
            SS D DVKMT+A ESSSGSGE+SK   +     GVLPEKE HLTGIYDLVAVLTHKGRSA
Sbjct  372  SSTDGDVKMTEAEESSSGSGEASKTTQEVNSISGVLPEKEHHLTGIYDLVAVLTHKGRSA  431

Query  553  DSGHYVAWVKQENGKWI  603
            DSGHYVAWVKQENGKW+
Sbjct  432  DSGHYVAWVKQENGKWV  448



>gb|KDP40803.1| hypothetical protein JCGZ_24802 [Jatropha curcas]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASPSLGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  257  LKCHISQEVNHLHEGLKHGLKSELEKASPSLGRSAIYLKESRINALPRYLTVQFVRFFWK  316

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSDDLRK+LE PR+ LRDEEGKKLGL+A+ K+SSSK
Sbjct  317  RESNQKAKILRKVDYPLELDVYDFCSDDLRKKLEAPRQTLRDEEGKKLGLKANEKASSSK  376

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS+GSGESSK   +EG   +KE  LTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  377  DSDVKMTDAEGSSNGSGESSKATSEEGDSSDKEPVLTGIYDLVAVLTHKGRSADSGHYVA  436

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  437  WVKQENGKWI  446



>gb|KJB35024.1| hypothetical protein B456_006G096100 [Gossypium raimondii]
Length=472

 Score =   311 bits (797),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLK  LKSELEKASP+LGRSAIYLK+SRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKHALKSELEKASPALGRSAIYLKESRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV+DLCSD+LRK+LEGPR+ LRDEEGKKLGL+A+ KSS
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYDLCSDELRKQLEGPRQILRDEEGKKLGLKANEKSS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSKD DVKM D   SS+ SGES+    QEGV  +KE  LTGIYDLVAVLTHKGRSADSGH
Sbjct  372  SSKD-DVKMIDGEGSSNASGESTVTTSQEGVPSDKETRLTGIYDLVAVLTHKGRSADSGH  430

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  431  YVAWVKQESGKWI  443



>gb|KJB35023.1| hypothetical protein B456_006G096100 [Gossypium raimondii]
Length=482

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLK  LKSELEKASP+LGRSAIYLK+SRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKHALKSELEKASPALGRSAIYLKESRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV+DLCSD+LRK+LEGPR+ LRDEEGKKLGL+A+ KSS
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYDLCSDELRKQLEGPRQILRDEEGKKLGLKANEKSS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSKD DVKM D   SS+ SGES+    QEGV  +KE  LTGIYDLVAVLTHKGRSADSGH
Sbjct  372  SSKD-DVKMIDGEGSSNASGESTVTTSQEGVPSDKETRLTGIYDLVAVLTHKGRSADSGH  430

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  431  YVAWVKQESGKWI  443



>ref|XP_002281000.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Vitis vinifera]
 emb|CBI35978.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 173/193 (90%), Gaps = 4/193 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHIS EVNHLHEGLK GLKSELEKASPSLGRSAIY+K+SRINGLPRYLTIQFVRF
Sbjct  252  VYSLKCHISHEVNHLHEGLKHGLKSELEKASPSLGRSAIYVKESRINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV+DLCSDDLRK+LE PR+ LRDEEGKKLGL    K+S
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYDLCSDDLRKKLEAPRQILRDEEGKKLGL----KNS  367

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            +SKDNDVKM DA  SS+ SGESS     EGV  +KE HLTGIYDLVAVLTHKGRSADSGH
Sbjct  368  ASKDNDVKMADAEGSSNRSGESSLATSDEGVPTDKETHLTGIYDLVAVLTHKGRSADSGH  427

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  428  YVAWVKQESGKWI  440



>ref|XP_011012175.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7-like isoform 
X2 [Populus euphratica]
Length=482

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASP LGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  254  LKCHISQEVNHLHEGLKHGLKSELEKASPCLGRSAIYLKESRINALPRYLTVQFVRFFWK  313

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LDV+D CSDDL K+LE PR+ LRDEEGKK GL+A  K+S SK
Sbjct  314  RESNQKAKILRKVDYPLQLDVYDFCSDDLCKKLEAPRQILRDEEGKKAGLKAKEKTSGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DNDVKMTD    S+ SGESSKP  QEG   +K+ HLTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DNDVKMTDVERPSNESGESSKPTSQEGGPTDKKSHLTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>ref|XP_011012174.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7-like isoform 
X1 [Populus euphratica]
Length=483

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASP LGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGLKHGLKSELEKASPCLGRSAIYLKESRINALPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LDV+D CSDDL K+LE PR+ LRDEEGKK GL+A  K+S SK
Sbjct  315  RESNQKAKILRKVDYPLQLDVYDFCSDDLCKKLEAPRQILRDEEGKKAGLKAKEKTSGSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DNDVKMTD    S+ SGESSKP  QEG   +K+ HLTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DNDVKMTDVERPSNESGESSKPTSQEGGPTDKKSHLTGIYDLVAVLTHKGRSADSGHYVA  434

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  435  WVKQESGKWI  444



>ref|XP_010088378.1| Ubiquitin carboxyl-terminal hydrolase 6 [Morus notabilis]
 gb|EXB34852.1| Ubiquitin carboxyl-terminal hydrolase 6 [Morus notabilis]
Length=693

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHIS EVNHLHEGLK GLKSELEK SPSLGRSAIYLK+SRINGLPRYLTIQFVR
Sbjct  461  SVYSLKCHISHEVNHLHEGLKHGLKSELEKNSPSLGRSAIYLKESRINGLPRYLTIQFVR  520

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+DLCSDDLRK+LEGPR+ LRDEEGKKLGL+ASGK 
Sbjct  521  FFWKRESNQKAKILRKVDYPLELDVYDLCSDDLRKKLEGPRQILRDEEGKKLGLKASGKG  580

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            S+SKD DVKM++A  SS+G+GE S     +G   +KE  +TG+YDLVAVLTHKGRSADSG
Sbjct  581  STSKDTDVKMSEAEGSSNGNGEPSNSKSDQGAESQKETQVTGVYDLVAVLTHKGRSADSG  640

Query  562  HYVAWVKQENGKWI  603
            HYVAWVKQE+GKWI
Sbjct  641  HYVAWVKQESGKWI  654



>ref|XP_011008463.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7 isoform X1 
[Populus euphratica]
Length=482

 Score =   307 bits (786),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASPSLGRSAIYLK+S IN LPRYLT+QFVRFFWK
Sbjct  254  LKCHISQEVNHLHEGLKHGLKSELEKASPSLGRSAIYLKESCINALPRYLTVQFVRFFWK  313

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSDDLRK+LE PR+ LRDEEGKK GL+A+ KSSSSK
Sbjct  314  RESNQKAKILRKVDYPLELDVYDFCSDDLRKKLEAPRQILRDEEGKKAGLKATVKSSSSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DND KMTD    S+ S ++S     EG   +KE HLTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DNDAKMTDVEGPSNESVKTSNSTSGEGGSSDKESHLTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>ref|XP_006393007.1| hypothetical protein EUTSA_v10011383mg [Eutrema salsugineum]
 gb|ESQ30293.1| hypothetical protein EUTSA_v10011383mg [Eutrema salsugineum]
Length=438

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGRSA+YLK+S I+ LPRYLT+QFVRFFWK
Sbjct  211  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRSALYLKESLIDSLPRYLTVQFVRFFWK  270

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD++DLCS+DLRK+LE PR+ LRDEEGKKLGLQ S K SS+K
Sbjct  271  RETNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTSAK-SSAK  329

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS GSGESS   PQEG   EKE H+TGIYDLV+VLTHKGRSADSGHYVA
Sbjct  330  DSDVKMTDAEASSHGSGESSTVTPQEGASSEKETHMTGIYDLVSVLTHKGRSADSGHYVA  389

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  390  WVKQESGKWI  399



>gb|KDO58642.1| hypothetical protein CISIN_1g011408mg [Citrus sinensis]
Length=486

 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 171/196 (87%), Gaps = 3/196 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            +++LKCHIS EVNHLHEGLK GLKSELEKASP+LGRSA+YLK+S INGLPRYLTIQFVRF
Sbjct  252  IYALKCHISHEVNHLHEGLKHGLKSELEKASPALGRSAVYLKESCINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV+D CSDDLRK+L+ PR+ LRDEEGKKLGL+   KSS
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQKLRDEEGKKLGLKGGEKSS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPA-PQEGVL--PEKEQHLTGIYDLVAVLTHKGRSAD  555
            +SKDNDVKMT+A  S+S     S  A  Q+GV    +KE HLTGIYDLVAVLTHKGRSAD
Sbjct  372  NSKDNDVKMTEAEGSASNGSGESSVASSQDGVTTDTDKETHLTGIYDLVAVLTHKGRSAD  431

Query  556  SGHYVAWVKQENGKWI  603
            SGHYVAWVKQE+GKWI
Sbjct  432  SGHYVAWVKQESGKWI  447



>emb|CDO97936.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 172/194 (89%), Gaps = 5/194 (3%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHISQEVNHLHEGLKRGLKSELEKASP+LGRSAIY+KDSRIN LPRYLT+QFVR
Sbjct  253  SVYSLKCHISQEVNHLHEGLKRGLKSELEKASPALGRSAIYVKDSRINDLPRYLTVQFVR  312

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPL LDVFDLCSDDLRKRLE PR+ LRDEEG+KLGL+   KS
Sbjct  313  FFWKRESNQKAKILRKVDYPLVLDVFDLCSDDLRKRLETPRQILRDEEGRKLGLKVDQKS  372

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            S S D DVKMTD  ES++G+G +SK +  EG    KE HLTGIYDLVAVLTHKGRSADSG
Sbjct  373  SGS-DTDVKMTDNEESANGNGGTSKDSSLEG----KEVHLTGIYDLVAVLTHKGRSADSG  427

Query  562  HYVAWVKQENGKWI  603
            HYVAW KQENGKWI
Sbjct  428  HYVAWAKQENGKWI  441



>ref|XP_007215300.1| hypothetical protein PRUPE_ppa005074mg [Prunus persica]
 ref|XP_008228329.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X2 
[Prunus mume]
 gb|EMJ16499.1| hypothetical protein PRUPE_ppa005074mg [Prunus persica]
Length=476

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 168/190 (88%), Gaps = 7/190 (4%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK  LKSELEK SPSLGRSAIYLK+SRINGLPRYLTIQFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHALKSELEKNSPSLGRSAIYLKESRINGLPRYLTIQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LD+FDLCSDDLRKRLE PR+ LRDEEGKKLGL+++ KSS SK
Sbjct  315  RESNQKAKILRKVDYPLQLDIFDLCSDDLRKRLEAPRRTLRDEEGKKLGLKSNEKSSGSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DND+KM+D   SS+GSGE+S P P EG        +TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DNDIKMSDVEGSSNGSGEASNPTPDEGA-------MTGIYDLVAVLTHKGRSADSGHYVA  427

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  428  WVKQESGKWI  437



>ref|XP_011012176.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7-like isoform 
X3 [Populus euphratica]
Length=479

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 167/190 (88%), Gaps = 4/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASP LGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGLKHGLKSELEKASPCLGRSAIYLKESRINALPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LDV+D CSDDL K+LE PR+ LRDEEGKK GL+A  K+S SK
Sbjct  315  RESNQKAKILRKVDYPLQLDVYDFCSDDLCKKLEAPRQILRDEEGKKAGLKAKEKTSGSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DNDVKMTD    S+ SGESSKP  QE    +K+ HLTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DNDVKMTDVERPSNESGESSKPTSQE----DKKSHLTGIYDLVAVLTHKGRSADSGHYVA  430

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  431  WVKQESGKWI  440



>ref|XP_011012177.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7-like isoform 
X4 [Populus euphratica]
Length=478

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 167/190 (88%), Gaps = 4/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASP LGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  254  LKCHISQEVNHLHEGLKHGLKSELEKASPCLGRSAIYLKESRINALPRYLTVQFVRFFWK  313

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LDV+D CSDDL K+LE PR+ LRDEEGKK GL+A  K+S SK
Sbjct  314  RESNQKAKILRKVDYPLQLDVYDFCSDDLCKKLEAPRQILRDEEGKKAGLKAKEKTSGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DNDVKMTD    S+ SGESSKP  QE    +K+ HLTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DNDVKMTDVERPSNESGESSKPTSQE----DKKSHLTGIYDLVAVLTHKGRSADSGHYVA  429

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  430  WVKQESGKWI  439



>ref|XP_010062585.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7 isoform X1 
[Eucalyptus grandis]
Length=483

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
             V+SLKCHIS EVNHLHEGL+ GLKSELEKASPSLGRSAIYLK+SRI+GLPRYLTIQFVR
Sbjct  251  TVYSLKCHISHEVNHLHEGLRHGLKSELEKASPSLGRSAIYLKESRIDGLPRYLTIQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+D CSDDL+K+LE PR+ LR+EEGKKLGL+ + KS
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYDFCSDDLQKKLEAPRQLLRNEEGKKLGLKVAEKS  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            S+SKDNDVKM+DA E SS     S     +   P +E+ LTGIYDLVAVLTHKGRSADSG
Sbjct  371  STSKDNDVKMSDADEGSSNLARESSLTTSQDDAPVEEKQLTGIYDLVAVLTHKGRSADSG  430

Query  562  HYVAWVKQENGKWI  603
            HYVAWVKQE+GKWI
Sbjct  431  HYVAWVKQESGKWI  444



>ref|XP_010545626.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X2 
[Tarenaya hassleriana]
Length=438

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 171/193 (89%), Gaps = 1/193 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLKRGL+ ELEK S SLGR+A+++K+S I+ LPRYLT+QFVRF
Sbjct  208  VYSLKCHISQEVNHLHEGLKRGLRGELEKTSSSLGRTALFIKESCIDSLPRYLTVQFVRF  267

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRE+NQKAKILRKVDYPLELDV+DLCSDDLRK+LE PR+ LRDEEGKKLGLQ S K +
Sbjct  268  FWKRETNQKAKILRKVDYPLELDVYDLCSDDLRKKLEAPRQKLRDEEGKKLGLQTSAK-N  326

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSKDNDVKM DA  SS+GS ESS    QEG   E+E H+TGIYDLVAVLTHKGRSADSGH
Sbjct  327  SSKDNDVKMADAEGSSNGSRESSTDNQQEGAPSEREAHMTGIYDLVAVLTHKGRSADSGH  386

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  387  YVAWVKQESGKWI  399



>ref|XP_010062586.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7 isoform X2 
[Eucalyptus grandis]
Length=482

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 173/194 (89%), Gaps = 1/194 (1%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
             V+SLKCHIS EVNHLHEGL+ GLKSELEKASPSLGRSAIYLK+SRI+GLPRYLTIQFVR
Sbjct  251  TVYSLKCHISHEVNHLHEGLRHGLKSELEKASPSLGRSAIYLKESRIDGLPRYLTIQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+D CSDDL+K+LE PR+ LR+EEGKKLGL+ + KS
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYDFCSDDLQKKLEAPRQLLRNEEGKKLGLKVAEKS  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            S+SKDNDVKM+DA  SS+ + ESS    Q+   P +E+ LTGIYDLVAVLTHKGRSADSG
Sbjct  371  STSKDNDVKMSDADGSSNLARESSLTTSQDDA-PVEEKQLTGIYDLVAVLTHKGRSADSG  429

Query  562  HYVAWVKQENGKWI  603
            HYVAWVKQE+GKWI
Sbjct  430  HYVAWVKQESGKWI  443



>gb|KCW69715.1| hypothetical protein EUGRSUZ_F03104 [Eucalyptus grandis]
Length=530

 Score =   303 bits (776),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
             V+SLKCHIS EVNHLHEGL+ GLKSELEKASPSLGRSAIYLK+SRI+GLPRYLTIQFVR
Sbjct  251  TVYSLKCHISHEVNHLHEGLRHGLKSELEKASPSLGRSAIYLKESRIDGLPRYLTIQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+D CSDDL+K+LE PR+ LR+EEGKKLGL+ + KS
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYDFCSDDLQKKLEAPRQLLRNEEGKKLGLKVAEKS  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            S+SKDNDVKM+DA E SS     S     +   P +E+ LTGIYDLVAVLTHKGRSADSG
Sbjct  371  STSKDNDVKMSDADEGSSNLARESSLTTSQDDAPVEEKQLTGIYDLVAVLTHKGRSADSG  430

Query  562  HYVAWVKQENGKWI  603
            HYVAWVKQE+GKWI
Sbjct  431  HYVAWVKQESGKWI  444



>ref|XP_011008464.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7 isoform X2 
[Populus euphratica]
Length=478

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 165/190 (87%), Gaps = 4/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASPSLGRSAIYLK+S IN LPRYLT+QFVRFFWK
Sbjct  254  LKCHISQEVNHLHEGLKHGLKSELEKASPSLGRSAIYLKESCINALPRYLTVQFVRFFWK  313

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSDDLRK+LE PR+ LRDEEGKK GL+A+ KSSSSK
Sbjct  314  RESNQKAKILRKVDYPLELDVYDFCSDDLRKKLEAPRQILRDEEGKKAGLKATVKSSSSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DND KMTD    S+ S ++S     E    +KE HLTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DNDAKMTDVEGPSNESVKTSNSTSGE----DKESHLTGIYDLVAVLTHKGRSADSGHYVA  429

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  430  WVKQESGKWI  439



>ref|XP_010545625.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X1 
[Tarenaya hassleriana]
Length=482

 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 171/193 (89%), Gaps = 1/193 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQEVNHLHEGLKRGL+ ELEK S SLGR+A+++K+S I+ LPRYLT+QFVRF
Sbjct  252  VYSLKCHISQEVNHLHEGLKRGLRGELEKTSSSLGRTALFIKESCIDSLPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRE+NQKAKILRKVDYPLELDV+DLCSDDLRK+LE PR+ LRDEEGKKLGLQ S K +
Sbjct  312  FWKRETNQKAKILRKVDYPLELDVYDLCSDDLRKKLEAPRQKLRDEEGKKLGLQTSAK-N  370

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSKDNDVKM DA  SS+GS ESS    QEG   E+E H+TGIYDLVAVLTHKGRSADSGH
Sbjct  371  SSKDNDVKMADAEGSSNGSRESSTDNQQEGAPSEREAHMTGIYDLVAVLTHKGRSADSGH  430

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  431  YVAWVKQESGKWI  443



>ref|XP_007215301.1| hypothetical protein PRUPE_ppa005074mg [Prunus persica]
 ref|XP_008228328.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X1 
[Prunus mume]
 gb|EMJ16500.1| hypothetical protein PRUPE_ppa005074mg [Prunus persica]
Length=478

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 167/190 (88%), Gaps = 5/190 (3%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK  LKSELEK SPSLGRSAIYLK+SRINGLPRYLTIQFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHALKSELEKNSPSLGRSAIYLKESRINGLPRYLTIQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LD+FDLCSDDLRKRLE PR+ LRDEEGKKLGL+++ KSS SK
Sbjct  315  RESNQKAKILRKVDYPLQLDIFDLCSDDLRKRLEAPRRTLRDEEGKKLGLKSNEKSSGSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DND+KM+D   SS+GSGE+S P P E         +TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DNDIKMSDVEGSSNGSGEASNPTPDEAA-----GAMTGIYDLVAVLTHKGRSADSGHYVA  429

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  430  WVKQESGKWI  439



>ref|NP_001077698.1| ubiquitin carboxyl-terminal hydrolase 6 [Arabidopsis thaliana]
 gb|AEE32706.1| ubiquitin carboxyl-terminal hydrolase 6 [Arabidopsis thaliana]
Length=443

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+Y+K+S I+ LPRYLT+QFVRFFWK
Sbjct  216  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYVKESLIDSLPRYLTVQFVRFFWK  275

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL LD+FDLCS+DLRK+LE PR+ LR+EEGKKLGLQ S K S SK
Sbjct  276  RESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAK-SGSK  334

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  S++GSGESS   PQEG   EKE H+TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  335  DSDVKMTDAEASANGSGESSTVNPQEGTSSEKETHMTGIYDLVAVLTHKGRSADSGHYVA  394

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  395  WVKQESGKWI  404



>ref|XP_006393006.1| hypothetical protein EUTSA_v10011383mg [Eutrema salsugineum]
 gb|ESQ30292.1| hypothetical protein EUTSA_v10011383mg [Eutrema salsugineum]
Length=531

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 169/190 (89%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGRSA+YLK+S I+ LPRYLT+QFVRFFWK
Sbjct  304  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRSALYLKESLIDSLPRYLTVQFVRFFWK  363

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD++DLCS+DLRK+LE PR+ LRDEEGKKLGLQ S K SS+K
Sbjct  364  RETNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTSAK-SSAK  422

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS GSGESS   PQEG   EKE H+TGIYDLV+VLTHKGRSADSGHYVA
Sbjct  423  DSDVKMTDAEASSHGSGESSTVTPQEGASSEKETHMTGIYDLVSVLTHKGRSADSGHYVA  482

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  483  WVKQESGKWI  492



>ref|XP_010693148.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +  +LKCHIS EVNHLHEGLK GLKSELEK SP+LGRSA+YLK+SRI+GLPRYLTIQFVR
Sbjct  263  STFALKCHISHEVNHLHEGLKHGLKSELEKNSPTLGRSALYLKESRISGLPRYLTIQFVR  322

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELD+FDLCSD+L+K+LE PR+ LRDEEGKKLGL+ S K+
Sbjct  323  FFWKRESNQKAKILRKVDYPLELDIFDLCSDELKKKLEAPRQILRDEEGKKLGLKPSEKN  382

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            S SK+NDVKM DA  SS+GSGESS     E    EKE HLTG+YDLVAVLTHKGRSADSG
Sbjct  383  SGSKENDVKMLDAEVSSNGSGESSTGTSIEAASSEKEMHLTGVYDLVAVLTHKGRSADSG  442

Query  562  HYVAWVKQENGKWI  603
            HYVAWVKQ++GKWI
Sbjct  443  HYVAWVKQDDGKWI  456



>ref|XP_006369258.1| UBIQUITIN-SPECIFIC PROTEASE 6 family protein [Populus trichocarpa]
 gb|ERP65827.1| UBIQUITIN-SPECIFIC PROTEASE 6 family protein [Populus trichocarpa]
Length=507

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 167/190 (88%), Gaps = 4/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASP LGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  283  LKCHISQEVNHLHEGLKHGLKSELEKASPCLGRSAIYLKESRINALPRYLTVQFVRFFWK  342

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LDV+D CSDDL K+LE PR+ LRDEEGKK GL+A  K+S SK
Sbjct  343  RESNQKAKILRKVDYPLQLDVYDFCSDDLCKKLEAPRQILRDEEGKKAGLKAKEKTSGSK  402

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DNDVKMTD    S+ SGESSKP  +E    +K+ HLTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  403  DNDVKMTDVERPSNESGESSKPTSKE----DKKSHLTGIYDLVAVLTHKGRSADSGHYVA  458

