BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS157A01

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    240   2e-84   
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                230   8e-84   Sesamum indicum [beniseed]
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    231   7e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          231   9e-83   Amborella trichopoda
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         226   1e-82   Fragaria vesca subsp. vesca
emb|CDP14881.1|  unnamed protein product                                230   1e-82   Coffea canephora [robusta coffee]
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    231   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         231   1e-82   Cucumis melo [Oriental melon]
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    226   2e-82   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             235   3e-82   Capsella rubella
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                226   3e-82   Nicotiana tomentosiformis