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  459  WVKQESGKWI  468



>ref|XP_002894329.1| ubiquitin-specific protease 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70588.1| ubiquitin-specific protease 6 [Arabidopsis lyrata subsp. lyrata]
Length=482

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+Y+K+S I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYVKESLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL LD+FDLCS+DLRK+LE PR+ LRDEEGKKLGLQ S K S SK
Sbjct  315  RESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTSAK-SGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  S++GSGESS   PQEG   EKE H+TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DSDVKMTDAEASANGSGESSTVNPQEGASSEKETHMTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>ref|XP_010462008.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Camelina 
sativa]
Length=482

 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+YLKDS I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPTLGRTALYLKDSLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD+FDLCS+DLRK+LE PR+ LRDEEGKKLGLQ S K S SK
Sbjct  315  RETNQKAKILRKVDYPLELDIFDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTSAK-SGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS+GSGESS    QEG    KE H+TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DSDVKMTDAEASSNGSGESSTVNQQEGASSGKETHMTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>ref|XP_010500755.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Camelina 
sativa]
Length=482

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+YLKDS I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPTLGRTALYLKDSLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD+FDLCS+DLRK+LE PR+ LRDEEGKKLGLQ S K S SK
Sbjct  315  RETNQKAKILRKVDYPLELDIFDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTSAK-SGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS+GSGESS    QEG    KE H+TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DSDVKMTDAEASSNGSGESSTVNQQEGASSGKETHMTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>ref|XP_010479669.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Camelina 
sativa]
Length=482

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+YLKDS I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPTLGRTALYLKDSLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD+FDLCS+DLRK+LE PR+ LRDEEGKKLGLQ S K S SK
Sbjct  315  RETNQKAKILRKVDYPLELDIFDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTSAK-SGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS+GSGESS    QEG    KE H+TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DSDVKMTDAEASSNGSGESSTVNQQEGASSGKETHMTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>ref|XP_009344441.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009344443.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X2 [Pyrus x bretschneideri]
Length=476

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 166/190 (87%), Gaps = 7/190 (4%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLKSELEK SPSLGRSAIY+K+S INGLPRYLTIQFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKSELEKNSPSLGRSAIYVKESLINGLPRYLTIQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LD+FDLCSDDLRK LE PR+ LRDEEGKKLGL+ S KSS SK
Sbjct  315  RESNQKAKILRKVDYPLQLDIFDLCSDDLRKTLEAPRQRLRDEEGKKLGLKPSEKSSDSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D D+KM+DA  SS+GSGESS P P EG        +TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DKDIKMSDAEGSSNGSGESSNPTPDEGA-------MTGIYDLVAVLTHKGRSADSGHYVA  427

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  428  WVKQESGKWI  437



>ref|XP_010262220.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Nelumbo nucifera]
Length=479

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 164/190 (86%), Gaps = 4/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEK SPSLGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGLKHGLKSELEKVSPSLGRSAIYLKESRINNLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+DLCSD+LRK+LE PR+ LRDEEGKKLGL+ S K++ SK
Sbjct  315  RESNQKAKILRKVDYPLELDVYDLCSDELRKKLETPRQILRDEEGKKLGLKTSDKNTDSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DNDVKM DA     GS   S+    EG   EK+ HLTGI+DLVAVLTHKGRSADSGHYV 
Sbjct  375  DNDVKMLDA----EGSSNGSRDQSGEGSSSEKQVHLTGIFDLVAVLTHKGRSADSGHYVG  430

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  431  WVKQESGKWI  440



>gb|AAG50872.1|AC025294_10 tRNA-guaninine transglycosylase, putative [Arabidopsis thaliana]
Length=490

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+Y+K+S I+ LPRYLT+QFVRFFWK
Sbjct  263  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYVKESLIDSLPRYLTVQFVRFFWK  322

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL LD+FDLCS+DLRK+LE PR+ LR+EEGKKLGLQ S K S SK
Sbjct  323  RESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAK-SGSK  381

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  S++GSGESS   PQEG   EKE H+TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  382  DSDVKMTDAEASANGSGESSTVNPQEGTSSEKETHMTGIYDLVAVLTHKGRSADSGHYVA  441

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  442  WVKQESGKWI  451



>ref|XP_002534122.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis]
 gb|EEF28259.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis]
Length=482

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQ+VNHLHEGLK GLKSELEKASPSLGRSAIYLK+S IN LPRYLT+QFVRFFWK
Sbjct  254  LKCHISQDVNHLHEGLKHGLKSELEKASPSLGRSAIYLKESCINDLPRYLTVQFVRFFWK  313

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CS DLRK+LE PR+ LRDEEG+KLGL+ + KSS SK
Sbjct  314  RESNQKAKILRKVDYPLELDVYDFCSADLRKQLEAPRQILRDEEGRKLGLKVNEKSSGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DNDVKMTDA   SSGSGESSK   +EG    K   LTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DNDVKMTDAEGPSSGSGESSKATSEEGESSHKVSSLTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>gb|AAG42751.1|AF302660_1 ubiquitin-specific protease 6 [Arabidopsis thaliana]
Length=482

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+Y+K+S I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYVKESLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL LD+FDLCS+DLRK+LE PR+ LR+EEGKKLGLQ S K S SK
Sbjct  315  RESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAK-SGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  S++GSGESS   PQEG   EKE H+TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DSDVKMTDAEASANGSGESSTVNPQEGTSSEKETHMTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>ref|NP_564596.1| ubiquitin carboxyl-terminal hydrolase 6 [Arabidopsis thaliana]
 sp|Q949Y0.1|UBP6_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 6; AltName: 
Full=Deubiquitinating enzyme 6; Short=AtUBP6; AltName: Full=Ubiquitin 
thioesterase 6; AltName: Full=Ubiquitin-specific-processing 
protease 6 [Arabidopsis thaliana]
 gb|AAK92752.1| putative ubiquitin-specific protease UBP6 [Arabidopsis thaliana]
 gb|AAM45129.1| putative ubiquitin-specific protease UBP6 [Arabidopsis thaliana]
 gb|AAM61304.1| ubiquitin-specific protease UBP6, putative [Arabidopsis thaliana]
 gb|AAN31805.1| putative ubiquitin-specific protease 6 (UBP6) [Arabidopsis thaliana]
 gb|AEE32705.1| ubiquitin carboxyl-terminal hydrolase 6 [Arabidopsis thaliana]
Length=482

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+Y+K+S I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYVKESLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL LD+FDLCS+DLRK+LE PR+ LR+EEGKKLGLQ S K S SK
Sbjct  315  RESNQKAKILRKVDYPLVLDIFDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAK-SGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  S++GSGESS   PQEG   EKE H+TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DSDVKMTDAEASANGSGESSTVNPQEGTSSEKETHMTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>gb|KEH18288.1| ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=554

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 167/190 (88%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKAS +LGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  329  LKCHISQEVNHLHEGLKHGLKSELEKASAALGRSAIYLKESRINALPRYLTVQFVRFFWK  388

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+DLCSDDL+K+LE PRK LRDEEGKKLGL+ + KSS  K
Sbjct  389  RESNQKAKILRKVDYPLELDVYDLCSDDLKKKLEAPRKFLRDEEGKKLGLKVNEKSSVPK  448

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            +NDVKM+DA  SS+G GE S    +EG   EKE  +TG+YDLVAVLTHKGRSADSGHYV 
Sbjct  449  ENDVKMSDAEGSSNGGGEPSVAPMEEG---EKETQMTGVYDLVAVLTHKGRSADSGHYVG  505

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  506  WVKQENGKWI  515



>ref|XP_006466082.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Citrus 
sinensis]
Length=486

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            +++LKCHIS EVNHLHEGLK GLKSELEKASP+LGRSA+YLK+S INGLP YLTIQFVRF
Sbjct  252  IYALKCHISHEVNHLHEGLKHGLKSELEKASPALGRSAVYLKESCINGLPGYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV+D CSDDLRK+L+ PR+ LRDEEGKKLGL+   KSS
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQKLRDEEGKKLGLKGGEKSS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPA-PQEGVL--PEKEQHLTGIYDLVAVLTHKGRSAD  555
            + KDNDVKMT+A  S+S     S  A  Q+GV    +KE HLTGIYDLVAVLTHKGRSAD
Sbjct  372  NLKDNDVKMTEAEGSASNGSGESSVASSQDGVTTDTDKETHLTGIYDLVAVLTHKGRSAD  431

Query  556  SGHYVAWVKQENGKWI  603
            SGHYVAWVKQ +GKWI
Sbjct  432  SGHYVAWVKQGSGKWI  447



>ref|XP_009344440.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009344442.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X1 [Pyrus x bretschneideri]
Length=478

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 165/190 (87%), Gaps = 5/190 (3%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLKSELEK SPSLGRSAIY+K+S INGLPRYLTIQFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKSELEKNSPSLGRSAIYVKESLINGLPRYLTIQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LD+FDLCSDDLRK LE PR+ LRDEEGKKLGL+ S KSS SK
Sbjct  315  RESNQKAKILRKVDYPLQLDIFDLCSDDLRKTLEAPRQRLRDEEGKKLGLKPSEKSSDSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D D+KM+DA  SS+GSGESS P P E         +TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DKDIKMSDAEGSSNGSGESSNPTPDEAA-----GAMTGIYDLVAVLTHKGRSADSGHYVA  429

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  430  WVKQESGKWI  439



>gb|AGH62007.1| ubiquitin carboxyl-terminal hydrolase 6 [Arachis hypogaea]
Length=480

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEG+K+GLKSELEKASP+LGRSA YLK+SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGIKQGLKSELEKASPALGRSANYLKESRINALPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSDDLRK+LE PRK LRDEEGKKLGL+ S KSS  K
Sbjct  315  RESNQKAKILRKVDYPLELDVYDFCSDDLRKKLEAPRKLLRDEEGKKLGLKGSEKSSVQK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DND KM DA  SS+G GE S    +EG   EK   +TGIYDLVAVLTHKGRSADSGHYV 
Sbjct  375  DNDEKMADAEGSSNGGGEPSVAPMEEG---EKATQMTGIYDLVAVLTHKGRSADSGHYVG  431

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  432  WVKQENGKWI  441



>ref|XP_008462369.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Cucumis melo]
Length=483

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHISQEVNHL EGLK GLKSE++K SPSLGRSAI++++SRIN LPRYLTIQFVR
Sbjct  250  SVYSLKCHISQEVNHLSEGLKHGLKSEIDKVSPSLGRSAIFIRESRINSLPRYLTIQFVR  309

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV DLCSDDLRK+LEGPR  LR+EEGKKLGL+   K+
Sbjct  310  FFWKRESNQKAKILRKVDYPLELDVLDLCSDDLRKQLEGPRLLLRNEEGKKLGLKPKEKA  369

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQE-GVLPEKEQHLTGIYDLVAVLTHKGRSADS  558
            S S D DVKM+DA  +S+GS   S  APQE     +KE  +TGIYDLVAVLTHKGRSADS
Sbjct  370  SDSADKDVKMSDAEGTSTGSEAQSSVAPQEDSPSSDKETQMTGIYDLVAVLTHKGRSADS  429

Query  559  GHYVAWVKQENGKWI  603
            GHYVAWVKQE+GKWI
Sbjct  430  GHYVAWVKQESGKWI  444



>ref|XP_006307372.1| hypothetical protein CARUB_v10008998mg [Capsella rubella]
 gb|EOA40270.1| hypothetical protein CARUB_v10008998mg [Capsella rubella]
Length=482

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+YLK+S I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPTLGRTALYLKESLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD+FDLCS+DLRK+LE PR+ LRDEEGKKLGLQ S K S SK
Sbjct  315  RETNQKAKILRKVDYPLELDIFDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTSAK-SGSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS+G GESS    QEG   EK  H+TGIYDLVAVLTHKGRSADSGHYV+
Sbjct  374  DSDVKMTDAEASSNGGGESSTVNQQEGASSEKGTHMTGIYDLVAVLTHKGRSADSGHYVS  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>gb|AGH61998.1| ubiquitin carboxyl-terminal hydrolase 6 [Arachis hypogaea]
Length=480

 Score =   294 bits (753),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 163/190 (86%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEG+K GLKSELEKASP+LGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGIKHGLKSELEKASPALGRSAIYLKESRINALPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSDDLRK+LE PRK LRDEEGKKLGL+ S KSS  K
Sbjct  315  RESNQKAKILRKVDYPLELDVYDFCSDDLRKKLEAPRKLLRDEEGKKLGLKGSEKSSVQK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DND KM DA  SS+G GE S    +EG   EK   +TGIYDLVAV THKGRSADSGHYV 
Sbjct  375  DNDEKMADAEGSSNGGGEPSVAPMEEG---EKATEMTGIYDLVAVSTHKGRSADSGHYVG  431

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  432  WVKQENGKWI  441



>ref|XP_011463339.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7 isoform X1 
[Fragaria vesca subsp. vesca]
Length=481

 Score =   294 bits (753),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            VHSLKCHIS EVNHLHEGLK GLKSELEK SP+LGRSA+Y+K+SRINGLPRYLTIQFVRF
Sbjct  250  VHSLKCHISHEVNHLHEGLKHGLKSELEKNSPALGRSAVYVKESRINGLPRYLTIQFVRF  309

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV+DLCS+DLRK+LE PRK LRDEEGKKLGL+ S KSS
Sbjct  310  FWKRESNQKAKILRKVDYPLELDVYDLCSEDLRKKLEVPRKTLRDEEGKKLGLKPSEKSS  369

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSKD D+ M+DA  +S+GSGE+S     EGV PEKE  +TG+YDLVAVLTHKGRSADSGH
Sbjct  370  SSKDKDIMMSDAEGASNGSGETSNAMSVEGVQPEKEPQMTGVYDLVAVLTHKGRSADSGH  429

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  430  YVAWVKQESGKWI  442



>gb|AFK43690.1| unknown [Medicago truncatula]
Length=480

 Score =   294 bits (752),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 166/190 (87%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKAS +LGRSAIYLK+SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGLKHGLKSELEKASAALGRSAIYLKESRINALPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+DLCSD L+K+LE PRK LRDEEGKKLGL+ + KSS  K
Sbjct  315  RESNQKAKILRKVDYPLELDVYDLCSDGLKKKLEAPRKFLRDEEGKKLGLKVNEKSSVPK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            +NDVKM+DA  SS+G GE S    +EG   EKE  +TG+YDLVAVLTHKGRSADSGHYV 
Sbjct  375  ENDVKMSDAEGSSNGGGEPSVAPMEEG---EKETQMTGVYDLVAVLTHKGRSADSGHYVG  431

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  432  WVKQENGKWI  441



>ref|XP_004510349.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X2 [Cicer arietinum]
Length=435

 Score =   292 bits (747),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 4/193 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHIS EVNHLHEGLK GLKSELEKAS +LGRSAIYLK+SRIN LPRYLT+QFVRF
Sbjct  208  VYSLKCHISHEVNHLHEGLKHGLKSELEKASAALGRSAIYLKESRINALPRYLTVQFVRF  267

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPL LDV+DLCSDDL+K+LE PR+ LR++EGKK GL+ + KSS
Sbjct  268  FWKRESNQKAKILRKVDYPLVLDVYDLCSDDLKKKLEAPRQVLRNDEGKKFGLKVNEKSS  327

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
              K+NDVKM+DA  SS+G   S  P  +EG   EKE  +TGIYDLVAVLTHKGRSADSGH
Sbjct  328  VRKENDVKMSDAEGSSNGGEPSVAPM-EEG---EKETQMTGIYDLVAVLTHKGRSADSGH  383

Query  565  YVAWVKQENGKWI  603
            YV WVKQENGKWI
Sbjct  384  YVGWVKQENGKWI  396



>ref|XP_008391450.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Malus domestica]
Length=417

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 162/190 (85%), Gaps = 7/190 (4%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLKSELEK SPSLGRSAIY+K+S INGLPRYLTIQFVRFFWK
Sbjct  196  LKCHISHEVNHLHEGLKHGLKSELEKNSPSLGRSAIYVKESLINGLPRYLTIQFVRFFWK  255

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LD+FDLCSDDLRK LE PR+ LRDEEGKKLGL+ S KSS SK
Sbjct  256  RESNQKAKILRKVDYPLQLDIFDLCSDDLRKTLEAPRQRLRDEEGKKLGLKPSEKSSDSK  315

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D D++M+D   SS+  GESS P   EG        +TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  316  DKDIEMSDVEGSSNRRGESSNPTSDEGA-------MTGIYDLVAVLTHKGRSADSGHYVA  368

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  369  WVKQESGKWI  378



>ref|XP_009367530.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X2 [Pyrus x bretschneideri]
Length=476

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 163/190 (86%), Gaps = 7/190 (4%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLKSELEK SPSLGRSAIY+K+S INGLPRYLTIQFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKSELEKNSPSLGRSAIYVKESLINGLPRYLTIQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LD+FDLCSDDLRK LE PR+ LRDEEGKKLGL+ S KSS SK
Sbjct  315  RESNQKAKILRKVDYPLQLDIFDLCSDDLRKTLEAPRQRLRDEEGKKLGLKPSEKSSDSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D D+KM+D   SS+ SGESS P   EG        +TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DKDIKMSDVEGSSNRSGESSNPTSDEGA-------MTGIYDLVAVLTHKGRSADSGHYVA  427

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  428  WVKQESGKWI  437



>ref|XP_004510348.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X1 [Cicer arietinum]
Length=479

 Score =   292 bits (747),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 4/193 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHIS EVNHLHEGLK GLKSELEKAS +LGRSAIYLK+SRIN LPRYLT+QFVRF
Sbjct  252  VYSLKCHISHEVNHLHEGLKHGLKSELEKASAALGRSAIYLKESRINALPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPL LDV+DLCSDDL+K+LE PR+ LR++EGKK GL+ + KSS
Sbjct  312  FWKRESNQKAKILRKVDYPLVLDVYDLCSDDLKKKLEAPRQVLRNDEGKKFGLKVNEKSS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
              K+NDVKM+DA  SS+G   S  P  +EG   EKE  +TGIYDLVAVLTHKGRSADSGH
Sbjct  372  VRKENDVKMSDAEGSSNGGEPSVAPM-EEG---EKETQMTGIYDLVAVLTHKGRSADSGH  427

Query  565  YVAWVKQENGKWI  603
            YV WVKQENGKWI
Sbjct  428  YVGWVKQENGKWI  440



>gb|EPS62411.1| ubiquitin carboxyl-terminal hydrolase, partial [Genlisea aurea]
Length=481

 Score =   291 bits (746),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 171/192 (89%), Gaps = 4/192 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGL+ GL+SELEK+SPSLGRSAI+ KDSRI+GLPRYLT+QFVRFFWK
Sbjct  259  LKCHISQEVNHLHEGLRHGLRSELEKSSPSLGRSAIFTKDSRISGLPRYLTVQFVRFFWK  318

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELDV+D CS+DL+KRLE PR+ LRDEEGKKLGL+++ KSS+S 
Sbjct  319  RETNQKAKILRKVDYPLELDVYDFCSEDLKKRLELPRQILRDEEGKKLGLKSNEKSSTS-  377

Query  394  DNDVKMTDA--VesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHY  567
              DVKM DA  +    G+GESSK A +E V  +KE+HLTGIYDL+AVLTHKGRSADSGHY
Sbjct  378  -CDVKMADAEVLPPFGGAGESSKSASEEAVAADKERHLTGIYDLIAVLTHKGRSADSGHY  436

Query  568  VAWVKQENGKWI  603
            VAWVKQ+NGKW+
Sbjct  437  VAWVKQQNGKWV  448



>ref|XP_010528930.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Tarenaya 
hassleriana]
Length=480

 Score =   291 bits (746),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 164/192 (85%), Gaps = 7/192 (4%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GL+ ELEK SPSLGR+A+++K+SRI+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGLKHGLRGELEKTSPSLGRTALFIKESRIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELDV+DLCSDDLRK+LE PR+ LRDEEG+KLGLQ     +S+K
Sbjct  315  RETNQKAKILRKVDYPLELDVYDLCSDDLRKKLEAPRQKLRDEEGRKLGLQ-----TSAK  369

Query  394  DNDVKMTDAVesssgsgessKPAPQ--EGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHY  567
            DNDVKMTDA  SS+     S  A Q   G   EKE H+TGIYDLVAVLTHKGRSADSGHY
Sbjct  370  DNDVKMTDAEGSSNNGSGESSTANQMESGATLEKEAHMTGIYDLVAVLTHKGRSADSGHY  429

Query  568  VAWVKQENGKWI  603
            VAWVKQ++GKW+
Sbjct  430  VAWVKQDSGKWV  441



>ref|XP_004141674.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Cucumis 
sativus]
 ref|XP_004155940.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Cucumis 
sativus]
 gb|KGN45539.1| hypothetical protein Csa_7G451940 [Cucumis sativus]
Length=483

 Score =   291 bits (746),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 164/191 (86%), Gaps = 1/191 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHL EGLK GLKSE++K SPSLGRSAI++++SRIN LPRYLTIQFVRFFWK
Sbjct  254  LKCHISQEVNHLSEGLKHGLKSEIDKVSPSLGRSAIFIRESRINSLPRYLTIQFVRFFWK  313

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDVFDLCSDDLRK+LEGPR  LR+EEGKKLGL+   K+S S 
Sbjct  314  RESNQKAKILRKVDYPLELDVFDLCSDDLRKQLEGPRLLLRNEEGKKLGLKPKEKASDSA  373

Query  394  DNDVKMTDAVesssgsgessKPAPQE-GVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D DVKM+DA  +S+GS   S   PQE     +KE  +TGIYDLVAVLTHKGRSADSGHYV
Sbjct  374  DKDVKMSDAEGTSTGSEAQSSVTPQEDSPSSDKETQMTGIYDLVAVLTHKGRSADSGHYV  433

Query  571  AWVKQENGKWI  603
            AWVKQE+GKWI
Sbjct  434  AWVKQESGKWI  444



>ref|XP_006385327.1| UBIQUITIN-SPECIFIC PROTEASE 6 family protein [Populus trichocarpa]
 gb|ERP63124.1| UBIQUITIN-SPECIFIC PROTEASE 6 family protein [Populus trichocarpa]
Length=482

 Score =   291 bits (745),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEGLK GLKSELEKASPSLGRSAIYLK+S IN LPRYLT+QFVRFFWK
Sbjct  254  LKCHISQEVNHLHEGLKHGLKSELEKASPSLGRSAIYLKESCINALPRYLTVQFVRFFWK  313

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LDV+D CSDDLRK LE PR+ LRDEEGKK GL+A  KSSSSK
Sbjct  314  RESNQKAKILRKVDYPLQLDVYDFCSDDLRKNLEAPRQILRDEEGKKAGLKAKVKSSSSK  373

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            DND KMTD    S+ S +SS     EG   +KE HLTGIYDLVAVLTHKGRSADSGHYVA
Sbjct  374  DNDAKMTDVEGPSNESVKSSNSTSGEGGSSDKESHLTGIYDLVAVLTHKGRSADSGHYVA  433

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  434  WVKQESGKWI  443



>ref|XP_007135584.1| hypothetical protein PHAVU_010G141700g [Phaseolus vulgaris]
 gb|ESW07578.1| hypothetical protein PHAVU_010G141700g [Phaseolus vulgaris]
Length=480

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 166/190 (87%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEG+K+GLKSELEKASP+LGRSA YLK+SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGIKQGLKSELEKASPALGRSATYLKESRINALPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELDV+D CSDDLRK+L+ PR+ LR+EEGKKLGL+ + KSS+ K
Sbjct  315  RETNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQILRNEEGKKLGLKVNEKSSAQK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            +NDVKM+ A  S +G GESS     EG   EKE  +TGIYDLVAVLTHKGRSADSGHYV 
Sbjct  375  ENDVKMSAAEGSLNGEGESSVVPMDEG---EKEGQMTGIYDLVAVLTHKGRSADSGHYVG  431

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  432  WVKQENGKWI  441



>ref|XP_009367529.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X1 [Pyrus x bretschneideri]
Length=478

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 162/190 (85%), Gaps = 5/190 (3%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLKSELEK SPSLGRSAIY+K+S INGLPRYLTIQFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKSELEKNSPSLGRSAIYVKESLINGLPRYLTIQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPL+LD+FDLCSDDLRK LE PR+ LRDEEGKKLGL+ S KSS SK
Sbjct  315  RESNQKAKILRKVDYPLQLDIFDLCSDDLRKTLEAPRQRLRDEEGKKLGLKPSEKSSDSK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D D+KM+D   SS+ SGESS P   E         +TGIYDLVAVLTHKGRSADSGHYVA
Sbjct  375  DKDIKMSDVEGSSNRSGESSNPTSDEAA-----GAMTGIYDLVAVLTHKGRSADSGHYVA  429

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  430  WVKQESGKWI  439



>ref|XP_011463340.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 7 isoform X2 
[Fragaria vesca subsp. vesca]
Length=483

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            VHSLKCHIS EVNHLHEGLK GLKSELEK SP+LGRSA+Y+K+SRINGLPRYLTIQFVRF
Sbjct  250  VHSLKCHISHEVNHLHEGLKHGLKSELEKNSPALGRSAVYVKESRINGLPRYLTIQFVRF  309

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV+DLCS+DLRK+LE PRK LRDEEGKKLGL+ S KSS
Sbjct  310  FWKRESNQKAKILRKVDYPLELDVYDLCSEDLRKKLEVPRKTLRDEEGKKLGLKPSEKSS  369

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQE--GVLPEKEQHLTGIYDLVAVLTHKGRSADS  558
            SSKD D+ M+DA  +S+GSGE+S     E  GV PEKE  +TG+YDLVAVLTHKGRSADS
Sbjct  370  SSKDKDIMMSDAEGASNGSGETSNAMSVEVAGVQPEKEPQMTGVYDLVAVLTHKGRSADS  429

Query  559  GHYVAWVKQENGKWI  603
            GHYVAWVKQE+GKWI
Sbjct  430  GHYVAWVKQESGKWI  444



>gb|KHN11308.1| Ubiquitin carboxyl-terminal hydrolase 6 [Glycine soja]
Length=536

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 163/190 (86%), Gaps = 4/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEG+K GLKSELEKASP LGRSA YLK+SRIN LPRYLT+QFVRFFWK
Sbjct  312  LKCHISQEVNHLHEGIKHGLKSELEKASPVLGRSATYLKESRINALPRYLTVQFVRFFWK  371

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSDDLRK+L+ PR+ LR+EEGKKLGL+ + KSS  K
Sbjct  372  RESNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQILRNEEGKKLGLKVNEKSSVQK  431

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            ++DVKM+DA  S +G   S  P  +EG   EKE  +TGIYDLVAVLTHKGRSADSGHYV 
Sbjct  432  ESDVKMSDAEGSLNGGEPSVVPM-EEG---EKETQMTGIYDLVAVLTHKGRSADSGHYVG  487

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  488  WVKQENGKWI  497



>ref|XP_009107168.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Brassica 
rapa]
 emb|CDY46543.1| BnaA08g01820D [Brassica napus]
Length=483

 Score =   288 bits (738),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 164/193 (85%), Gaps = 6/193 (3%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+YLK+S I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYLKESLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD++DLCS+DLRK+LE PR+ LRDEEGKKLGLQ     SSSK
Sbjct  315  RETNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDEEGKKLGLQT---KSSSK  371

Query  394  DNDVKMTDAVesssgsgessKPAPQEGV---LPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            D DVKMTDA   S+ SGESS  A QEG      EK  H+TGIYDLV+VLTHKGRSADSGH
Sbjct  372  DGDVKMTDAEAPSNESGESSTAAQQEGAGGSSSEKGTHMTGIYDLVSVLTHKGRSADSGH  431

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  432  YVAWVKQESGKWI  444



>ref|XP_003529967.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X1 [Glycine max]
Length=480

 Score =   288 bits (738),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 165/190 (87%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEG+K GLKSELEKAS  LGRSAI+LK+SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISQEVNHLHEGIKHGLKSELEKASLVLGRSAIHLKESRINALPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSD+LRK+LE PR+ LR+EEGKKLGL+ + KSS  K
Sbjct  315  RESNQKAKILRKVDYPLELDVYDFCSDELRKKLEAPRQILRNEEGKKLGLKVNEKSSVQK  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            +NDVKM+DA  ++SG GE S    +EG   EKE  +TGIYDLVAVLTHKGRSADSGHYV 
Sbjct  375  ENDVKMSDAEGATSGGGEPSVVPMEEG---EKETQMTGIYDLVAVLTHKGRSADSGHYVG  431

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  432  WVKQENGKWI  441



>gb|AAG42752.1|AF302661_1 ubiquitin-specific protease 7 [Arabidopsis thaliana]
Length=477

 Score =   288 bits (738),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 5/193 (3%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V SLKCHIS EVNHLHEGLK GLK ELEK SPSLGR+A+Y+K+S I+ LPRYLT+QFVRF
Sbjct  251  VFSLKCHISHEVNHLHEGLKHGLKGELEKTSPSLGRTAVYVKESLIDSLPRYLTVQFVRF  310

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELD++DLCS+DLRK+LE PR+ LRD EG+KLGLQAS K S
Sbjct  311  FWKRESNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDIEGQKLGLQASAK-S  369

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK +DVKMTDA  SS+ SGESS    QEG  P    H+TGIYDLV+VLTHKGRSADSGH
Sbjct  370  SSKGDDVKMTDAEGSSNQSGESSTGDQQEGASP----HMTGIYDLVSVLTHKGRSADSGH  425

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKW+
Sbjct  426  YVAWVKQESGKWV  438



>sp|Q84WC6.1|UBP7_ARATH RecName: Full=Ubiquitin carboxyl-terminal hydrolase 7; AltName: 
Full=Deubiquitinating enzyme 7; Short=AtUBP7; AltName: Full=Ubiquitin 
thioesterase 7; AltName: Full=Ubiquitin-specific-processing 
protease 7 [Arabidopsis thaliana]
 gb|AAO42031.1| putative ubiquitin-specific protease 7 (UBP7) [Arabidopsis thaliana]
Length=477

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 5/193 (3%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V SLKCHIS EVNHLHEGLK GLK ELEK SPSLGR+A+Y+K+S I+ LPRYLT+QFVRF
Sbjct  251  VFSLKCHISHEVNHLHEGLKHGLKGELEKTSPSLGRTAVYVKESLIDSLPRYLTVQFVRF  310

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELD++DLCS+DLRK+LE PR+ LRD EG+KLGLQAS K S
Sbjct  311  FWKRESNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDIEGQKLGLQASAK-S  369

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK +DVKMTDA  SS+ SGESS    QEG  P    H+TGIYDLV+VLTHKGRSADSGH
Sbjct  370  SSKGDDVKMTDAEGSSNQSGESSTGDQQEGASP----HMTGIYDLVSVLTHKGRSADSGH  425

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKW+
Sbjct  426  YVAWVKQESGKWV  438



>ref|XP_006583027.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X2 [Glycine max]
Length=482

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 165/190 (87%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEG+K GLKSELEKAS  LGRSAI+LK+SRIN LPRYLT+QFVRFFWK
Sbjct  257  LKCHISQEVNHLHEGIKHGLKSELEKASLVLGRSAIHLKESRINALPRYLTVQFVRFFWK  316

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSD+LRK+LE PR+ LR+EEGKKLGL+ + KSS  K
Sbjct  317  RESNQKAKILRKVDYPLELDVYDFCSDELRKKLEAPRQILRNEEGKKLGLKVNEKSSVQK  376

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            +NDVKM+DA  ++SG GE S    +EG   EKE  +TGIYDLVAVLTHKGRSADSGHYV 
Sbjct  377  ENDVKMSDAEGATSGGGEPSVVPMEEG---EKETQMTGIYDLVAVLTHKGRSADSGHYVG  433

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  434  WVKQENGKWI  443



>dbj|BAB01721.1| ubiquitin specific protease; queuine tRNA-ribosyltransferase 
[Arabidopsis thaliana]
Length=520

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 5/193 (3%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V SLKCHIS EVNHLHEGLK GLK ELEK SPSLGR+A+Y+K+S I+ LPRYLT+QFVRF
Sbjct  294  VFSLKCHISHEVNHLHEGLKHGLKGELEKTSPSLGRTAVYVKESLIDSLPRYLTVQFVRF  353

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELD++DLCS+DLRK+LE PR+ LRD EG+KLGLQAS K S
Sbjct  354  FWKRESNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDIEGQKLGLQASAK-S  412

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK +DVKMTDA  SS+ SGESS    QEG  P    H+TGIYDLV+VLTHKGRSADSGH
Sbjct  413  SSKGDDVKMTDAEGSSNQSGESSTGDQQEGASP----HMTGIYDLVSVLTHKGRSADSGH  468

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKW+
Sbjct  469  YVAWVKQESGKWV  481



>gb|KHN39286.1| Ubiquitin carboxyl-terminal hydrolase 6 [Glycine soja]
Length=518

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 165/190 (87%), Gaps = 3/190 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEG+K GLKSELEKAS  LGRSAI+LK+SRIN LPRYLT+QFVRFFWK
Sbjct  293  LKCHISQEVNHLHEGIKHGLKSELEKASLVLGRSAIHLKESRINALPRYLTVQFVRFFWK  352

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSD+LRK+LE PR+ LR+EEGKKLGL+ + KSS  K
Sbjct  353  RESNQKAKILRKVDYPLELDVYDFCSDELRKKLEAPRQILRNEEGKKLGLKVNEKSSVQK  412

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            +NDVKM+DA  ++SG GE S    +EG   EKE  +TGIYDLVAVLTHKGRSADSGHYV 
Sbjct  413  ENDVKMSDAEGATSGGGEPSVVPMEEG---EKETQMTGIYDLVAVLTHKGRSADSGHYVG  469

Query  574  WVKQENGKWI  603
            WVKQENGKWI
Sbjct  470  WVKQENGKWI  479



>ref|NP_566680.2| ubiquitin-specific protease 7 [Arabidopsis thaliana]
 gb|AEE76487.1| ubiquitin-specific protease 7 [Arabidopsis thaliana]
Length=532

 Score =   288 bits (737),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 167/193 (87%), Gaps = 5/193 (3%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V SLKCHIS EVNHLHEGLK GLK ELEK SPSLGR+A+Y+K+S I+ LPRYLT+QFVRF
Sbjct  306  VFSLKCHISHEVNHLHEGLKHGLKGELEKTSPSLGRTAVYVKESLIDSLPRYLTVQFVRF  365

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELD++DLCS+DLRK+LE PR+ LRD EG+KLGLQAS K S
Sbjct  366  FWKRESNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDIEGQKLGLQASAK-S  424

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK +DVKMTDA  SS+ SGESS    QEG  P    H+TGIYDLV+VLTHKGRSADSGH
Sbjct  425  SSKGDDVKMTDAEGSSNQSGESSTGDQQEGASP----HMTGIYDLVSVLTHKGRSADSGH  480

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKW+
Sbjct  481  YVAWVKQESGKWV  493



>ref|XP_009147740.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Brassica 
rapa]
 emb|CDY22862.1| BnaA06g02150D [Brassica napus]
Length=481

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 164/191 (86%), Gaps = 4/191 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+YLK+S I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYLKESLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD+FDLCS++LRK+LE PR+ LRDEEGKKLGLQ     SSSK
Sbjct  315  RETNQKAKILRKVDYPLELDIFDLCSEELRKKLEAPRQKLRDEEGKKLGLQP---KSSSK  371

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQ-HLTGIYDLVAVLTHKGRSADSGHYV  570
            D+DVKMTDA  SS  SGESS    QEG   EK   H+TGIYDLV+VLTHKGRSADSGHYV
Sbjct  372  DSDVKMTDAEASSKESGESSTVTQQEGGSSEKGTLHMTGIYDLVSVLTHKGRSADSGHYV  431

Query  571  AWVKQENGKWI  603
            AWVKQE+GKWI
Sbjct  432  AWVKQESGKWI  442



>emb|CDY52954.1| BnaC03g77920D [Brassica napus]
Length=566

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 164/191 (86%), Gaps = 4/191 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+YLK+S I+ LPRYLT+QFVRFFWK
Sbjct  340  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYLKESLIDSLPRYLTVQFVRFFWK  399

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD++DLCS++LRK+LE PR+ LRDEEGKKLGLQ     SSSK
Sbjct  400  RETNQKAKILRKVDYPLELDIYDLCSEELRKKLEAPRQKLRDEEGKKLGLQT---KSSSK  456

Query  394  DNDVKMTDAVesssgsgessKPAPQEGV-LPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D DVKMTDA   S+ SGESS  A QEG    EK  H+TGIYDLV+VLTHKGRSADSGHYV
Sbjct  457  DGDVKMTDAEAPSNESGESSTAAQQEGASSSEKGTHMTGIYDLVSVLTHKGRSADSGHYV  516

Query  571  AWVKQENGKWI  603
            AWVKQE+GKWI
Sbjct  517  AWVKQESGKWI  527



>ref|XP_006585534.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
7-like [Glycine max]
Length=537

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 161/189 (85%), Gaps = 4/189 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHISQEVNHLHEG+K GLKSELEKASP LGRSA YLK+SRIN LPRYLT+QFVRFFWK
Sbjct  312  LKCHISQEVNHLHEGIKHGLKSELEKASPVLGRSATYLKESRINALPRYLTVQFVRFFWK  371

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSDDLRK+L+ PR+ LR+EEGKKLGL+ + KSS  K
Sbjct  372  RESNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQILRNEEGKKLGLKVNEKSSVQK  431

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            ++DVKM+DA  S +G   S  P  +EG   EKE  +TGIYDLVAVLTHKGRSADSGHYV 
Sbjct  432  ESDVKMSDAEGSLNGGEPSVVPM-EEG---EKETQMTGIYDLVAVLTHKGRSADSGHYVG  487

Query  574  WVKQENGKW  600
            WVKQENG +
Sbjct  488  WVKQENGSF  496



>emb|CDY33876.1| BnaC06g04770D [Brassica napus]
Length=481

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 163/191 (85%), Gaps = 4/191 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+YLK+S I+ LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTALYLKESLIDSLPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD+FDLCS++LRK+LE PR+ LRDEEGKKLGLQ     S+SK
Sbjct  315  RETNQKAKILRKVDYPLELDIFDLCSEELRKKLEAPRQKLRDEEGKKLGLQP---KSTSK  371

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQ-HLTGIYDLVAVLTHKGRSADSGHYV  570
            D+DVKMTDA  SS  SGESS     EG   EK   H+TGIYDLV+VLTHKGRSADSGHYV
Sbjct  372  DSDVKMTDAEASSKESGESSTVTQPEGGSSEKGTLHMTGIYDLVSVLTHKGRSADSGHYV  431

Query  571  AWVKQENGKWI  603
            AWVKQE+GKWI
Sbjct  432  AWVKQESGKWI  442



>ref|XP_006426475.1| hypothetical protein CICLE_v10025482mg [Citrus clementina]
 gb|ESR39715.1| hypothetical protein CICLE_v10025482mg [Citrus clementina]
Length=487

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 165/197 (84%), Gaps = 4/197 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            +++LKCHIS EVNHLHEGLK GLKSELEKASP+LGRSA+YLK+S INGLPRYLTIQFVRF
Sbjct  252  IYALKCHISHEVNHLHEGLKHGLKSELEKASPALGRSAVYLKESCINGLPRYLTIQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD-EEGKKLGLQASGKS  381
            FWKRESNQKAKILRKVDYPLELDV+D CSDDLRK+L+ PR+ LRD E  K    +   KS
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYDFCSDDLRKKLDAPRQKLRDEEGKKLGLKKGGEKS  371

Query  382  SSSKDNDVKMTDAVesssgsgessKPA-PQEGVL--PEKEQHLTGIYDLVAVLTHKGRSA  552
            S+SKDNDVKMT+A  S+S     S  A  Q+GV    +KE HLTGIYDLVAVLTHKGRSA
Sbjct  372  SNSKDNDVKMTEAEGSASNGSGESSVASSQDGVTTDTDKETHLTGIYDLVAVLTHKGRSA  431

Query  553  DSGHYVAWVKQENGKWI  603
            DSGHYVAWVKQE+GKWI
Sbjct  432  DSGHYVAWVKQESGKWI  448



>ref|XP_006406291.1| hypothetical protein EUTSA_v10020636mg [Eutrema salsugineum]
 gb|ESQ47744.1| hypothetical protein EUTSA_v10020636mg [Eutrema salsugineum]
Length=477

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 162/190 (85%), Gaps = 5/190 (3%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+Y+K+S I+ LPRYLT+QFVRFFWK
Sbjct  254  LKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYIKESLIDSLPRYLTVQFVRFFWK  313

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELD+FDLCS+DLRK+LE PR+ LRD EG+K GLQ S K SSSK
Sbjct  314  RESNQKAKILRKVDYPLELDIFDLCSEDLRKKLEAPRQKLRDIEGQKFGLQTSAK-SSSK  372

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
             +DVKMTDA  SSSGSG+SS    Q G       H+TGIYDLV+VLTHKGRSADSGHYVA
Sbjct  373  GDDVKMTDAEGSSSGSGQSSTGDQQGGA----SSHMTGIYDLVSVLTHKGRSADSGHYVA  428

Query  574  WVKQENGKWI  603
            WVKQE+GKW+
Sbjct  429  WVKQESGKWV  438



>ref|XP_002885433.1| ubiquitin carboxyl-terminal hydrolase 7 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61692.1| ubiquitin carboxyl-terminal hydrolase 7 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 5/193 (3%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V SLKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+Y+K+S I+ LPRYLT+QFVRF
Sbjct  251  VFSLKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYIKESLIDSLPRYLTVQFVRF  310

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV+DLCS+DLRK+L+ PR+ LRD EG+KLGLQAS K S
Sbjct  311  FWKRESNQKAKILRKVDYPLELDVYDLCSEDLRKKLKAPRQKLRDIEGQKLGLQASAK-S  369

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK +DVKMTDA  SS+GSGE S      G       H+TGIYDLV+VLTHKGRSADSGH
Sbjct  370  SSKGDDVKMTDAEGSSNGSGELSSGDQPGGA----SSHMTGIYDLVSVLTHKGRSADSGH  425

Query  565  YVAWVKQENGKWI  603
            YV+WVKQE+GKW+
Sbjct  426  YVSWVKQESGKWV  438



>ref|XP_006393005.1| hypothetical protein EUTSA_v10011383mg [Eutrema salsugineum]
 gb|ESQ30291.1| hypothetical protein EUTSA_v10011383mg [Eutrema salsugineum]
Length=521

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 160/190 (84%), Gaps = 11/190 (6%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS E          GLK ELEK SP+LGRSA+YLK+S I+ LPRYLT+QFVRFFWK
Sbjct  304  LKCHISHE----------GLKGELEKTSPALGRSALYLKESLIDSLPRYLTVQFVRFFWK  353

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RE+NQKAKILRKVDYPLELD++DLCS+DLRK+LE PR+ LRDEEGKKLGLQ S K SS+K
Sbjct  354  RETNQKAKILRKVDYPLELDIYDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTSAK-SSAK  412

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+DVKMTDA  SS GSGESS   PQEG   EKE H+TGIYDLV+VLTHKGRSADSGHYVA
Sbjct  413  DSDVKMTDAEASSHGSGESSTVTPQEGASSEKETHMTGIYDLVSVLTHKGRSADSGHYVA  472

Query  574  WVKQENGKWI  603
            WVKQE+GKWI
Sbjct  473  WVKQESGKWI  482



>gb|ABK24394.1| unknown [Picea sitchensis]
Length=480

 Score =   273 bits (698),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 157/193 (81%), Gaps = 1/193 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHIS EVNHLHEGLK GLKSELEK SP LGRSA+YLK+SRIN LP YLTIQFVRF
Sbjct  249  VYSLKCHISHEVNHLHEGLKHGLKSELEKVSPVLGRSAVYLKESRINTLPNYLTIQFVRF  308

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKV+YP+ELDV D CSD+LR++L+ PR+ LRD+E  K GL+  G  S
Sbjct  309  FWKRESNQKAKILRKVNYPIELDVLDFCSDELREKLKEPRQILRDQENTKFGLK-KGNQS  367

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
             SKD DV+M++A  S S S ESS       +  +K+   TGIYDLVAVLTHKGRSADSGH
Sbjct  368  DSKDKDVEMSNAEVSLSTSCESSNSNAAGAMDIQKQAQFTGIYDLVAVLTHKGRSADSGH  427

Query  565  YVAWVKQENGKWI  603
            YVAWVKQENGKWI
Sbjct  428  YVAWVKQENGKWI  440



>ref|XP_008797867.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X2 
[Phoenix dactylifera]
Length=439

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V++LKCHISQ+VNHLHEGLK GLKSELEK SPSLGRSAIY K+SRIN LPRYLT+QFVRF
Sbjct  208  VYALKCHISQDVNHLHEGLKHGLKSELEKVSPSLGRSAIYSKESRINDLPRYLTVQFVRF  267

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+LR++L+ PR+ LR+ E  KLGL+   K+S
Sbjct  268  FWKRESNQKAKILRKVDYPLELDVYEFCSDELRQKLQAPRQTLRELENAKLGLKTQDKNS  327

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
             SK+ND  +  +   S  SGE S    ++    EK+  LTGIYDLVAVLTHKGRSADSGH
Sbjct  328  GSKENDANIPKSEGPSDNSGEPSAITHEKATSSEKKVQLTGIYDLVAVLTHKGRSADSGH  387

Query  565  YVAWVKQENGKWI  603
            YV WVKQE+GKWI
Sbjct  388  YVGWVKQESGKWI  400



>ref|XP_006853983.1| hypothetical protein AMTR_s00036p00226440 [Amborella trichopoda]
 gb|ERN15450.1| hypothetical protein AMTR_s00036p00226440 [Amborella trichopoda]
Length=475

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 159/193 (82%), Gaps = 8/193 (4%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V++LKCHISQEVNHLHEGLK GLKSELEK SP+LGRSA+YLK+S IN LPRYLT+QFVRF
Sbjct  252  VYALKCHISQEVNHLHEGLKHGLKSELEKVSPALGRSAVYLKESCINDLPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDVFDLCS+ L+ +L+ PR+ LRDEEG KLGL    K +
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVFDLCSESLKSKLQTPRQILRDEEGAKLGL----KKN  367

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
             SKD + +       ++ +G+SS  A     L EKE H+TGIYDLVAVLTHKGRSADSGH
Sbjct  368  ESKDKEAQTPKTEVGANENGQSSTGA----ALEEKEMHMTGIYDLVAVLTHKGRSADSGH  423

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  424  YVAWVKQESGKWI  436



>ref|XP_008797866.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 isoform X1 
[Phoenix dactylifera]
Length=483

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V++LKCHISQ+VNHLHEGLK GLKSELEK SPSLGRSAIY K+SRIN LPRYLT+QFVRF
Sbjct  252  VYALKCHISQDVNHLHEGLKHGLKSELEKVSPSLGRSAIYSKESRINDLPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+LR++L+ PR+ LR+ E  KLGL+   K+S
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYEFCSDELRQKLQAPRQTLRELENAKLGLKTQDKNS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
             SK+ND  +  +   S  SGE S    ++    EK+  LTGIYDLVAVLTHKGRSADSGH
Sbjct  372  GSKENDANIPKSEGPSDNSGEPSAITHEKATSSEKKVQLTGIYDLVAVLTHKGRSADSGH  431

Query  565  YVAWVKQENGKWI  603
            YV WVKQE+GKWI
Sbjct  432  YVGWVKQESGKWI  444



>ref|XP_010912089.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X2 [Elaeis guineensis]
Length=483

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V++LKCHISQ+VNHLHEGLKRGLKSELEK SPSLGR+AIY K+SRI+ LPRYLT+QFVRF
Sbjct  252  VYALKCHISQDVNHLHEGLKRGLKSELEKVSPSLGRTAIYSKESRISDLPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+LR++L+ PR+ LR+ E  KLGL+A  K++
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYEFCSDELRQKLQAPRQTLRELENAKLGLKAQDKNN  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK+N+  +  +   S  SGE S    +     +K+  LTGIYDLVAVLTHKGRSADSGH
Sbjct  372  SSKENEANIPKSEGPSGNSGEPSAITHEAATSSDKKVQLTGIYDLVAVLTHKGRSADSGH  431

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  432  YVAWVKQESGKWI  444



>ref|XP_010912082.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like isoform 
X1 [Elaeis guineensis]
Length=497

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V++LKCHISQ+VNHLHEGLKRGLKSELEK SPSLGR+AIY K+SRI+ LPRYLT+QFVRF
Sbjct  266  VYALKCHISQDVNHLHEGLKRGLKSELEKVSPSLGRTAIYSKESRISDLPRYLTVQFVRF  325

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+LR++L+ PR+ LR+ E  KLGL+A  K++
Sbjct  326  FWKRESNQKAKILRKVDYPLELDVYEFCSDELRQKLQAPRQTLRELENAKLGLKAQDKNN  385

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK+N+  +  +   S  SGE S    +     +K+  LTGIYDLVAVLTHKGRSADSGH
Sbjct  386  SSKENEANIPKSEGPSGNSGEPSAITHEAATSSDKKVQLTGIYDLVAVLTHKGRSADSGH  445

Query  565  YVAWVKQENGKWI  603
            YVAWVKQE+GKWI
Sbjct  446  YVAWVKQESGKWI  458



>ref|XP_004968945.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Setaria 
italica]
Length=478

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 163/194 (84%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+S+KCHISQ+VNHLHEGLK GLK+ELEK SP+LGR+AIY ++SRIN LPRYLT+QFVR
Sbjct  251  SVYSMKCHISQDVNHLHEGLKHGLKTELEKVSPALGRTAIYTRESRINELPRYLTVQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV++ CSD+L+++L+ PR+ LRD E  K GL+  GK+
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYEFCSDELKQKLQAPRQMLRDAENAKFGLKTQGKA  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            SSSK+N+   + A +SSS   + + P+     +P+K+  LTG+YDLVAVLTHKGRSADSG
Sbjct  371  SSSKENEGSSSSAGDSSSMDIDKADPS-----VPKKQ--LTGVYDLVAVLTHKGRSADSG  423

Query  562  HYVAWVKQENGKWI  603
            HYV WVKQ+NGKWI
Sbjct  424  HYVGWVKQDNGKWI  437



>ref|NP_001043299.1| Os01g0550100 [Oryza sativa Japonica Group]
 dbj|BAD88057.1| putative ubiquitin-specific protease 6 [Oryza sativa Japonica 
Group]
 dbj|BAD88117.1| putative ubiquitin-specific protease 6 [Oryza sativa Japonica 
Group]
 dbj|BAF05213.1| Os01g0550100 [Oryza sativa Japonica Group]
 dbj|BAG89879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 164/194 (85%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHIS +VNHLHEGLK GLKSELEKASPSLGR+A+Y ++SRIN LPRYLT+QFVR
Sbjct  251  SVYSLKCHISHDVNHLHEGLKHGLKSELEKASPSLGRTALYTRESRINELPRYLTVQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+D CSD+L+++L+ PR+ LRD E  K GL+A GK+
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYDFCSDELKQKLQAPRQMLRDAENAKFGLKAQGKA  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            SSSK+N+   ++A ESSS   + +     +  +P+K  HLTGIYDL+AVLTHKGRSADSG
Sbjct  371  SSSKENEGSSSNAGESSSMDIDKA-----DSSVPKK--HLTGIYDLIAVLTHKGRSADSG  423

Query  562  HYVAWVKQENGKWI  603
            HYV WVKQ++GKWI
Sbjct  424  HYVGWVKQDDGKWI  437



>ref|XP_003638631.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula]
Length=280

 Score =   261 bits (666),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 156/185 (84%), Gaps = 5/185 (3%)
 Frame = +1

Query  49   SQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWKRESNQ  228
            +Q ++HL      GLKSELEKAS +LGRSAIYLK+SRIN LPRYLT+QFVRFFWKRESNQ
Sbjct  62   TQLISHLPS--IHGLKSELEKASAALGRSAIYLKESRINALPRYLTVQFVRFFWKRESNQ  119

Query  229  KAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSKDNDVK  408
            KAKILRKVDYPLELDV+DLCSDDL+K+LE PRK LRDEEGKKLGL+ + KSS  K+NDVK
Sbjct  120  KAKILRKVDYPLELDVYDLCSDDLKKKLEAPRKFLRDEEGKKLGLKVNEKSSVPKENDVK  179

Query  409  MTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVAWVKQE  588
            M+DA  SS+G GE S    +EG   EKE  +TG+YDLVAVLTHKGRSADSGHYV WVKQE
Sbjct  180  MSDAEGSSNGGGEPSVAPMEEG---EKETQMTGVYDLVAVLTHKGRSADSGHYVGWVKQE  236

Query  589  NGKWI  603
            NGKWI
Sbjct  237  NGKWI  241



>tpg|DAA59027.1| TPA: hypothetical protein ZEAMMB73_534205 [Zea mays]
Length=483

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 162/194 (84%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHISQ+VNHLHEG+K GLK+ELEKASP+LGR+A+Y ++SRIN LPRYLT+QFVR
Sbjct  251  SVYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINELPRYLTVQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV++ CSD+L+++L+ PR+ LRD E  K GL+A GK+
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYEFCSDELKQKLQAPRQMLRDAENAKFGLKAQGKA  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            S  K+N+   + A ESSS   + +     E  LP+K+  LTG+YDLVAVLTHKGRSADSG
Sbjct  371  SGFKENEGSSSSAGESSSMDIDKA-----ESSLPKKQ--LTGVYDLVAVLTHKGRSADSG  423

Query  562  HYVAWVKQENGKWI  603
            HYV WVKQ++GKWI
Sbjct  424  HYVGWVKQDDGKWI  437



>ref|XP_006644280.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Oryza 
brachyantha]
Length=474

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 161/194 (83%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHIS +VNHLHEGLK GLKSELEKASPSLGR+A+Y ++SRI+ LPRYLT+QFVR
Sbjct  251  SVYSLKCHISHDVNHLHEGLKHGLKSELEKASPSLGRTALYTRESRIDELPRYLTVQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+D CSD+L+++L+ PR+ LRD E  K GL+  GK+
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYDFCSDELKQKLQAPRQMLRDVENAKFGLKVQGKA  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            SSS +N+   ++A ESS    + +     +  +P+K+  LTGIYDL+AVLTHKGRSADSG
Sbjct  371  SSSTENEGSSSNAGESSGMDIDKA-----DSSVPKKQ--LTGIYDLIAVLTHKGRSADSG  423

Query  562  HYVAWVKQENGKWI  603
            HYV WVKQ++GKWI
Sbjct  424  HYVGWVKQDDGKWI  437



>ref|NP_001148768.1| ubiquitin carboxyl-terminal hydrolase 6 [Zea mays]
 gb|ACG32838.1| ubiquitin carboxyl-terminal hydrolase 6 [Zea mays]
 gb|ACN26950.1| unknown [Zea mays]
 tpg|DAA59026.1| TPA: ubiquitin carboxyl-terminal hydrolase [Zea mays]
Length=478

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 162/194 (84%), Gaps = 7/194 (4%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHISQ+VNHLHEG+K GLK+ELEKASP+LGR+A+Y ++SRIN LPRYLT+QFVR
Sbjct  251  SVYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINELPRYLTVQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV++ CSD+L+++L+ PR+ LRD E  K GL+A GK+
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYEFCSDELKQKLQAPRQMLRDAENAKFGLKAQGKA  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            S  K+N+   + A ESSS   + +     E  LP+K+  LTG+YDLVAVLTHKGRSADSG
Sbjct  371  SGFKENEGSSSSAGESSSMDIDKA-----ESSLPKKQ--LTGVYDLVAVLTHKGRSADSG  423

Query  562  HYVAWVKQENGKWI  603
            HYV WVKQ++GKWI
Sbjct  424  HYVGWVKQDDGKWI  437



>ref|XP_002455783.1| hypothetical protein SORBIDRAFT_03g025180 [Sorghum bicolor]
 gb|EES00903.1| hypothetical protein SORBIDRAFT_03g025180 [Sorghum bicolor]
Length=477

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 160/193 (83%), Gaps = 8/193 (4%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQ+VNHLHEG+K GLK+ELEKASP+LGR+A+Y ++SRIN LPRYLT+QFVRF
Sbjct  252  VYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINELPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+L+++L+ PR+ LRD E  K GL+A GK+S
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYEFCSDELKQKLQAPRQMLRDAENAKFGLKAHGKAS  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK+N+   +    SS    ++      E  LP+K+  LTG+YDLVAVLTHKGRSADSGH
Sbjct  372  SSKENEESSSAGESSSMDIDKA------ESSLPKKQ--LTGVYDLVAVLTHKGRSADSGH  423

Query  565  YVAWVKQENGKWI  603
            YV WVKQ++GKWI
Sbjct  424  YVGWVKQDDGKWI  436



>ref|XP_010231906.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6 [Brachypodium 
distachyon]
Length=473

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 156/194 (80%), Gaps = 8/194 (4%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHIS EVNHLHEGLK GLK+ELEK SP+LGR+AIY ++SRIN LPRYLT+QFVR
Sbjct  251  SVYSLKCHISHEVNHLHEGLKHGLKTELEKVSPTLGRTAIYTRESRINELPRYLTVQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+D CSD+L+++L+ PR+ LRD E  K GL+  GK+
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYDFCSDELKQKLQAPRQVLRDAENAKFGLKVQGKT  370

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            SSSKD     +    SS    ++      +  LP+K+  LTGIYDL+AVLTHKGRSADSG
Sbjct  371  SSSKDEGSSSSAGESSSMDIDKA------DSSLPKKQ--LTGIYDLIAVLTHKGRSADSG  422

Query  562  HYVAWVKQENGKWI  603
            HYV WVKQ++GKWI
Sbjct  423  HYVGWVKQDDGKWI  436



>ref|XP_009410802.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 6-like [Musa 
acuminata subsp. malaccensis]
Length=478

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V++LKCHISQ++NHLHEGL+RGLKSELEK S SLGRSA++ K+S I+ LPRYLT+QFVRF
Sbjct  252  VYALKCHISQDINHLHEGLRRGLKSELEKMSTSLGRSAVFSKESCISELPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+LR++L+ PR+ LR+ E  KLGL+   K  
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYEFCSDELRQKLQTPRQTLRELENVKLGLKVEDK--  369

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
              K+++V M  +  SS+ S E S  A  + V  E +  LTGIYDLVAVLTHKGRSADSGH
Sbjct  370  -KKEHEVNMPTSEGSSNDSSEPSSMALDKAVSSEDKGQLTGIYDLVAVLTHKGRSADSGH  428

Query  565  YVAWVKQENGKWI  603
            YVAWVKQENGKWI
Sbjct  429  YVAWVKQENGKWI  441



>dbj|BAJ94932.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 151/190 (79%), Gaps = 7/190 (4%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS EVNHLHEGLK GLK+ELEK SPSLGR+AIY ++SRIN LPRYLT+QFVRFFWK
Sbjct  255  LKCHISHEVNHLHEGLKHGLKTELEKVSPSLGRTAIYTRESRINELPRYLTVQFVRFFWK  314

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            RESNQKAKILRKVDYPLELDV+D CSD+L+ +L+ PR+ LRD E  K GL+   K+SSS+
Sbjct  315  RESNQKAKILRKVDYPLELDVYDFCSDELKLKLQTPRQVLRDAESAKFGLKVQVKTSSSQ  374

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            +      +   +S+G   S      +  +P+K+  LTGIYDL+AVLTHKGRSADSGHYV 
Sbjct  375  N-----IEGSSTSAGESSSMDIDKADSSVPKKQ--LTGIYDLIAVLTHKGRSADSGHYVG  427

Query  574  WVKQENGKWI  603
            WVKQ++GKWI
Sbjct  428  WVKQDDGKWI  437



>ref|XP_008656578.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
6-like [Zea mays]
Length=477

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 162/193 (84%), Gaps = 8/193 (4%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQ+VNHLHEG+K GLK+ELEKASP+LGR+A+Y ++SRIN LPRYLT+QFVRF
Sbjct  252  VYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINELPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+L+K+L+ PR+ LRD E  KLGL   GK+S
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYEFCSDELKKKLKAPRQMLRDAENAKLGL-XHGKAS  370

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SSK+N+   + A ESSS   + +     E  LP+K+  LTG+YDLVAVLTHKGRSADSGH
Sbjct  371  SSKENEESSSSAGESSSMDIDKA-----ESSLPKKQ--LTGVYDLVAVLTHKGRSADSGH  423

Query  565  YVAWVKQENGKWI  603
            YV WVKQ++GKWI
Sbjct  424  YVGWVKQDDGKWI  436



>gb|EEE54783.1| hypothetical protein OsJ_02180 [Oryza sativa Japonica Group]
Length=443

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 144/194 (74%), Gaps = 38/194 (20%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHIS +VNHLHEGLK GLKSELEKASPSLGR+A+Y ++        YLT+QFVR
Sbjct  251  SVYSLKCHISHDVNHLHEGLKHGLKSELEKASPSLGRTALYTRE--------YLTVQFVR  302

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+D CSD+L+++L+ PR+ LRD E  K GL+A GK+
Sbjct  303  FFWKRESNQKAKILRKVDYPLELDVYDFCSDELKQKLQAPRQMLRDAENAKFGLKAQGKA  362

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            SSSK+N                              E+HLTGIYDL+AVLTHKGRSADSG
Sbjct  363  SSSKEN------------------------------EKHLTGIYDLIAVLTHKGRSADSG  392

Query  562  HYVAWVKQENGKWI  603
            HYV WVKQ++GKWI
Sbjct  393  HYVGWVKQDDGKWI  406



>gb|EEC70862.1| hypothetical protein OsI_02374 [Oryza sativa Indica Group]
Length=478

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 143/194 (74%), Gaps = 38/194 (20%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHIS +VNHLHEGLK GLKSELEKASPSLGR+A+Y ++        YLT+QFVR
Sbjct  286  SVYSLKCHISHDVNHLHEGLKHGLKSELEKASPSLGRTALYTRE--------YLTVQFVR  337

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            FFWKRESNQKAKILRKVDYPLELDV+D CSD+L+++L+ PR+ LRD E  K GL+A GK+
Sbjct  338  FFWKRESNQKAKILRKVDYPLELDVYDFCSDELKQKLQAPRQMLRDAENAKFGLKAQGKA  397

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            SSSK+N                              E+ LTGIYDL+AVLTHKGRSADSG
Sbjct  398  SSSKEN------------------------------EKQLTGIYDLIAVLTHKGRSADSG  427

Query  562  HYVAWVKQENGKWI  603
            HYV WVKQ++GKWI
Sbjct  428  HYVGWVKQDDGKWI  441



>gb|AFW82988.1| hypothetical protein ZEAMMB73_925418 [Zea mays]
Length=616

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 155/237 (65%), Gaps = 44/237 (19%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQ+VNHLHEG+K GLK+ELEKASP+LGR+A+Y ++SRIN LPRYLT+QFVRF
Sbjct  339  VYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINELPRYLTVQFVRF  398

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+L+K+L+ PR+ LRD E  KLGL     ++
Sbjct  399  FWKRESNQKAKILRKVDYPLELDVYEFCSDELKKKLKAPRQMLRDAENAKLGLYMGKLAA  458

Query  385  SSKDNDVK----------MTDAVesssgsgessKPAPQEGVL------PEK---------  489
              K    +          +T A      S  +  P  Q   L      P+K         
Sbjct  459  QKKMRSHQVALGNRLVWTLTKASCLFLPSFCNDTPYCQTSFLGIIFLGPKKFHPLSLMIR  518

Query  490  -------------------EQHLTGIYDLVAVLTHKGRSADSGHYVAWVKQENGKWI  603
                               ++ LTG+YDLVAVLTHKGRSADSGHYV WVKQ++GKWI
Sbjct  519  NTISKRFARVLNAAESSLPKKQLTGVYDLVAVLTHKGRSADSGHYVGWVKQDDGKWI  575



>ref|XP_002986111.1| hypothetical protein SELMODRAFT_157786 [Selaginella moellendorffii]
 gb|EFJ12930.1| hypothetical protein SELMODRAFT_157786 [Selaginella moellendorffii]
Length=466

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 142/194 (73%), Gaps = 23/194 (12%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQ+VNHL+EGLK+GLKSELEK SPSLGRSA++ K+S I  LP+YLT+QFVRF
Sbjct  255  VYSLKCHISQDVNHLNEGLKQGLKSELEKTSPSLGRSAVHSKESVITRLPQYLTVQFVRF  314

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRE+ QKAKILRKVDYPL LDV   CS+DL+  L+ PR+ LR++E ++ GL+  GK  
Sbjct  315  FWKRETKQKAKILRKVDYPLVLDVMGFCSEDLKNELKAPRELLREQEDREAGLK--GKR-  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQ-HLTGIYDLVAVLTHKGRSADSG  561
                   K+ D             PAP        EQ   TGIYDLVAVLTHKGRSADSG
Sbjct  372  -------KIEDG------------PAPSSMDWSTTEQGSPTGIYDLVAVLTHKGRSADSG  412

Query  562  HYVAWVKQENGKWI  603
            HYVAWVKQENGKWI
Sbjct  413  HYVAWVKQENGKWI  426



>ref|XP_002989662.1| hypothetical protein SELMODRAFT_184724 [Selaginella moellendorffii]
 gb|EFJ09332.1| hypothetical protein SELMODRAFT_184724 [Selaginella moellendorffii]
Length=466

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 142/194 (73%), Gaps = 23/194 (12%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQ+VNHL+EGLK+GLKSELEK SPSLGRSA++ K+S I  LP+YLT+QFVRF
Sbjct  255  VYSLKCHISQDVNHLNEGLKQGLKSELEKTSPSLGRSAVHSKESVITRLPQYLTVQFVRF  314

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRE+ QKAKILRKVDYPL LDV   CS++L+  L+ PR+ LR++E ++ GL+  GK  
Sbjct  315  FWKRETKQKAKILRKVDYPLVLDVMGFCSEELKNELKAPRELLREQEDREAGLK--GKR-  371

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQ-HLTGIYDLVAVLTHKGRSADSG  561
                   K+ D             PAP        EQ   TGIYDLVAVLTHKGRSADSG
Sbjct  372  -------KIEDG------------PAPSSMDWSTTEQGSPTGIYDLVAVLTHKGRSADSG  412

Query  562  HYVAWVKQENGKWI  603
            HYVAWVKQENGKWI
Sbjct  413  HYVAWVKQENGKWI  426



>ref|XP_006297746.1| hypothetical protein CARUB_v10013781mg, partial [Capsella rubella]
 gb|EOA30644.1| hypothetical protein CARUB_v10013781mg, partial [Capsella rubella]
Length=424

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V SLKCHIS EVNHLHEGLK GLK ELEK SP+LGR+A+Y+KDS I+ LPRYLTIQFVRF
Sbjct  237  VFSLKCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYIKDSLIDSLPRYLTIQFVRF  296

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELD++DLCS+DL+K+LE PR+ LRD EG+KLGLQAS K S
Sbjct  297  FWKRESNQKAKILRKVDYPLELDIYDLCSEDLKKKLEAPRQKLRDIEGQKLGLQASAK-S  355

Query  385  SSKDNDVKMTDA  420
            S K +DVKMTDA
Sbjct  356  SLKGDDVKMTDA  367



>ref|XP_001760451.1| predicted protein [Physcomitrella patens]
 gb|EDQ74842.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 145/209 (69%), Gaps = 25/209 (12%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
             V SLKCHISQEVNHLH+GLK GLK ELEK SP LGRSA+++K+S I  LP+YLTIQFVR
Sbjct  254  TVFSLKCHISQEVNHLHDGLKHGLKGELEKTSPLLGRSALFIKESHIQKLPQYLTIQFVR  313

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRK----------ALRDEEGK  351
            FFWKRESNQKAKILRKV YPL LDV D C+++L+++L  PR+           L+ +E  
Sbjct  314  FFWKRESNQKAKILRKVGYPLVLDVLDFCTEELKEKLVEPRRRQFAAEEVKAGLKKDEKG  373

Query  352  KLGLQA-----SGKSSSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYD  516
            K+G +      +   S  K++D+  TD   +SS +      A  E         ++GIYD
Sbjct  374  KVGAEGVKSLETSTLSERKEHDMD-TDGSATSSTTKSDGSGAATE---------VSGIYD  423

Query  517  LVAVLTHKGRSADSGHYVAWVKQENGKWI  603
            LVAVLTHKGRSADSGHYV+WVKQ+NGKWI
Sbjct  424  LVAVLTHKGRSADSGHYVSWVKQDNGKWI  452



>gb|AFW82989.1| hypothetical protein ZEAMMB73_925418 [Zea mays]
Length=401

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 109/123 (89%), Gaps = 1/123 (1%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHISQ+VNHLHEG+K GLK+ELEKASP+LGR+A+Y ++SRIN LPRYLT+QFVRF
Sbjct  252  VYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINELPRYLTVQFVRF  311

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            FWKRESNQKAKILRKVDYPLELDV++ CSD+L+K+L+ PR+ LRD E  KLGL   GK +
Sbjct  312  FWKRESNQKAKILRKVDYPLELDVYEFCSDELKKKLKAPRQMLRDAENAKLGLYM-GKLA  370

Query  385  SSK  393
            + K
Sbjct  371  AQK  373



>emb|CDY32369.1| BnaC01g36880D [Brassica napus]
Length=482

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 133/194 (69%), Gaps = 29/194 (15%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V  L C IS E          GLK +LEK S +LGR+A +  +S I+ LPRYLT +F+R
Sbjct  277  SVLFLSCFISNE----------GLKDKLEKRSKALGRNADFHIESLIDSLPRYLTFRFMR  326

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            F W++E++Q AKIL+KVDYPLELD+++LCS++LRK+LE PR+ LRDE+ K+LG       
Sbjct  327  FIWEKETSQNAKILKKVDYPLELDIYELCSEELRKKLEAPRQKLRDEKDKRLG-------  379

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            +SS D+DVKMTDA           +P+ + G      Q  TGIYDLV+VLTH+G + D+G
Sbjct  380  TSSMDSDVKMTDA----------EEPSKESGKSSTAAQ--TGIYDLVSVLTHEGITTDNG  427

Query  562  HYVAWVKQENGKWI  603
            HY+AWVKQE+G WI
Sbjct  428  HYLAWVKQESGTWI  441



>tpg|DAA59025.1| TPA: hypothetical protein ZEAMMB73_534205 [Zea mays]
Length=379

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            +V+SLKCHISQ+VNHLHEG+K GLK+ELEKASP+LGR+A+Y ++SRIN LPRYLT+QFVR
Sbjct  251  SVYSLKCHISQDVNHLHEGIKHGLKTELEKASPTLGRTAVYTRESRINELPRYLTVQFVR  310

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKA  330
            FFWKRESNQKAKILRKVDYPLELDV++ CSD+L+++L+ PR+ 
Sbjct  311  FFWKRESNQKAKILRKVDYPLELDVYEFCSDELKQKLQAPRQV  353



>dbj|BAD94710.1| ubiquitin-specific protease 6 [Arabidopsis thaliana]
Length=147

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +1

Query  277  FDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSKDNDVKMTDAVesssgsgessK  456
            FDLCS+DLRK+LE PR+ LR+EEGKKLGLQ S KS S KD+DVKMTDA  S++GSGESS 
Sbjct  1    FDLCSEDLRKKLEAPRQKLREEEGKKLGLQTSAKSGS-KDSDVKMTDAEASANGSGESST  59

Query  457  PAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVAWVKQENGKWI  603
              PQEG   EKE H+TGIYDLVAVLTHKGRSADSGHYVAWVKQE+GKWI
Sbjct  60   VNPQEGTSSEKETHMTGIYDLVAVLTHKGRSADSGHYVAWVKQESGKWI  108



>ref|XP_005645914.1| ubiquitin carboxyl-terminal hydrolase 6 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21370.1| ubiquitin carboxyl-terminal hydrolase 6 [Coccomyxa subellipsoidea 
C-169]
Length=496

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 131/221 (59%), Gaps = 37/221 (17%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
             V+ LKC+I+ EVNHL EG+  GL+ + EK S +LGR A++   S I  LP Y+T+Q VR
Sbjct  249  TVYELKCNITLEVNHLTEGIHLGLQDDREKNSDALGRLALFKGSSVITKLPPYMTVQMVR  308

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQAS---  372
            FF+K ++ QKAKILRKV +P+ LD ++ C+D  +K L+GPR A ++ E  + GL+ +   
Sbjct  309  FFYKVDTRQKAKILRKVVFPMVLDAYEFCADSYKKELDGPRAAWQEAEDVRAGLEKAAKT  368

Query  373  --------------GK----------SSSSKDNDVKMTDAVesssgsgessKPAPQEGVL  480
                          GK          +S+    DV M DA         SS  AP+ G  
Sbjct  369  AAKAADKAAEASKDGKAEAPAAAAAPASNGSAADVDMKDA-------EASSSAAPEAG--  419

Query  481  PEKEQHLTGIYDLVAVLTHKGRSADSGHYVAWVKQENGKWI  603
             +    LTG Y+LVAVLTHKGRSADSGHYV+WVKQ++  WI
Sbjct  420  -QYSGQLTGRYELVAVLTHKGRSADSGHYVSWVKQDDKSWI  459



>emb|CEG00589.1| Ubiquitin supergroup [Ostreococcus tauri]
Length=488

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 124/202 (61%), Gaps = 15/202 (7%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            +SLKC+I+ EVNH+ EG +  L    E  S +LGR A++   S+I+ LP YLT Q VRFF
Sbjct  253  YSLKCNITIEVNHVTEGFRIALNDTRELRSEALGRDAVFEGASKISSLPEYLTTQLVRFF  312

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRK---------ALRDEEGKKLG  360
            +K +   KAKILR V +P+ LD ++ C+D+L+  L+  RK         A +    KK  
Sbjct  313  YKADIRAKAKILRAVTFPITLDAYEFCTDELKAELDPARKLKLKREDDAATQRMNEKKAA  372

Query  361  LQASGKSSSSKDNDVKMTDAVesssgsgess--KPAPQEGVLPEKEQHLTGIYDLVAVLT  534
            L+ + + SS    D  M DA  SS+ + + +    AP+  V P +   LTG YDL+AVLT
Sbjct  373  LEGAKEESS----DTAMGDAPASSAATSDVAPVSTAPEPEVDPLEGTRLTGFYDLIAVLT  428

Query  535  HKGRSADSGHYVAWVKQENGKW  600
            HKGRSADSGHYV+WVK +NG W
Sbjct  429  HKGRSADSGHYVSWVKHDNGSW  450



>ref|XP_003083921.1| putative ubiquitin-specific protease UBP6 (ISS) [Ostreococcus 
tauri]
Length=493

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 124/202 (61%), Gaps = 15/202 (7%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            +SLKC+I+ EVNH+ EG +  L    E  S +LGR A++   S+I+ LP YLT Q VRFF
Sbjct  258  YSLKCNITIEVNHVTEGFRIALNDTRELRSEALGRDAVFEGASKISSLPEYLTTQLVRFF  317

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRK---------ALRDEEGKKLG  360
            +K +   KAKILR V +P+ LD ++ C+D+L+  L+  RK         A +    KK  
Sbjct  318  YKADIRAKAKILRAVTFPITLDAYEFCTDELKAELDPARKLKLKREDDAATQRMNEKKAA  377

Query  361  LQASGKSSSSKDNDVKMTDAVesssgsgess--KPAPQEGVLPEKEQHLTGIYDLVAVLT  534
            L+ + + SS    D  M DA  SS+ + + +    AP+  V P +   LTG YDL+AVLT
Sbjct  378  LEGAKEESS----DTAMGDAPASSAATSDVAPVSTAPEPEVDPLEGTRLTGFYDLIAVLT  433

Query  535  HKGRSADSGHYVAWVKQENGKW  600
            HKGRSADSGHYV+WVK +NG W
Sbjct  434  HKGRSADSGHYVSWVKHDNGSW  455



>ref|XP_005098967.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like [Aplysia 
californica]
Length=477

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 123/192 (64%), Gaps = 19/192 (10%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I +EV ++H GLK  L+  + K SP+LGR A+Y+K S+IN LP YLTIQFVRFF+K
Sbjct  282  LSCFIEKEVKYMHTGLKNRLEEHITKNSPTLGRDAVYVKSSKINRLPGYLTIQFVRFFYK  341

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKL-GLQAS-GKSSS  387
             ++   AKIL+ + +P+ LDVFDLCSD L+++L   R+  ++ E KKL   QA+ GK+  
Sbjct  342  EKNATNAKILKDIKFPMSLDVFDLCSDSLQQKLIPMREKFKEVEDKKLEQAQATKGKAPV  401

Query  388  SKDNDVKMTDAVesssgsgessKPAPQEGVLPEKE-QHLTGIYDLVAVLTHKGRSADSGH  564
             KD+  ++              K AP     P+    + +G Y+L AVLTHKGRS+ SGH
Sbjct  402  EKDDKKEV--------------KTAPYN--FPDDTGSNNSGYYELSAVLTHKGRSSSSGH  445

Query  565  YVAWVKQENGKW  600
            YVAWV+++ G W
Sbjct  446  YVAWVRRKGGDW  457



>ref|XP_011399658.1| Ubiquitin carboxyl-terminal hydrolase 7 [Auxenochlorella protothecoides]
 gb|KFM26720.1| Ubiquitin carboxyl-terminal hydrolase 7 [Auxenochlorella protothecoides]
Length=486

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 119/193 (62%), Gaps = 0/193 (0%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
             ++LKC+IS EVNHL +G++ GLK + EK S +LGR A ++  S+I  LP YLT+Q VRF
Sbjct  257  AYTLKCNISAEVNHLADGIRLGLKEDREKTSAALGRIAPFVGSSQITALPPYLTVQMVRF  316

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
            ++K +  QKAKILRKV +P +LDVF+ CS +L+  L+ PR+A +  E  K G   SG   
Sbjct  317  YYKADVQQKAKILRKVAFPAQLDVFEFCSPELQAELKAPREAAKAAEDAKAGATKSGSGP  376

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            ++  +           + +   +  A            LT  Y+L  VLTHKGRSADSGH
Sbjct  377  AAAGDAAPGPSTAAGPADAPAPATMAAANTPPAANSGALTARYELCGVLTHKGRSADSGH  436

Query  565  YVAWVKQENGKWI  603
            YVAWVKQ +G+WI
Sbjct  437  YVAWVKQGDGRWI  449



>gb|EJY81667.1| Ubiquitin carboxyl-terminal hydrolase [Oxytricha trifallax]
Length=507

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 124/218 (57%), Gaps = 35/218 (16%)
 Frame = +1

Query  25   VHSLKCHISQE---VNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQF  195
            V  L CHI      +NHL EGLK  L  ++EK SP L R+A+Y KD++IN LP YLTIQF
Sbjct  261  VLRLSCHIDNNNNPINHLAEGLKISLSGDIEKYSPVLDRNAVYFKDAKINKLPSYLTIQF  320

Query  196  VRFFWKRESN------QKAKILRKVDYPLELDVFDLCSDDLRKRLEGPR---KALRDEEG  348
            VRF+WKRES        KAKILR V +P  LD++D C+D+L+K L+  R   + LR+EE 
Sbjct  321  VRFYWKRESTLQGTKAGKAKILRNVSFPKVLDIYDFCTDELKKSLDLGREFERKLREEED  380

Query  349  KKLGLQASGKSSSSKDNDVKMTDAVesssgsgessKPAPQ-----------EGVL--PEK  489
             +  LQ           DV+M D  +++    +  KP P+           + +L  P  
Sbjct  381  TRR-LQGQ---------DVEMKDESKNNQEEEKVQKPVPKTAQKEEEIKVSDAMLYRPHG  430

Query  490  EQHLTGIYDLVAVLTHKGRSADSGHYVAWVKQENGKWI  603
            E   TG Y L+AV+THKGRSAD GHYV WV Q    W 
Sbjct  431  EGLDTGHYQLIAVVTHKGRSADGGHYVGWVHQSGDDWF  468



>gb|EJY84462.1| Ubiquitin carboxyl-terminal hydrolase [Oxytricha trifallax]
Length=507

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 124/218 (57%), Gaps = 35/218 (16%)
 Frame = +1

Query  25   VHSLKCHISQE---VNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQF  195
            V  L CHI      +NHL EGLK  L  ++EK SP L R+A+Y KD++IN LP YLTIQF
Sbjct  261  VLRLSCHIDNNNNPINHLAEGLKISLSGDIEKYSPVLDRNAVYYKDAKINKLPSYLTIQF  320

Query  196  VRFFWKRESN------QKAKILRKVDYPLELDVFDLCSDDLRKRLEGPR---KALRDEEG  348
            VRF+WKRES        KAKILR V +P  LD++D C+D+L+K L+  R   + LR+EE 
Sbjct  321  VRFYWKRESTLQGTKAGKAKILRNVSFPKVLDIYDFCTDELKKSLDLGREFERKLREEED  380

Query  349  KKLGLQASGKSSSSKDNDVKMTDAVesssgsgessKPAPQ-----------EGVL--PEK  489
             +  LQ           DV+M D  +++    +  KP P+           + +L  P  
Sbjct  381  TRR-LQGQ---------DVEMKDESKNNQEEEKVQKPVPKTAQKEEEIKVSDAMLYRPHG  430

Query  490  EQHLTGIYDLVAVLTHKGRSADSGHYVAWVKQENGKWI  603
            E   TG Y L+AV+THKGRSAD GHYV WV Q    W 
Sbjct  431  EGLDTGHYQLIAVVTHKGRSADGGHYVGWVHQSGDDWF  468



>ref|XP_005845420.1| hypothetical protein CHLNCDRAFT_25814 [Chlorella variabilis]
 gb|EFN53318.1| hypothetical protein CHLNCDRAFT_25814 [Chlorella variabilis]
Length=489

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 127/195 (65%), Gaps = 6/195 (3%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C+IS +VNHL EG++ GLK + E+ S +LGR  ++  D++I+GLP YLT+Q +RFF+K
Sbjct  256  LVCNISVDVNHLSEGIRLGLKQDREQRSEALGRDVLFQGDAQISGLPPYLTVQMMRFFYK  315

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKA--LRDEEGKKLGLQASGKSSS  387
             +  QKAKILRKV +PL LDV + C+ +L+ +L+GPR A  LR   G   G     +   
Sbjct  316  ADVQQKAKILRKVTFPLHLDVLEFCTPELQAQLKGPRLAGTLRALWGHPWGC-CCCRCRL  374

Query  388  SKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLT-GI--YDLVAVLTHKGRSADS  558
            S   DV M +A   S  + E+   A    +  E    L+ G+  Y+L+ VLTHKGRSADS
Sbjct  375  SAGGDVAMQEAGAGSGAAAEADPAAFAGELTGEAGPALSLGLCKYELIGVLTHKGRSADS  434

Query  559  GHYVAWVKQENGKWI  603
            GHYV+WV+QE+G+W+
Sbjct  435  GHYVSWVRQEDGQWV  449



>ref|XP_001697158.1| hypothetical protein CHLREDRAFT_58437 [Chlamydomonas reinhardtii]
 gb|EDP00413.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=460

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 119/198 (60%), Gaps = 20/198 (10%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            ++LK +I  +  H+ EG+  GL+ E E+ S +LGR+A++   + +  LP YLT+Q +RFF
Sbjct  243  YTLKVNIEDKTAHVSEGVAVGLREERERTSAALGRTALFKGATALTELPPYLTLQMMRFF  302

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSS  387
            ++R++ QKAKIL+K+ + LE D ++ CSD L+K+LEGPR+A ++ +   +  +   K   
Sbjct  303  FRRDNQQKAKILKKIPFSLEFDAYEFCSDALKKQLEGPRQAFKEAQDAAMEAKKLAKKVL  362

Query  388  SKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-----TGIYDLVAVLTHKGRSA  552
                 +  T              PAPQ G  P   Q       TG Y+LV V+THKGR+A
Sbjct  363  PHLPHLPFT--------------PAPQPGPRPTSSQPAPPRPHTGKYELVGVVTHKGRTA  408

Query  553  DSGHYVAWVKQ-ENGKWI  603
            DSGHYVAWVKQ  +G W+
Sbjct  409  DSGHYVAWVKQPSDGTWV  426



>ref|XP_003286293.1| hypothetical protein DICPUDRAFT_54181 [Dictyostelium purpureum]
 gb|EGC37165.1| hypothetical protein DICPUDRAFT_54181 [Dictyostelium purpureum]
Length=507

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 117/190 (62%), Gaps = 2/190 (1%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C+I+ E ++L EGLK+GL+ E+ KASPSL R A Y+K + I  LP+YL +QFVRF WK
Sbjct  262  LACNITVETSYLLEGLKKGLEEEISKASPSLHRDATYVKKTLIKELPQYLMVQFVRFHWK  321

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
              S  K+KI+R V +P  LD+  LC+ + + +LE  RK L DE      L    K+ ++ 
Sbjct  322  DTSKTKSKIVRIVQFPFVLDLQGLCTPEYQAKLEPNRKKLEDEANS--ALDKKRKAFAND  379

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D+D K T+   +      S+ P   E V    +   TG Y+LVAVLTH+GR A+SGHYVA
Sbjct  380  DDDSKQTEKKAAVGEEQPSTLPTLSEPVDIFNKSDDTGKYELVAVLTHQGRYAESGHYVA  439

Query  574  WVKQENGKWI  603
            WVK+   KW 
Sbjct  440  WVKKAEDKWF  449



>gb|ESA17055.1| hypothetical protein GLOINDRAFT_345257 [Rhizophagus irregularis 
DAOM 181602]
Length=492

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 122/192 (64%), Gaps = 4/192 (2%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHIS+ +N++  G+   L  ++EK SP+L R AIY K +RI+ LP YLT+QFVRFFWK
Sbjct  265  LNCHISKTINYMQNGVLEDLDEQIEKNSPTLRRMAIYDKTTRISRLPSYLTVQFVRFFWK  324

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             +   K+KILRKV +P+ELD  D C+D+L+ ++   +  LR+ E ++    A  K+  S 
Sbjct  325  ADRRVKSKILRKVKFPMELDATDFCTDELKNKILPLKNRLRELEKERES--AKNKAKLSI  382

Query  394  DNDVK-MTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
            DND + + D+    +   E  K      +  +   +++G+YDL AVLTH GRSA+SGHY+
Sbjct  383  DNDDQGLADSKNDETTYAEELKKLIDPDLNKDIGANVSGLYDLCAVLTHIGRSAESGHYM  442

Query  571  AWVKQENG-KWI  603
             WV+++N   WI
Sbjct  443  GWVRKDNSDDWI  454



>tpe|CBF78212.1| TPA: ubiquitin C-terminal hydrolase, putative (AFU_orthologue; 
AFUA_6G02380) [Aspergillus nidulans FGSC A4]
Length=572

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 128/233 (55%), Gaps = 49/233 (21%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E NHLH+G+  GL+ ++EK SP+L R A+Y K SRI  LP+YLT+ FVRFFWK
Sbjct  287  LDCHIDKETNHLHDGILSGLEEKIEKHSPTLNRDAVYTKRSRIARLPKYLTVHFVRFFWK  346

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGK-----  378
            R++ +KAKI+RKV +P ELDV D C+D+L+K+L   R  +RD   ++L ++ + K     
Sbjct  347  RDAQKKAKIMRKVTFPAELDVLDFCTDELKKQLIPVRDKVRDIRKEELDIERARKRQKIA  406

Query  379  -------------------------------SSSSKDNDVKMTDAVesssgsgessKPAP  465
                                           ++S KD D  MTD V  +    E+ K A 
Sbjct  407  RQREEDAKTDNASSLEPMQKKKATEERKEEGTNSGKDEDAAMTD-VFKTDAEYEAEKQAS  465

Query  466  QEGVLPEKEQHL------------TGIYDLVAVLTHKGRSADSGHYVAWVKQE  588
                  E  Q +            TG+Y+L  V+TH+G SADSGHY ++VK++
Sbjct  466  ITAAKKELAQLIDPKLGADSGTNKTGLYELRGVITHQGASADSGHYTSYVKKQ  518



>ref|XP_004986707.1| PREDICTED: uncharacterized protein LOC101772707 [Setaria italica]
Length=969

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 129/192 (67%), Gaps = 7/192 (4%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
            + +SLKCH+S +V+H++EGLKRGL+ E  + SP LG+SAIY   + I+ LPRYLT++F R
Sbjct  783  SFYSLKCHVSHDVDHIYEGLKRGLEREFWRHSPRLGQSAIYTGQAEIDELPRYLTVKFER  842

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
              WK+E ++ AKI +KV+YPL+LDV+  CSD+L+++L  PR+ L    G    + ++ K+
Sbjct  843  LIWKKELSRNAKIPQKVEYPLQLDVYKFCSDELKQKLHAPRQML----GDPGNVDSTLKT  898

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
                 +  +   +  +++    +      E  +P+K+  LTG+YDL AVLTHKG S + G
Sbjct  899  HEKGSSSTQSEVSSSATAEEPYNMDIDEVELCIPKKK--LTGLYDLHAVLTHKG-SGEVG  955

Query  562  HYVAWVKQENGK  597
            HYV+WVKQ++G+
Sbjct  956  HYVSWVKQDDGE  967



>ref|XP_001823882.1| ubiquitin carboxyl-terminal hydrolase 6 [Aspergillus oryzae RIB40]
 dbj|BAE62749.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT82564.1| ubiquitin-specific protease [Aspergillus oryzae 3.042]
 gb|KDE75282.1| ubiquitin-specific protease [Aspergillus oryzae 100-8]
Length=572

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 133/247 (54%), Gaps = 55/247 (22%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
             + L CHI +E NHLH+G+K GL+ ++EK SP+L R AIY K SRI  LP+YLT+ FVRF
Sbjct  284  FYKLDCHIGKETNHLHDGIKAGLEEKIEKRSPTLDRDAIYTKRSRIARLPKYLTVHFVRF  343

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGK--  378
            FWKRE+ +KAKI+RKV +P ELD  D C+D+L+K L   R  +R+   ++L ++ + K  
Sbjct  344  FWKRETQKKAKIMRKVTFPAELDAVDFCTDELKKELIPIRDKVREIRKEELDVERARKRQ  403

Query  379  -----------------------------------SSSSKDNDVKMTDAV-------ess  432
                                                ++ KD D  MTD            
Sbjct  404  KLDRQRDEEKKTEAEPEPLEPMQKKKAAEERKDASKATEKDGDSAMTDVFKSDAEYEAEK  463

Query  433  sgsgessKPAPQEGVLP----EKEQHLTGIYDLVAVLTHKGRSADSGHYVAWV-------  579
            + S  ++K    E + P    ++  + +G+Y+L  V+TH+G SADSGHY A+V       
Sbjct  464  AASILAAKKELSELIDPKLRSDEGTNKSGLYELRGVITHQGASADSGHYTAYVKKQAQGN  523

Query  580  KQENGKW  600
            K+E+GKW
Sbjct  524  KEEDGKW  530



>ref|XP_002380939.1| ubiquitin C-terminal hydrolase, putative [Aspergillus flavus 
NRRL3357]
 gb|EED49038.1| ubiquitin C-terminal hydrolase, putative [Aspergillus flavus 
NRRL3357]
Length=572

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 133/247 (54%), Gaps = 55/247 (22%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
             + L CHI +E NHLH+G+K GL+ ++EK SP+L R AIY K SRI  LP+YLT+ FVRF
Sbjct  284  FYKLDCHIGKETNHLHDGIKAGLEEKIEKRSPTLDRDAIYTKRSRIARLPKYLTVHFVRF  343

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGK--  378
            FWKRE+ +KAKI+RKV +P ELD  D C+D+L+K L   R  +R+   ++L ++ + K  
Sbjct  344  FWKRETQKKAKIMRKVTFPAELDAVDFCTDELKKELIPIRDKVREIRKEELDVERARKRQ  403

Query  379  -----------------------------------SSSSKDNDVKMTDAV-------ess  432
                                                ++ KD D  MTD            
Sbjct  404  KLDHQRDEEKKTEAEPEPLEPMQKKKAAEERKDASKATEKDGDSAMTDVFKSDAEYEAEK  463

Query  433  sgsgessKPAPQEGVLP----EKEQHLTGIYDLVAVLTHKGRSADSGHYVAWV-------  579
            + S  ++K    E + P    ++  + +G+Y+L  V+TH+G SADSGHY A+V       
Sbjct  464  AASILAAKKELSELIDPKLRSDEGTNKSGLYELRGVITHQGASADSGHYTAYVKKQAQGN  523

Query  580  KQENGKW  600
            K+E+GKW
Sbjct  524  KEEDGKW  530



>ref|XP_001209899.1| hypothetical protein ATEG_07213 [Aspergillus terreus NIH2624]
 gb|EAU32597.1| hypothetical protein ATEG_07213 [Aspergillus terreus NIH2624]
Length=564

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 133/247 (54%), Gaps = 60/247 (24%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            + L CHI +E NHLH+G+  GL+ ++EK SP+L R A+Y K SRI  LP+YLT+ FVRFF
Sbjct  280  YKLDCHIGKETNHLHDGIIAGLEEKIEKHSPTLDRDAVYTKRSRIARLPKYLTVHFVRFF  339

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGK---  378
            WKRE+ +KAKI+RKV +P ELD  + C+D+L+K+L   R  +R+   ++L ++ S K   
Sbjct  340  WKRETQKKAKIMRKVTFPAELDAVEFCTDELKKQLIPIRDKVREIRKEELDVERSRKRQK  399

Query  379  -------------------------------SSSSKDNDVKMTDAVesssgsgessKPAP  465
                                             ++KD D  MTDA ++ +        + 
Sbjct  400  IAHQREEEQAANSGPMEPMQKKKVAEENKDTEKAAKDGDTAMTDAFKTEADYEAEKAAS-  458

Query  466  QEGVLPEKEQ---------------HLTGIYDLVAVLTHKGRSADSGHYVAWVK------  582
               +L  K++               + +G+Y+L  V+TH+G SADSGHY A+VK      
Sbjct  459  ---ILAAKKELSELLDQKTASDNGTNKSGLYELRGVITHQGASADSGHYTAYVKKQKNGN  515

Query  583  -QENGKW  600
             +E+GKW
Sbjct  516  GEEDGKW  522



>ref|XP_001257424.1| ubiquitin C-terminal hydrolase, putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW15527.1| ubiquitin C-terminal hydrolase, putative [Neosartorya fischeri 
NRRL 181]
Length=571

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 132/251 (53%), Gaps = 64/251 (25%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            + L CHI +E NHLH+G+  GL+ ++EK SP+L R A+Y K SRI  LP+YLT+ FVRFF
Sbjct  283  YKLDCHIGKETNHLHDGILAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVRFF  342

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD----------------  339
            WKRE+ +KAKI+RKV +P ELDV + C+++L+K+L   R  +RD                
Sbjct  343  WKRETQKKAKIMRKVTFPAELDVVEFCTEELKKQLIPIRDKVRDIRKEEVDVERARKRQK  402

Query  340  ------EEGKK-----LGL-----------QASGKSSSSKDNDVKMTDAVesssgsgess  453
                  EE K+      GL           Q     S  +D D  MTD  +S +      
Sbjct  403  LAHQREEELKRAAESDAGLEPMQKKQVTEGQKEATKSGEQDGDTAMTDVFKSDAEYEAEK  462

Query  454  KPAPQEGVLPEKEQHLT---------------GIYDLVAVLTHKGRSADSGHYVAWVK--  582
              +    +L  K++  T               G+Y+L AV+TH+G SADSGHY ++VK  
Sbjct  463  NAS----ILAAKKELATLIDPKLASDAGTNKSGLYELRAVITHQGASADSGHYTSYVKKQ  518

Query  583  -----QENGKW  600
                 +E+GKW
Sbjct  519  PNGKGEEDGKW  529



>dbj|BAE42125.1| unnamed protein product [Mus musculus]
Length=239

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 114/190 (60%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  21   LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  80

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  81   EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSP  140

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              ++K                         +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  141  PKEIKYVPF-----------------SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  183

Query  574  WVKQENGKWI  603
            WV+++  +WI
Sbjct  184  WVRRKQDEWI  193



>gb|KFH72121.1| hypothetical protein MVEG_02414 [Mortierella verticillata NRRL 
6337]
Length=497

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 114/188 (61%), Gaps = 6/188 (3%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHIS+EVN+LH G+   L  ++EK S +LGRSA+Y K  RI+ LP YLT+ FVRFFWK
Sbjct  259  LDCHISKEVNYLHNGILESLDQKIEKNSATLGRSAVYSKTQRISRLPAYLTVNFVRFFWK  318

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
            +E   KAKILRKV +P ELD    C+ +L+ +L   +  LR+ +  +  L+   +    K
Sbjct  319  QEEQVKAKILRKVKFPFELDASQFCTTELQGKLTNTKLKLRELDTAETALKR--RKRQDK  376

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPE----KEQHLTGIYDLVAVLTHKGRSADSG  561
            +     TD +     + + ++ A Q  + PE       + +G Y+L AVLTH GR+ADSG
Sbjct  377  EAGKMDTDEISEEQKAVQEAQVALQNSLDPELVKDSGSNPSGQYELAAVLTHIGRTADSG  436

Query  562  HYVAWVKQ  585
            HY+ W K+
Sbjct  437  HYIGWAKK  444



>ref|XP_681968.1| hypothetical protein AN8699.2 [Aspergillus nidulans FGSC A4]
 gb|EAA60248.1| hypothetical protein AN8699.2 [Aspergillus nidulans FGSC A4]
Length=856

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 128/233 (55%), Gaps = 49/233 (21%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E NHLH+G+  GL+ ++EK SP+L R A+Y K SRI  LP+YLT+ FVRFFWK
Sbjct  287  LDCHIDKETNHLHDGILSGLEEKIEKHSPTLNRDAVYTKRSRIARLPKYLTVHFVRFFWK  346

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGK-----  378
            R++ +KAKI+RKV +P ELDV D C+D+L+K+L   R  +RD   ++L ++ + K     
Sbjct  347  RDAQKKAKIMRKVTFPAELDVLDFCTDELKKQLIPVRDKVRDIRKEELDIERARKRQKIA  406

Query  379  -------------------------------SSSSKDNDVKMTDAVesssgsgessKPAP  465
                                           ++S KD D  MTD V  +    E+ K A 
Sbjct  407  RQREEDAKTDNASSLEPMQKKKATEERKEEGTNSGKDEDAAMTD-VFKTDAEYEAEKQAS  465

Query  466  QEGVLPEKEQHL------------TGIYDLVAVLTHKGRSADSGHYVAWVKQE  588
                  E  Q +            TG+Y+L  V+TH+G SADSGHY ++VK++
Sbjct  466  ITAAKKELAQLIDPKLGADSGTNKTGLYELRGVITHQGASADSGHYTSYVKKQ  518



>ref|XP_001270293.1| ubiquitin C-terminal hydrolase, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW08867.1| ubiquitin C-terminal hydrolase, putative [Aspergillus clavatus 
NRRL 1]
Length=571

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 133/249 (53%), Gaps = 60/249 (24%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            + L CHI +E NHLH+G+  GL+ ++EK SP+L R A+Y K SRI  LP+YLT+ FVRFF
Sbjct  283  YKLDCHIGKETNHLHDGILAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVRFF  342

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD--------EEGKKLG-  360
            WKRE+ +KAKI+RKV +P ELDV D C+++L+K+L   R  +RD        E  +K   
Sbjct  343  WKRETQKKAKIMRKVTFPAELDVVDFCTEELKKQLVPIRDKVRDIRKEEVDVERARKRQK  402

Query  361  --------LQASGKSSSS---------------------KDNDVKMTDAVesssgsgess  453
                    L+ + +S +S                     KD D  MTD  ++ +      
Sbjct  403  AAHQREEELKRAAESDASLEPMQKKQATEEKKEATKGGEKDGDTAMTDVFKTDADYEAEK  462

Query  454  KP-------------APQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVAWVK----  582
                           +P+  +  +   + +G+Y+L  V+TH+G SADSGHY A+VK    
Sbjct  463  NASILVAKKELSALVSPE--IAADTGSNKSGLYELRGVITHQGASADSGHYTAYVKKQPN  520

Query  583  ---QENGKW  600
               +++GKW
Sbjct  521  SKGEDDGKW  529



>ref|XP_002946055.1| hypothetical protein VOLCADRAFT_78675 [Volvox carteri f. nagariensis]
 gb|EFJ53050.1| hypothetical protein VOLCADRAFT_78675 [Volvox carteri f. nagariensis]
Length=528

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 122/203 (60%), Gaps = 10/203 (5%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
             ++LK +I ++  H+ EG+  GLK E E++S ++GR+ ++   + +  LP +LT+Q +RF
Sbjct  261  TYTLKVNIEEKTAHVSEGVALGLKEERERSSVAMGRTVVFRGGTSLTALPPFLTLQMMRF  320

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKAL-----RDEEGKKLGLQA  369
            F++R++ QKAKIL+K+ + LE D F+ CSD+L+K LE PR A      R+ E KKL  + 
Sbjct  321  FFRRDNGQKAKILKKIPFSLEFDAFEFCSDELKKELEAPRVAYKEAQDREIEAKKLAKKG  380

Query  370  SG----KSSSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTH  537
             G     ++S+    +   +AV        +             +  +TG Y+LV V+TH
Sbjct  381  PGPSAVATASAASGTLTAANAVADVDMKEAAVASTSAPTTSSSTKLSMTGKYELVGVVTH  440

Query  538  KGRSADSGHYVAWVKQ-ENGKWI  603
            KGR+ADSGHYVAWVKQ  +G W+
Sbjct  441  KGRTADSGHYVAWVKQSSDGTWV  463



>gb|KEY76508.1| ubiquitin hydrolase [Aspergillus fumigatus var. RP-2014]
Length=570

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 134/248 (54%), Gaps = 63/248 (25%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E NHLH+G+  GL+ ++EK SP+L R A+Y K SRI  LP+YLT+ FVRFFWK
Sbjct  285  LDCHIGKETNHLHDGILAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVRFFWK  344

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD------------------  339
            RE+ +KAKI+RKV +P ELDV + C+++L+K+L   R  +RD                  
Sbjct  345  RETQKKAKIMRKVTFPAELDVVEFCTEELKKQLIPIRDKVRDIRKEEVDIERARKRQKLA  404

Query  340  ----EEGKK-----LGL----------QASGKSSSSKDNDVKMTDAVesssgsgessKPA  462
                EE K+      GL          Q     S  +D D  MTD V  S    E+ K A
Sbjct  405  HQREEELKRAAESDAGLEPLQKKATEGQKEATKSGEQDGDTAMTD-VFKSDAEYEAEKYA  463

Query  463  PQEGVLPEKEQ---------------HLTGIYDLVAVLTHKGRSADSGHYVAWVKQ----  585
                +L  K++               + +G+Y+L AV+TH+G SADSGHY ++VK+    
Sbjct  464  ---SILAAKKELAALIDPKLASDAGTNKSGLYELRAVITHQGASADSGHYTSYVKKQPDG  520

Query  586  ---ENGKW  600
               E+GKW
Sbjct  521  KGVEDGKW  528



>ref|XP_747839.1| ubiquitin C-terminal hydrolase [Aspergillus fumigatus Af293]
 gb|EAL85801.1| ubiquitin C-terminal hydrolase, putative [Aspergillus fumigatus 
Af293]
 gb|EDP47744.1| ubiquitin C-terminal hydrolase, putative [Aspergillus fumigatus 
A1163]
Length=571

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 97/249 (39%), Positives = 134/249 (54%), Gaps = 64/249 (26%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E NHLH+G+  GL+ ++EK SP+L R A+Y K SRI  LP+YLT+ FVRFFWK
Sbjct  285  LDCHIGKETNHLHDGILAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVRFFWK  344

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD------------------  339
            RE+ +KAKI+RKV +P ELDV + C+++L+K+L   R  +RD                  
Sbjct  345  RETQKKAKIMRKVTFPAELDVVEFCTEELKKQLIPIRDKVRDIRKEEVDVERARKRQKLA  404

Query  340  ----EEGKK-----LGL-----------QASGKSSSSKDNDVKMTDAVesssgsgessKP  459
                EE K+      GL           Q     S  +D D  MTD V  S    E+ K 
Sbjct  405  HQREEELKRAAESDAGLEPLQKKKATEGQKEATKSGEQDGDTAMTD-VFKSDAEYEAEKY  463

Query  460  APQEGVLPEKEQ---------------HLTGIYDLVAVLTHKGRSADSGHYVAWVKQ---  585
            A    +L  K++               + +G+Y+L AV+TH+G SADSGHY ++VK+   
Sbjct  464  A---SILAAKKELAALIDPKLASDAGTNNSGLYELRAVITHQGASADSGHYTSYVKKQPN  520

Query  586  ----ENGKW  600
                E+GKW
Sbjct  521  GKGVEDGKW  529



>ref|XP_001421889.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00183.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=461

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 111/191 (58%), Gaps = 20/191 (10%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            ++ KC+I+ EVNH+ EG K  L    E  S  LG  A++   S+I+ LP YLT Q VRF+
Sbjct  253  YTFKCNITIEVNHVTEGFKIALNDTRELRSEVLGADAVFEGQSKISKLPDYLTTQLVRFY  312

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSS  387
            +K +   KAKILR V +P+ LDV++ C+D+L+  LE  RK     E  +   + + K ++
Sbjct  313  YKADIRAKAKILRAVTFPITLDVYEFCTDELKAELEPARKLKLKREDDEALKRVNEKKAA  372

Query  388  SKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHY  567
             +D                    PA  E V P +    TG +DLV+VLTHKGRSADSGHY
Sbjct  373  LED--------------------PASMEVVDPLEGTRFTGFFDLVSVLTHKGRSADSGHY  412

Query  568  VAWVKQENGKW  600
            V+WVK+++G W
Sbjct  413  VSWVKKDDGSW  423



>ref|XP_010294811.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Phaethon 
lepturus]
Length=555

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 116/190 (61%), Gaps = 15/190 (8%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  335  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  394

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  395  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  452

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D   K               K  P      E  +   G YDL AVLTH+GRS+ SGHYV+
Sbjct  453  DGTQK-------------EVKYEPFSFPDGEYREVNCGYYDLQAVLTHQGRSSSSGHYVS  499

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  500  WVKRKQDEWI  509



>ref|XP_008825184.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X3 
[Nannospalax galili]
Length=432

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 115/197 (58%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  213  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  272

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q S    +S 
Sbjct  273  EKESVNAKVLKDVKFPLMLDVYELCTSELQEKMVSFRSKFKDLEDKKVNQQPSANDKTS-  331

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                                  +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  332  ----------------------SPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  369

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  370  SSGHYVSWVKRKQDEWI  386



>gb|EMS46093.1| Ubiquitin carboxyl-terminal hydrolase 6 [Triticum urartu]
Length=512

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 102/193 (53%), Gaps = 75/193 (39%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            V+SLKCHIS +VNHLHEGLK GLK+ELEK                               
Sbjct  358  VYSLKCHISHDVNHLHEGLKHGLKTELEK-------------------------------  386

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSS  384
                          KVDYPLELDV+D CSD+L+ +L+ PR+ LRD E  K GL+   K+S
Sbjct  387  --------------KVDYPLELDVYDFCSDELKLKLQTPRQVLRDAESAKFGLKVEVKTS  432

Query  385  SSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGH  564
            SS++                               E+ LTGIYDL+AVLTHKGRSADSGH
Sbjct  433  SSQN------------------------------IEKQLTGIYDLIAVLTHKGRSADSGH  462

Query  565  YVAWVKQENGKWI  603
            YV WVKQ++GKWI
Sbjct  463  YVGWVKQDDGKWI  475



>gb|ERE83866.1| ubiquitin carboxyl-terminal hydrolase 14 isoform 1 [Cricetulus 
griseus]
Length=240

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 114/191 (60%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  21   LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  80

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS-SSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +     SS
Sbjct  81   EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKKSS  140

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK                         +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  141  PPKEVKYEPF-----------------SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  183

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  184  SWVKRKQDEWI  194



>ref|XP_008573933.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 
14 [Galeopterus variegatus]
Length=493

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 118/197 (60%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  274  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPGYLTIQMVRFFYK  333

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +     + 
Sbjct  334  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVSQQPN-----TS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
            DN                  K +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  389  DN------------------KSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  430

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++ G+WI
Sbjct  431  SSGHYVSWVKRKQGEWI  447



>gb|EFA81974.1| ubiquitin domain-containing protein [Polysphondylium pallidum 
PN500]
Length=512

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 121/198 (61%), Gaps = 15/198 (8%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C+I+ E ++LHEGLKRGL+ E+ K SP+L R A+YLK + I+ LP YL +QFVRF WK
Sbjct  260  LACNINIETSYLHEGLKRGLEEEITKKSPTLNREAVYLKKTAISKLPPYLFVQFVRFHWK  319

Query  214  RESNQ---------KAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQ  366
            ++  +         KAKI+R V +P  LDV D+C+ +L+++L   RK + D+  + L   
Sbjct  320  KDVKESRDSATVGVKAKIIRPVQFPFMLDVQDMCTPELKEKLAVKRKIIEDQFNQSL---  376

Query  367  ASGKSSSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGR  546
               +      +D +M+D  +      ++   +    V  + + + TG Y+L AVLTH+GR
Sbjct  377  ---ERKRKPLDDQEMSDVSKPPEKKPDNKSTSATSDVSLDIKPNDTGKYELSAVLTHQGR  433

Query  547  SADSGHYVAWVKQENGKW  600
             ADSGHYVAWVK+ + +W
Sbjct  434  YADSGHYVAWVKKADNQW  451



>ref|XP_004683832.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Condylura cristata]
Length=458

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 117/197 (59%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SPSL R+A+YLK S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPSLQRNALYLKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+ LQ         
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNLQP--------  351

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                K +D            K +PQ+ +  E             G YDL AVLTH+GRS+
Sbjct  352  ----KTSD-----------KKSSPQKEIKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  396

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  397  SSGHYVSWVKRKQDEWI  413



>ref|XP_004368318.1| peptidase C19 family protein [Acanthamoeba castellanii str. Neff]
 gb|ELR25563.1| peptidase C19 family protein [Acanthamoeba castellanii str. Neff]
Length=488

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 116/196 (59%), Gaps = 16/196 (8%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI+ + N L  GLK  LK E+EK S  LGR+A++ K++ I  LP YL +QFVRFFWK
Sbjct  263  LMCHITSQTNFLVNGLKESLKEEIEKRSEVLGRNAVFQKEAEITRLPYYLNVQFVRFFWK  322

Query  214  RESN--QKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKL----GLQASG  375
              S+   KAKIL+ V++P+ LD+FDLC++DL+  L+  R  L + E  +L    G++   
Sbjct  323  SNSDGGNKAKILKPVEFPMVLDLFDLCAEDLKATLKEHRNILTEREDLRLQNRHGIKGKE  382

Query  376  KSSSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSAD  555
            K    K  + +    +E S       KP           Q+ TG+Y+L AVLTHKGR AD
Sbjct  383  KEGEKKAEEDEGAMDIEKSLPPLWEQKPL----------QNETGLYELYAVLTHKGRDAD  432

Query  556  SGHYVAWVKQENGKWI  603
            SGHYVAW KQ    W+
Sbjct  433  SGHYVAWTKQSEDNWL  448



>gb|EPS28429.1| hypothetical protein PDE_03375 [Penicillium oxalicum 114-2]
Length=580

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/237 (38%), Positives = 129/237 (54%), Gaps = 55/237 (23%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E NHLH+G+  GL+ ++EK SPSLGR+A+Y K SRI+ LP+YLT+ FVRFFWK
Sbjct  282  LDCHIGKETNHLHDGIMAGLEEQIEKQSPSLGRNALYTKRSRISRLPKYLTVHFVRFFWK  341

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALR-------------------  336
            RE+ +KAKI+RKV +P ELD  + C+++LR +L   R  +R                   
Sbjct  342  RETQKKAKIMRKVTFPAELDAVEFCTEELRSQLVPIRDKVREIRKDEVDLERSRKRQKLS  401

Query  337  -------------DEEGKKLGLQ-----ASGKS-SSSKDNDVKMTDAVesssgsgessKP  459
                         D +  K  +Q     A GK+ ++  D DV M +  ++ +        
Sbjct  402  NQRTEEQKKAEEADAQASKEPMQKKKEVAEGKTKANDNDGDVNMEENFKTDAEYEAEK--  459

Query  460  APQEGVLPEKE------QH--------LTGIYDLVAVLTHKGRSADSGHYVAWVKQE  588
              QE    +KE      QH         +G+Y+L  V+TH+G SADSGHY A+VK++
Sbjct  460  -LQEITAAKKELYELIKQHSSGDSGNNQSGLYELRGVITHQGASADSGHYTAYVKKQ  515



>gb|EYE96936.1| cysteine proteinase [Aspergillus ruber CBS 135680]
Length=565

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 133/248 (54%), Gaps = 60/248 (24%)
 Frame = +1

Query  25   VHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
             + L CHI ++ NHLH+G+  GL+ ++EK SP+L R+AIY K SR+  LP+YLT+ FVRF
Sbjct  280  FYKLDCHIGKDTNHLHDGIMDGLEEKIEKNSPTLDRNAIYTKRSRVARLPKYLTVHFVRF  339

Query  205  FWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRL-----------------EGPRK--  327
            FWKRE+ +KAKI+RKV +P ELD  + C+++L+ +L                 E  RK  
Sbjct  340  FWKRETQKKAKIMRKVSFPAELDAVEFCTEELKNQLVPVRNKLREVRKEETDMERARKRQ  399

Query  328  --ALRDEEGKKLGLQASGKSS-----------------SSKDNDVKMTDAVesssgsges  450
              A RDEE K    QA G SS                  + D D +MT+A ++ +     
Sbjct  400  KIAHRDEEEK----QAVGASSMEPMQKKKATEERKESGKAGDKDTEMTEAYKTDAEYEAE  455

Query  451  sKPAPQEG-----------VLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVAWVKQE---  588
            +  +               V  E   + +G+Y+L  V+TH+G SADSGHY A+VK++   
Sbjct  456  AAASILAAKKELAALVDPKVAAEAGTNQSGLYELRGVITHQGASADSGHYTAYVKKQKSN  515

Query  589  ----NGKW  600
                +GKW
Sbjct  516  GSNDDGKW  523



>ref|XP_004683831.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Condylura cristata]
Length=493

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 117/197 (59%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SPSL R+A+YLK S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPSLQRNALYLKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+ LQ         
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNLQP--------  386

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                K +D            K +PQ+ +  E             G YDL AVLTH+GRS+
Sbjct  387  ----KTSD-----------KKSSPQKEIKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  431

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  432  SSGHYVSWVKRKQDEWI  448



>ref|XP_006901353.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Elephantulus edwardii]
Length=482

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  264  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  323

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q      SS 
Sbjct  324  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKISDKSSP  383

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            + +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  384  EKEVK--------------YEPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  426

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  427  WVKRKQDEWI  436



>gb|EZF11496.1| hypothetical protein H100_07530 [Trichophyton rubrum MR850]
 gb|EZF38251.1| hypothetical protein H102_07494 [Trichophyton rubrum CBS 100081]
 gb|EZF48957.1| hypothetical protein H103_07517 [Trichophyton rubrum CBS 288.86]
 gb|EZF59605.1| hypothetical protein H104_07465 [Trichophyton rubrum CBS 289.86]
 gb|EZF80840.1| hypothetical protein H110_07512 [Trichophyton rubrum MR1448]
 gb|EZF91494.1| hypothetical protein H113_07571 [Trichophyton rubrum MR1459]
 gb|EZG13106.1| hypothetical protein H107_07682 [Trichophyton rubrum CBS 202.88]
 gb|KDB30076.1| hypothetical protein H112_07504 [Trichophyton rubrum D6]
 gb|EGD83827.2| hypothetical protein TERG_00110 [Trichophyton rubrum CBS 118892]
Length=566

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 127/245 (52%), Gaps = 56/245 (23%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E+NHLH+G+   L+ ++EK SP+L R AIY K +RI+ LP+YLT+ FVRFFWK
Sbjct  276  LNCHIDKEINHLHDGIMASLEEKIEKHSPTLDRDAIYTKKTRISRLPKYLTVHFVRFFWK  335

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD--------EEGKKLGLQA  369
            RES +KAKI+RKV +P E+DV D C+D+L+K+L   R  +R+        E  +K    A
Sbjct  336  RESQKKAKIMRKVTFPQEIDVVDFCTDELKKQLIPVRDKVREIRKDEQDMERARKRQKIA  395

Query  370  SGKSSSSKDND--------VKMTDAVesssgsgessKPAPQE-------------GVLPE  486
              +    K+ D         KM ++    S      K A  E               L +
Sbjct  396  HKREQEEKEEDRASEPLQKKKMAESATDKSRDKPEDKDAAPEVFKSDAEYEAEKAATLLQ  455

Query  487  KEQHL----------------TGIYDLVAVLTHKGRSADSGHYVAWVK-----------Q  585
             +Q L                 G+Y+L  V+TH+G SADSGHY A+VK           +
Sbjct  456  AKQELFSLINEDLAKDESTNKCGLYELRGVITHQGASADSGHYTAYVKKQGKVVDGKRRE  515

Query  586  ENGKW  600
            E+G W
Sbjct  516  EDGNW  520



>ref|XP_003238118.1| ubiquitin C-terminal hydrolase [Trichophyton rubrum CBS 118892]
Length=567

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 127/245 (52%), Gaps = 56/245 (23%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E+NHLH+G+   L+ ++EK SP+L R AIY K +RI+ LP+YLT+ FVRFFWK
Sbjct  277  LNCHIDKEINHLHDGIMASLEEKIEKHSPTLDRDAIYTKKTRISRLPKYLTVHFVRFFWK  336

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD--------EEGKKLGLQA  369
            RES +KAKI+RKV +P E+DV D C+D+L+K+L   R  +R+        E  +K    A
Sbjct  337  RESQKKAKIMRKVTFPQEIDVVDFCTDELKKQLIPVRDKVREIRKDEQDMERARKRQKIA  396

Query  370  SGKSSSSKDND--------VKMTDAVesssgsgessKPAPQE-------------GVLPE  486
              +    K+ D         KM ++    S      K A  E               L +
Sbjct  397  HKREQEEKEEDRASEPLQKKKMAESATDKSRDKPEDKDAAPEVFKSDAEYEAEKAATLLQ  456

Query  487  KEQHL----------------TGIYDLVAVLTHKGRSADSGHYVAWVK-----------Q  585
             +Q L                 G+Y+L  V+TH+G SADSGHY A+VK           +
Sbjct  457  AKQELFSLINEDLAKDESTNKCGLYELRGVITHQGASADSGHYTAYVKKQGKVVDGKRRE  516

Query  586  ENGKW  600
            E+G W
Sbjct  517  EDGNW  521



>gb|EZG02502.1| hypothetical protein H106_07348 [Trichophyton rubrum CBS 735.88]
Length=566

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 127/245 (52%), Gaps = 56/245 (23%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E+NHLH+G+   L+ ++EK SP+L R AIY K +RI+ LP+YLT+ FVRFFWK
Sbjct  276  LNCHIDKEINHLHDGIMASLEEKIEKHSPTLDRDAIYTKKTRISRLPKYLTVHFVRFFWK  335

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD--------EEGKKLGLQA  369
            RES +KAKI+RKV +P E+DV D C+D+L+K+L   R  +R+        E  +K    A
Sbjct  336  RESQKKAKIMRKVTFPQEIDVVDFCTDELKKQLIPVRDKVREIRKDEQDMERARKRQKIA  395

Query  370  SGKSSSSKDND--------VKMTDAVesssgsgessKPAPQE-------------GVLPE  486
              +    K+ D         KM ++    S      K A  E               L +
Sbjct  396  HKREQEEKEEDRASEPLQKKKMAESATDKSRDKPEDKDAAPEVFKSDAEYEAEKAATLLQ  455

Query  487  KEQHL----------------TGIYDLVAVLTHKGRSADSGHYVAWVK-----------Q  585
             +Q L                 G+Y+L  V+TH+G SADSGHY A+VK           +
Sbjct  456  AKQELFSLINEDLAKDESTNKCGLYELRGVITHQGASADSGHYTAYVKKQGKVVDGKRRE  515

Query  586  ENGKW  600
            E+G W
Sbjct  516  EDGNW  520



>gb|EZF70124.1| hypothetical protein H105_07524 [Trichophyton soudanense CBS 
452.61]
Length=566

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 127/245 (52%), Gaps = 56/245 (23%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E+NHLH+G+   L+ ++EK SP+L R AIY K +RI+ LP+YLT+ FVRFFWK
Sbjct  276  LNCHIDKEINHLHDGIMASLEEKIEKHSPTLDRDAIYTKKTRISRLPKYLTVHFVRFFWK  335

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD--------EEGKKLGLQA  369
            RES +KAKI+RKV +P E+DV D C+D+L+K+L   R  +R+        E  +K    A
Sbjct  336  RESQKKAKIMRKVTFPQEIDVVDFCTDELKKQLIPVRDKVREIRKDEQDMERARKRQKIA  395

Query  370  SGKSSSSKDND--------VKMTDAVesssgsgessKPAPQE-------------GVLPE  486
              +    K+ D         KM ++    S      K A  E               L +
Sbjct  396  HKREQEEKEEDRASEPLQKKKMAESATDKSRDKPEDKDAAPEVFKSDAEYEAEKAATLLQ  455

Query  487  KEQHL----------------TGIYDLVAVLTHKGRSADSGHYVAWVK-----------Q  585
             +Q L                 G+Y+L  V+TH+G SADSGHY A+VK           +
Sbjct  456  AKQELFSLINEDLAKDESTNKCGLYELRGVITHQGASADSGHYTAYVKKQGKVVDGKRRE  515

Query  586  ENGKW  600
            E+G W
Sbjct  516  EDGNW  520



>ref|XP_006901354.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X3 
[Elephantulus edwardii]
Length=458

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q      SS 
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKISDKSSP  359

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            + +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  360  EKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  402

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  403  WVKRKQDEWI  412



>ref|XP_008825183.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Nannospalax galili]
Length=468

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 115/197 (58%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  249  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  308

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q S    +S 
Sbjct  309  EKESVNAKVLKDVKFPLMLDVYELCTSELQEKMVSFRSKFKDLEDKKVNQQPSANDKTS-  367

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                                  +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  368  ----------------------SPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  405

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  406  SSGHYVSWVKRKQDEWI  422



>ref|XP_005355804.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X3 
[Microtus ochrogaster]
Length=457

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  239  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  298

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  299  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSP  358

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  359  PKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  401

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  402  WVKRKQDEWI  411



>gb|KFQ70323.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Phaethon lepturus]
Length=485

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 116/190 (61%), Gaps = 21/190 (11%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            D   K               K  P     P+      G YDL AVLTH+GRS+ SGHYV+
Sbjct  389  DGTQK-------------EVKYEPFS--FPDD----CGYYDLQAVLTHQGRSSSSGHYVS  429

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  430  WVKRKQDEWI  439



>ref|XP_002162819.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14-like [Hydra 
vulgaris]
Length=453

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 122/195 (63%), Gaps = 12/195 (6%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            + L C ISQ++ +L+ GLK  LK  + KASP LG+ A+Y K S I+ LP YLTIQFVRFF
Sbjct  221  YQLSCFISQDIKYLNSGLKSRLKETITKASPVLGKDALYTKSSLISRLPAYLTIQFVRFF  280

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLG---LQASGK  378
            +K +    AKIL+ + +P+ LDVF+LCS +L+++L+  R   ++EE K+     LQ S  
Sbjct  281  YKEKEKVNAKILKDIKFPMTLDVFELCSSELQEKLKPMRDKFKEEEDKRANEKLLQIS-I  339

Query  379  SSSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADS  558
            ++++K    + +D            K   +   L +   + +G Y+L AVLTH+GRS+ S
Sbjct  340  AANNKKLPFEFSDG--------RIFKMLSRLVFLQDIGSNNSGYYELSAVLTHRGRSSSS  391

Query  559  GHYVAWVKQENGKWI  603
            GHYVAW++++  +W+
Sbjct  392  GHYVAWIRKQEDEWL  406



>ref|XP_005355802.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Microtus ochrogaster]
 ref|XP_005355803.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Microtus ochrogaster]
Length=492

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  274  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  333

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  334  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSP  393

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  394  PKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  436

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  437  WVKRKQDEWI  446



>ref|XP_006901352.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Elephantulus edwardii]
Length=493

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q      SS 
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKISDKSSP  394

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
            + +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  395  EKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  437

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  438  WVKRKQDEWI  447



>ref|XP_008825182.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Nannospalax galili]
Length=494

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 115/197 (58%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q S    +S 
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTSELQEKMVSFRSKFKDLEDKKVNQQPSANDKTS-  393

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                                  +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  394  ----------------------SPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  431

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  432  SSGHYVSWVKRKQDEWI  448



>ref|XP_645688.1| ubiquitin domain-containing protein [Dictyostelium discoideum 
AX4]
 gb|EAL71762.1| ubiquitin domain-containing protein [Dictyostelium discoideum 
AX4]
Length=512

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 122/203 (60%), Gaps = 16/203 (8%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C+I+ E ++L +GLK+GL+ E+ KASP+L + AIY K + I  LP+Y+ +QFVRF WK
Sbjct  262  LACNITVETSYLFDGLKKGLEEEISKASPTLHKDAIYTKKTLIKQLPKYIMVQFVRFHWK  321

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDE-----EGKKLGLQASGK  378
              +  K+KI+R V +P  LD+FDLC+ + ++RL   RK + DE     E K+  +  SG 
Sbjct  322  DATKTKSKIVRVVQFPFTLDLFDLCTPEYKERLSPNRKRVEDEFNASLERKRKVIGGSGD  381

Query  379  SSSSKDNDVKMTDAVesssgsgessK---------PAPQEGVLPEKEQHLTGIYDLVAVL  531
             +   D  V+   AV + +    S+           A  + V  ++ +  TG Y+L AVL
Sbjct  382  GNDEDDKQVEKKAAVNNDNQPQSSTSSNDSVSTTGAAVDDDVFFKENE--TGKYELCAVL  439

Query  532  THKGRSADSGHYVAWVKQENGKW  600
            TH+GR A+SGHYVAWVK+   KW
Sbjct  440  THQGRYAESGHYVAWVKKSENKW  462



>ref|XP_011358769.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Pteropus vampyrus]
Length=468

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 116/197 (59%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  249  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  308

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q         
Sbjct  309  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQ---------  359

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                K TD            K +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  360  ---TKTTD-----------KKSSPQKEVQYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  405

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  406  SSGHYVSWVKRKQDEWI  422



>gb|KFP59504.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Cariama cristata]
Length=490

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C ISQEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFISQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_009701995.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Cariama 
cristata]
Length=501

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C ISQEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  282  LSCFISQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  341

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  342  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  399

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  400  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  444

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  445  SWVKRKQDEWI  455



>ref|XP_010124044.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Chlamydotis macqueenii]
Length=494

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KKL  Q   K+SS  
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKLNQQP--KNSSKS  392

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  393  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKQDEWI  448



>gb|KFP44522.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Chlamydotis 
macqueenii]
Length=490

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KKL  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKLNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_010827208.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Bison bison 
bison]
Length=468

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  249  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  308

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G   SS
Sbjct  309  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSS  368

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  369  PQKEVK--------------YEPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  411

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  412  SWVKRKQDEWI  422



>ref|XP_008158392.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Eptesicus fuscus]
Length=483

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  264  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  323

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  + +  SS
Sbjct  324  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSEKKSS  383

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  384  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  426

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  427  SWVKRKEDEWI  437



>emb|CDW77022.1| UNKNOWN [Stylonychia lemnae]
Length=509

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 120/217 (55%), Gaps = 35/217 (16%)
 Frame = +1

Query  34   LKCHISQE---VNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRF  204
            L CHI      +NHL EGLK  L  ++EK S +L R+A+Y K+S+IN LP YLTIQFVRF
Sbjct  262  LSCHIDNNNNPINHLAEGLKISLCGDMEKFSDTLQRNAVYHKESKINKLPSYLTIQFVRF  321

Query  205  FWKRESN------QKAKILRKVDYPLELDVFDLCSDDLRKRLEGPR---KALRDEE----  345
            +WK+ES        KAKILR V +P   D++D C+D+LRK L+  R   + LR+EE    
Sbjct  322  YWKKESTLQGTKAGKAKILRNVTFPKVFDLYDFCTDELRKSLDLGREFERKLREEEDNRR  381

Query  346  --GKKLGLQASGKSSSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL------  501
              GK + +    K    KD + +    +        + K A QE  +   +  L      
Sbjct  382  LQGKDVEMADESKQDDGKDKEEEKKLVI--------NKKKAQQEEEIKVSDAMLYRPHGI  433

Query  502  ---TGIYDLVAVLTHKGRSADSGHYVAWVKQENGKWI  603
               TG Y L+AV+THKGRSAD GHYV WV Q    W+
Sbjct  434  GLDTGHYQLIAVVTHKGRSADGGHYVGWVHQSGDDWL  470



>dbj|GAM17761.1| hypothetical protein SAMD00019534_009360 [Acytostelium subglobosum 
LB1]
Length=487

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 114/200 (57%), Gaps = 18/200 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C+I+ + ++LHEGLK+GL  E+ K SPSL R A+Y K + I  LP YL +QFVRF WK
Sbjct  229  LTCNINIDTSYLHEGLKKGLLEEISKFSPSLQREAVYNKKTLITKLPPYLNVQFVRFHWK  288

Query  214  RESNQ---------KAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQ  366
            ++  +         KAKI+R V +P  LDVFDLC+ +L+++L   RK + D         
Sbjct  289  KDVKESRDSATVGVKAKIIRAVQFPFTLDVFDLCTPELKEKLSVKRKIMDD--------I  340

Query  367  ASGKSSSSKDNDVKMTDAVesssgsgessKPAPQEGVLP-EKEQHLTGIYDLVAVLTHKG  543
             +  S   K  D +M DA                    P + + + TG Y+L AVLTH+G
Sbjct  341  YNDSSLKRKPEDEEMADAPAEKKPDNTKQAAVSTALDAPIDIKSNDTGKYELTAVLTHQG  400

Query  544  RSADSGHYVAWVKQENGKWI  603
            R ADSGHYVAWVK+E+  W+
Sbjct  401  RFADSGHYVAWVKKEDNVWM  420



>ref|XP_008158399.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X3 
[Eptesicus fuscus]
Length=459

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  + +  SS
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSEKKSS  359

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  360  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  402

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  403  SWVKRKEDEWI  413



>ref|XP_011358768.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Pteropus vampyrus]
Length=494

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 116/197 (59%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q         
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQT--------  386

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                K TD            K +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  387  ----KTTD-----------KKSSPQKEVQYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  431

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  432  SSGHYVSWVKRKQDEWI  448



>ref|XP_006254460.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Rattus norvegicus]
Length=458

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQPNANDKNSP  359

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              ++K               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  360  PKEIKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  402

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  403  WVKRKEDEWI  412



>gb|KFM11864.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Aptenodytes 
forsteri]
Length=490

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKE-QHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDTGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_006920103.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Pteropus 
alecto]
Length=494

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 116/197 (59%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q         
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQT--------  386

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                K TD            K +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  387  ----KTTD-----------KKSSPQKEVQYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  431

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  432  SSGHYVSWVKRKQDEWI  448



>gb|ELR54146.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Bos mutus]
Length=457

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  238  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  297

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G   SS
Sbjct  298  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSS  357

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  358  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  400

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  401  SWVKRKQDEWI  411



>gb|ESZ98521.1| ubiquitin C-terminal hydrolase [Sclerotinia borealis F-4157]
Length=565

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 129/242 (53%), Gaps = 56/242 (23%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHIS   NHL +G+  GL+ ++EK S  LGR AIY K S+I+ LP+YLTI FVRFFWK
Sbjct  281  LDCHISGTTNHLRDGIVAGLEEKIEKNSEILGRDAIYTKKSKISRLPKYLTIHFVRFFWK  340

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALR-------------------  336
            R+  +KAKI+RKV +P ELDV + C+D+L++ L   R  LR                   
Sbjct  341  RQVQKKAKIMRKVTFPDELDVVEFCTDELKQMLIPVRDKLREVRKEEEDVDRARKRQKRI  400

Query  337  ---DEEGKKLGL---QASGKSSSSKDNDVKMTDAVesssgsgessKPAPQEGVL-PEKEQ  495
               +E  KK G+   +   K +  KD D KM D V  +    ++ K A    +L  +KE 
Sbjct  401  HDKEEADKKAGIVDGKDEKKETKPKDGDTKMEDVVYKTGAEIDAEKAA---AILEAKKEL  457

Query  496  HL--------------TGIYDLVAVLTHKGRSADSGHYVAWVK-------------QENG  594
            H               +G+Y+L  ++TH+G SADSGHY ++VK             +E+G
Sbjct  458  HALINPELAKDDGANKSGLYELRGIVTHQGSSADSGHYTSYVKKQGPLDSKTGKRGEEDG  517

Query  595  KW  600
            KW
Sbjct  518  KW  519



>ref|XP_005898963.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Bos mutus]
Length=456

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  237  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  296

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G   SS
Sbjct  297  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSS  356

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  357  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  399

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  400  SWVKRKQDEWI  410



>ref|XP_006079265.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Bubalus bubalis]
Length=459

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G   SS
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSS  359

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  360  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  402

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  403  SWVKRKQDEWI  413



>ref|XP_003474162.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform 2 
[Cavia porcellus]
Length=458

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  239  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  298

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G   SS
Sbjct  299  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDIEDKKVNQQPNTGDKKSS  358

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  359  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  401

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  402  SWVKRKQDEWI  412



>ref|XP_008158387.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Eptesicus fuscus]
Length=494

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  + +  SS
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSEKKSS  394

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  395  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKEDEWI  448



>ref|XP_009283956.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Aptenodytes 
forsteri]
Length=519

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  300  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  359

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  360  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  417

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKE-QHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  418  DGAQK-------------EVKYEPFS--FPDDTGSNNCGYYDLQAVLTHQGRSSSSGHYV  462

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  463  SWVKRKQDEWI  473



>ref|XP_002194731.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Taeniopygia 
guttata]
Length=466

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  247  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  306

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  307  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  364

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  365  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  409

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  410  SWVKRKQDEWI  420



>gb|EPZ34611.1| Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 domain-containing 
protein [Rozella allomycis CSF55]
Length=476

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/194 (40%), Positives = 113/194 (58%), Gaps = 24/194 (12%)
 Frame = +1

Query  22   AVHSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVR  201
             V  L CHIS  VN++++GL   +   +EK SPSLGR   Y K + IN LP+YLT+  +R
Sbjct  267  VVDKLNCHISGNVNYINDGLNESMIEVIEKTSPSLGRQCSYSKKTLINRLPKYLTLNMLR  326

Query  202  FFWKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS  381
            F+WK     KAKILRKV +PL LD+++ C+D L+ ++E  R+A+R  E +   ++  GK+
Sbjct  327  FYWKPAERVKAKILRKVKFPLVLDMYEYCTDALKMKMEPNREAIRKYENE---VKLRGKN  383

Query  382  SSSKDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSG  561
            +   D  +++++                      +   + TG Y+L AVLTH GRSADSG
Sbjct  384  ADVSDLKLELSE--------------------FDDVGSNTTGFYELTAVLTHIGRSADSG  423

Query  562  HYVAWVK-QENGKW  600
            HY+ W K Q + KW
Sbjct  424  HYIGWTKDQSSDKW  437



>ref|XP_009946819.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Leptosomus 
discolor]
Length=466

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  247  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  306

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  307  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  364

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  365  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  409

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  410  SWVKRKQDEWI  420



>ref|NP_001068657.1| ubiquitin carboxyl-terminal hydrolase 14 [Bos taurus]
 ref|XP_006079264.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Bubalus bubalis]
 ref|XP_010817118.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Bos taurus]
 sp|Q0IIF7.3|UBP14_BOVIN RecName: Full=Ubiquitin carboxyl-terminal hydrolase 14; AltName: 
Full=Deubiquitinating enzyme 14; AltName: Full=Ubiquitin 
thioesterase 14; AltName: Full=Ubiquitin-specific-processing 
protease 14 [Bos taurus]
 gb|AAI22667.1| Ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) 
[Bos taurus]
 tpg|DAA15782.1| TPA: ubiquitin carboxyl-terminal hydrolase 14 [Bos taurus]
Length=494

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G   SS
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKDSS  394

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  395  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKQDEWI  448



>ref|XP_003474161.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform 1 
[Cavia porcellus]
Length=493

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  274  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  333

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G   SS
Sbjct  334  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDIEDKKVNQQPNTGDKKSS  393

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  394  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  436

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  437  SWVKRKQDEWI  447



>ref|NP_001008302.1| ubiquitin carboxyl-terminal hydrolase 14 [Rattus norvegicus]
 ref|XP_006254458.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Rattus norvegicus]
 gb|AAH85947.1| Ubiquitin specific peptidase 14 [Rattus norvegicus]
 gb|EDL86663.1| ubiquitin specific protease 14 [Rattus norvegicus]
Length=493

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQPNANDKNSP  394

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              ++K               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  395  PKEIKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  437

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  438  WVKRKEDEWI  447



>gb|EMT25494.1| Ubiquitin carboxyl-terminal hydrolase 6 [Aegilops tauschii]
Length=567

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 114/203 (56%), Gaps = 60/203 (30%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            LKCHIS +VNHLHEGLK GLK+ELEK                                  
Sbjct  375  LKCHISHDVNHLHEGLKHGLKTELEK----------------------------------  400

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
                       KVDYPLELDV+D CSD+L+ +L+ PR+ LRD E  K GL+   K+SSS+
Sbjct  401  -----------KVDYPLELDVYDFCSDELKLKLQTPRQVLRDAESAKFGLKVEVKTSSSQ  449

Query  394  DNDVKMTDAVesss------gsgessKPAPQ-------EGVLPEKEQHLTGIYDLVAVLT  534
            + +  +T A ESSS       +     P  +       +  +P+K+  LTGIYDL+AVLT
Sbjct  450  NIEGSLTSAGESSSIDIDKGNNFSEYSPTSEIKLTTNADSSVPKKQ--LTGIYDLIAVLT  507

Query  535  HKGRSADSGHYVAWVKQENGKWI  603
            HKGRSADSGHYV WVKQ++GKWI
Sbjct  508  HKGRSADSGHYVGWVKQDDGKWI  530



>gb|KFQ28661.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Merops nubicus]
Length=490

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 116/192 (60%), Gaps = 20/192 (10%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS-SSS  390
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q    S S S
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQPKNSSKSDS  390

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHY  567
               +VK                   +    P+    +  G YDL AVLTH+GRS+ SGHY
Sbjct  391  AQKEVKY------------------EPFSFPDDIGSNNCGYYDLQAVLTHQGRSSSSGHY  432

Query  568  VAWVKQENGKWI  603
            V+WVK++  +WI
Sbjct  433  VSWVKRKPDEWI  444



>ref|XP_004579771.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Ochotona 
princeps]
Length=430

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  212  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  271

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +     S 
Sbjct  272  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDIEDKKVNQQPNTNDKKSP  331

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              +V+               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  332  QKEVRY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  374

Query  574  WVKQENGKWI  603
            WVK+++ +WI
Sbjct  375  WVKRKHDEWI  384



>ref|XP_006097447.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Myotis lucifugus]
 ref|XP_006097448.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X3 
[Myotis lucifugus]
Length=468

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 116/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  249  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  308

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +    SS
Sbjct  309  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSDKKSS  368

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  369  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  411

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  412  SWVKRKEDEWI  422



>ref|XP_005517282.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Pseudopodoces humilis]
Length=457

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  238  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  297

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  298  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  355

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  356  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  400

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  401  SWVKRKQDEWI  411



>ref|XP_004020676.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Ovis aries]
Length=491

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 118/191 (62%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  272  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  331

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G  +SS
Sbjct  332  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKNSS  391

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  392  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  434

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  435  SWVKRKPDEWI  445



>ref|XP_009645958.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Egretta 
garzetta]
Length=497

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  278  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  337

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  338  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  395

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  396  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  440

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  441  SWVKRKQDEWI  451



>ref|XP_008937468.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Merops nubicus]
Length=494

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 116/192 (60%), Gaps = 20/192 (10%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKS-SSS  390
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q    S S S
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQPKNSSKSDS  394

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHY  567
               +VK                   +    P+    +  G YDL AVLTH+GRS+ SGHY
Sbjct  395  AQKEVKY------------------EPFSFPDDIGSNNCGYYDLQAVLTHQGRSSSSGHY  436

Query  568  VAWVKQENGKWI  603
            V+WVK++  +WI
Sbjct  437  VSWVKRKPDEWI  448



>ref|XP_001593749.1| hypothetical protein SS1G_05177 [Sclerotinia sclerotiorum 1980]
 gb|EDO02700.1| hypothetical protein SS1G_05177 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=571

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/249 (37%), Positives = 131/249 (53%), Gaps = 63/249 (25%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHIS   NHL +G+  GL+ ++EK S  LGR AIY K S+I+ LP+YLT+ FVRFFWK
Sbjct  280  LDCHISGATNHLRDGIVAGLEEKIEKRSEVLGRDAIYTKKSKISRLPKYLTVHFVRFFWK  339

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALR-------------------  336
            RE+ +KAKI+RKV +P ELDV + C+D+L++ L   R  +R                   
Sbjct  340  REAQKKAKIMRKVTFPDELDVVEFCTDELKQMLIPVRDKVREVRKEEEDIERARKRQKRL  399

Query  337  ---DEEGKKLGLQASGKSSS----------SKDNDVKMTDAVesssgsgessKPAPQEGV  477
               +E  KK GL     SSS          SKD D +M + V  +    ++ K A    +
Sbjct  400  HDKEEADKKAGLVDEAPSSSSNKDEKKEIKSKDGDTEMEEVVYKTDAEIDAEKAA---AI  456

Query  478  LPEKEQ---------------HLTGIYDLVAVLTHKGRSADSGHYVAWVK----------  582
            L  K++               + +G+Y+L  ++TH+G SADSGHY ++VK          
Sbjct  457  LEAKKELHALINPELAKDDGANKSGLYELRGIVTHQGSSADSGHYTSYVKKQGPLDPKTG  516

Query  583  ---QENGKW  600
               +E+GKW
Sbjct  517  VRGEEDGKW  525



>gb|KFR06410.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Opisthocomus 
hoazin]
Length=489

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  270  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  329

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  330  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  387

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  388  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  432

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  433  SWVKRKQDEWI  443



>ref|XP_003025841.1| hypothetical protein TRV_05807 [Trichophyton verrucosum HKI 0517]
 gb|EFE39513.1| hypothetical protein TRV_05807 [Trichophyton verrucosum HKI 0517]
Length=576

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 127/245 (52%), Gaps = 56/245 (23%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L CHI +E+NHLH+G+   L+ ++EK SP+L R AIY K +RI+ LP+YLT+ FVRFFWK
Sbjct  286  LNCHIDKEINHLHDGIMASLEEKIEKHSPTLDRDAIYTKKTRISRLPKYLTVHFVRFFWK  345

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD--------EEGKKLGLQA  369
            RES +KAKI+RKV +P E+DV D C+D+L+K+L   R  +R+        E  +K    A
Sbjct  346  RESQKKAKIMRKVTFPQEIDVVDFCTDELKKQLIPVRDKVREIRKDEQDMERARKRQKIA  405

Query  370  SGKSSSSKDND--------VKMTDAVesssgsgessK-PAPQ------------------  468
              +    K  D         KM ++    +      K  AP+                  
Sbjct  406  HKREQEEKQEDRASEPLQKKKMAESATDKNKDKAEDKDAAPEVFKSDAEYEAEKAAALLQ  465

Query  469  ----------EGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVAWVK-----------Q  585
                      E +  ++  +  G+Y+L  V+TH+G SADSGHY A+VK           +
Sbjct  466  AKKELFSLINEDLAKDESTNKCGLYELRGVITHQGASADSGHYTAYVKKQGKVVDGKRRE  525

Query  586  ENGKW  600
            E+G W
Sbjct  526  EDGNW  530



>ref|XP_006761938.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Myotis davidii]
Length=468

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 116/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  249  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  308

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +    SS
Sbjct  309  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSDKKSS  368

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  369  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  411

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  412  SWVKRKEDEWI  422



>gb|KFP26821.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Colius striatus]
Length=490

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>gb|KFP73459.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Acanthisitta 
chloris]
Length=490

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_006526197.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Mus musculus]
Length=467

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  249  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  308

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  309  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSP  368

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              ++K               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  369  PKEIKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  411

Query  574  WVKQENGKWI  603
            WV+++  +WI
Sbjct  412  WVRRKQDEWI  421



>ref|XP_009082327.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Acanthisitta 
chloris]
Length=510

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  291  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  350

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  351  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  408

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  409  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  453

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  454  SWVKRKQDEWI  464



>gb|KFP23231.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Egretta garzetta]
Length=490

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>gb|KFQ08696.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Leptosomus 
discolor]
Length=489

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  270  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  329

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  330  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  387

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  388  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  432

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  433  SWVKRKQDEWI  443



>gb|EOB08802.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Anas platyrhynchos]
Length=490

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_005861671.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Myotis brandtii]
Length=459

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 116/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +    SS
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSDKKSS  359

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  360  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  402

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  403  SWVKRKEDEWI  413



>ref|XP_010205075.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Colius striatus]
Length=496

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  277  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  336

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  337  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  394

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  395  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  439

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  440  SWVKRKQDEWI  450



>ref|XP_008926611.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Manacus 
vitellinus]
Length=505

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  286  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  345

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  346  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  403

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  404  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  448

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  449  SWVKRKQDEWI  459



>ref|XP_005861670.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Myotis brandtii]
Length=494

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 116/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +    SS
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSDKKSS  394

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  395  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKEDEWI  448



>gb|KFV58557.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Gavia stellata]
Length=490

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_005009472.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Anas platyrhynchos]
Length=501

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  282  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  341

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  342  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  399

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  400  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  444

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  445  SWVKRKQDEWI  455



>gb|KGL94606.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Charadrius 
vociferus]
Length=490

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>gb|KFO61551.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Corvus brachyrhynchos]
Length=490

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_004421094.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform 4 
[Ceratotherium simum simum]
Length=458

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 117/197 (59%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q         
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQT--------  351

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                K++D            K +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  352  ----KISD-----------KKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  396

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  397  SSGHYVSWVKRKQDEWI  413



>ref|XP_010300379.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Balearica regulorum gibbericeps]
Length=494

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  392

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  393  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKQDEWI  448



>ref|XP_010080520.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Pterocles gutturalis]
Length=486

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  267  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  326

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  327  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  384

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  385  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  429

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  430  SWVKRKQDEWI  440



>gb|KFW84645.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Manacus vitellinus]
Length=490

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>gb|KFR03986.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Nipponia nippon]
 gb|KFW72385.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Pygoscelis 
adeliae]
Length=490

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_009489381.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Pelecanus crispus]
 ref|XP_009575607.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Fulmarus glacialis]
Length=494

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  392

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  393  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKQDEWI  448



>ref|XP_005243360.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Falco peregrinus]
 ref|XP_005446243.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Falco cherrug]
Length=556

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  337  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  396

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  397  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDIEDKKVNQQP--KNSSKS  454

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  455  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  499

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  500  SWVKRKQDEWI  510



>ref|XP_004421093.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform 3 
[Ceratotherium simum simum]
Length=482

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 117/197 (59%), Gaps = 30/197 (15%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  264  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  323

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q         
Sbjct  324  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQT--------  375

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHL-------TGIYDLVAVLTHKGRSA  552
                K++D            K +PQ+ V  E             G YDL AVLTH+GRS+
Sbjct  376  ----KISD-----------KKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSS  420

Query  553  DSGHYVAWVKQENGKWI  603
             SGHYV+WVK++  +WI
Sbjct  421  SSGHYVSWVKRKQDEWI  437



>ref|XP_005517281.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Pseudopodoces humilis]
Length=492

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  273  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  332

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  333  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  390

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  391  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  435

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  436  SWVKRKQDEWI  446



>gb|KFP03853.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Calypte anna]
Length=490

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|NP_001033678.1| ubiquitin carboxyl-terminal hydrolase 14 isoform 2 [Mus musculus]
Length=458

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 114/190 (60%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSP  359

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              ++K                         +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  360  PKEIKYEPF-----------------SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  402

Query  574  WVKQENGKWI  603
            WV+++  +WI
Sbjct  403  WVRRKQDEWI  412



>gb|KFU96567.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Chaetura pelagica]
Length=490

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>ref|XP_006097449.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X4 
[Myotis lucifugus]
Length=459

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 116/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +    SS
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSDKKSS  359

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  360  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  402

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  403  SWVKRKEDEWI  413



>ref|XP_010168639.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Caprimulgus carolinensis]
Length=499

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  280  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  339

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  340  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  397

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  398  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  442

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  443  SWVKRKQDEWI  453



>ref|XP_009816187.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Gavia stellata]
Length=505

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  286  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  345

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  346  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  403

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  404  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  448

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  449  SWVKRKQDEWI  459



>ref|XP_009907147.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Picoides 
pubescens]
Length=501

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  282  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  341

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  342  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  399

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  400  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  444

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  445  SWVKRKQDEWI  455



>ref|XP_006097446.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Myotis lucifugus]
Length=494

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 116/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +    SS
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSDKKSS  394

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  395  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKEDEWI  448



>gb|KFO10715.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Balearica 
regulorum gibbericeps]
 gb|KFQ66267.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Pelecanus 
crispus]
 gb|KFV92110.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Fulmarus glacialis]
Length=490

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>gb|KFZ60526.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Caprimulgus 
carolinensis]
Length=491

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  272  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  331

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  332  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  389

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  390  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  434

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  435  SWVKRKQDEWI  445



>gb|KFV75662.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Picoides pubescens]
Length=490

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>gb|KFV01007.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Pterocles 
gutturalis]
Length=490

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>gb|AAH50197.1| Ubiquitin specific peptidase 14 [Mus musculus]
Length=458

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 114/190 (60%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  240  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  299

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  300  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSP  359

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              ++K                         +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  360  PKEIKYEPF-----------------SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  402

Query  574  WVKQENGKWI  603
            WV+++  +WI
Sbjct  403  WVRRKQDEWI  412



>ref|XP_005490782.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Zonotrichia 
albicollis]
Length=517

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  298  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  357

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  358  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  415

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  416  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  460

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  461  SWVKRKQDEWI  471



>gb|EMC79416.1| Ubiquitin carboxyl-terminal hydrolase 14, partial [Columba livia]
Length=490

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  271  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  330

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  331  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  388

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  389  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  433

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  434  SWVKRKQDEWI  444



>emb|CCX08485.1| Similar to Ubiquitin carboxyl-terminal hydrolase 6; acc. no. 
Q949Y0 [Pyronema omphalodes CBS 100304]
Length=553

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 123/223 (55%), Gaps = 35/223 (16%)
 Frame = +1

Query  31   SLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFW  210
            +LKCHI+Q+ N L +G+  GL  ++EK SPSLGR A+Y K S+I  LP+YLT  FVRFFW
Sbjct  277  NLKCHITQQTNFLKDGILAGLSEKIEKHSPSLGRDAVYEKTSKITRLPKYLTCHFVRFFW  336

Query  211  KRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRD--------EEGKK----  354
            +R+ N+K KI+RKV +P ELD  + C+D+LR +L   R  LRD        E  +K    
Sbjct  337  RRDINKKTKIMRKVTFPFELDATEYCTDELRNKLIPVRDKLRDLHKDASDRERARKRMKM  396

Query  355  ---------LGLQA------SGKSSSS--------KDNDVKMTDAVesssgsgessKPAP  465
                      G  A      SGK S +        K  +  M   +E      +  K   
Sbjct  397  STGGAPDDVAGGNAGSSGFGSGKQSETDLVAQDKKKQEEEAMAKYIEKVPVWADELKDKL  456

Query  466  QEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVAWVKQENG  594
               ++ ++  + +G+Y+L AV+TH+G  ADSGHY A+VK+E G
Sbjct  457  NPEIMADEGCNPSGLYELFAVVTHQGAGADSGHYCAYVKKEGG  499



>ref|XP_009969702.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14, partial 
[Tyto alba]
Length=494

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  392

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  393  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKQDEWI  448



>ref|NP_067497.2| ubiquitin carboxyl-terminal hydrolase 14 isoform 1 [Mus musculus]
 sp|Q9JMA1.3|UBP14_MOUSE RecName: Full=Ubiquitin carboxyl-terminal hydrolase 14; AltName: 
Full=Deubiquitinating enzyme 14; AltName: Full=Ubiquitin 
thioesterase 14; AltName: Full=Ubiquitin-specific-processing 
protease 14 [Mus musculus]
 gb|AAH05571.1| Ubiquitin specific peptidase 14 [Mus musculus]
 dbj|BAC26713.1| unnamed protein product [Mus musculus]
 dbj|BAC32528.1| unnamed protein product [Mus musculus]
 gb|EDL23002.1| ubiquitin specific peptidase 14, isoform CRA_b [Mus musculus]
Length=493

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 116/190 (61%), Gaps = 17/190 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q +    +S 
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSP  394

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
              ++K               +P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  395  PKEIKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  437

Query  574  WVKQENGKWI  603
            WV+++  +WI
Sbjct  438  WVRRKQDEWI  447



>ref|XP_005329083.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X2 
[Ictidomys tridecemlineatus]
Length=483

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  264  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  323

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G   SS
Sbjct  324  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQPNTGDKKSS  383

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  384  PHKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  426

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  427  SWVKRKQDEWI  437



>ref|XP_008635078.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Corvus brachyrhynchos]
 ref|XP_010394734.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Corvus cornix 
cornix]
Length=576

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 114/190 (60%), Gaps = 16/190 (8%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  357  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  416

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q    S S  
Sbjct  417  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQPKNSSKS--  474

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
                   D  +        S P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  475  -------DGAQKEVKYEPFSFPD-------DIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  520

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  521  WVKRKQDEWI  530



>ref|XP_005042102.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Ficedula 
albicollis]
Length=499

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  280  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  339

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  340  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQP--KNSSKS  397

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  398  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  442

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  443  SWVKRKQDEWI  453



>ref|XP_006761937.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X1 
[Myotis davidii]
Length=494

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 116/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  275  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  334

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +    SS
Sbjct  335  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMISFRSKFKDLEDKKVNQQTKTSDKKSS  394

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               DVK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  395  PQKDVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  437

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  438  SWVKRKEDEWI  448



>ref|XP_005976794.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Pantholops 
hodgsonii]
Length=519

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 118/191 (62%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  300  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  359

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G  +SS
Sbjct  360  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKNSS  419

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  420  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  462

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  463  SWVKRKPDEWI  473



>ref|XP_004939814.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoform X5 
[Gallus gallus]
Length=457

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 113/190 (59%), Gaps = 16/190 (8%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C ISQEV +L  GLK  L+ E+ K SP+L R A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  238  LSCFISQEVKYLFTGLKLRLQEEITKLSPTLQRDALYIKSSKISRLPAYLTIQMVRFFYK  297

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q    S S  
Sbjct  298  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQPKNLSKS--  355

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
                   D  +        S P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  356  -------DGAQKEVKYEPFSFP-------DDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  401

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  402  WVKRKQDEWI  411



>gb|EHA25517.1| hypothetical protein ASPNIDRAFT_201896 [Aspergillus niger ATCC 
1015]
Length=554

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 131/241 (54%), Gaps = 57/241 (24%)
 Frame = +1

Query  28   HSLKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFF  207
            + L CHI +E NHLH+G+  GL+ ++EK S +L R A+Y K SRI  LP+YLT+ FVRFF
Sbjct  285  YKLDCHIGKETNHLHDGIMAGLEEKIEKRSSTLDRDAVYTKRSRIARLPKYLTVHFVRFF  344

Query  208  WKRESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPR---KALRDEE-----------  345
            WKRE+ +KAKI+RKV +P ELD  D C+D+L+K+L   R   + +R EE           
Sbjct  345  WKRETQKKAKIMRKVTFPAELDAVDFCTDELKKQLIPVRDKVREIRKEEVDVERARKRQK  404

Query  346  -----------------------GKKLGLQASGKS-SSSKDNDVKMTDAVesssgsgess  453
                                    KK   +  G+S ++ KD D  MTD V  S    E+ 
Sbjct  405  LAHRKEEEEKKEAESGASMEPMQKKKAAEERKGESKAAEKDGDEAMTD-VFKSDADYEAE  463

Query  454  KPAPQEGVLPEKEQ---------------HLTGIYDLVAVLTHKGRSADSGHYVAWVKQE  588
            K A    +L  K++               + TG+Y+L  V+TH+G SADSGHY A+VK++
Sbjct  464  KTA---SILAAKKELSELIDPSLASDSGVNKTGLYELRGVITHQGASADSGHYTAYVKKQ  520

Query  589  N  591
            +
Sbjct  521  S  521



>ref|XP_005697176.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Capra hircus]
Length=519

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 118/191 (62%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  300  LSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  359

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQA-SGKSSSS  390
             + +  AK+L+ V +PL LDV++LC+ +L++++   R   +D E KK+  Q  +G  +SS
Sbjct  360  EKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPKTGDKNSS  419

Query  391  KDNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYV  570
               +VK               +P        +   +  G YDL AVLTH+GRS+ SGHYV
Sbjct  420  PQKEVKY--------------EPF---SFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  462

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  463  SWVKRKPDEWI  473



>ref|XP_010572708.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 [Haliaeetus 
leucocephalus]
Length=563

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 117/191 (61%), Gaps = 18/191 (9%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C I+QEV +L  GLK  L+ E+ K SP+L R+A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  344  LSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYK  403

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q   K+SS  
Sbjct  404  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDVEDKKVNQQP--KNSSKS  461

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEK-EQHLTGIYDLVAVLTHKGRSADSGHYV  570
            D   K               K  P     P+    +  G YDL AVLTH+GRS+ SGHYV
Sbjct  462  DGAQK-------------EVKYEPFS--FPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYV  506

Query  571  AWVKQENGKWI  603
            +WVK++  +WI
Sbjct  507  SWVKRKQDEWI  517



>ref|XP_419150.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 14 isoformX2 
[Gallus gallus]
Length=492

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 113/190 (59%), Gaps = 16/190 (8%)
 Frame = +1

Query  34   LKCHISQEVNHLHEGLKRGLKSELEKASPSLGRSAIYLKDSRINGLPRYLTIQFVRFFWK  213
            L C ISQEV +L  GLK  L+ E+ K SP+L R A+Y+K S+I+ LP YLTIQ VRFF+K
Sbjct  273  LSCFISQEVKYLFTGLKLRLQEEITKLSPTLQRDALYIKSSKISRLPAYLTIQMVRFFYK  332

Query  214  RESNQKAKILRKVDYPLELDVFDLCSDDLRKRLEGPRKALRDEEGKKLGLQASGKSSSSK  393
             + +  AK+L+ V +PL LDV++LC+ DL++++   R   +D E KK+  Q    S S  
Sbjct  333  EKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQPKNLSKS--  390

Query  394  DNDVKMTDAVesssgsgessKPAPQEGVLPEKEQHLTGIYDLVAVLTHKGRSADSGHYVA  573
                   D  +        S P        +   +  G YDL AVLTH+GRS+ SGHYV+
Sbjct  391  -------DGAQKEVKYEPFSFP-------DDIGSNNCGYYDLQAVLTHQGRSSSSGHYVS  436

Query  574  WVKQENGKWI  603
            WVK++  +WI
Sbjct  437  WVKRKQDEWI  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370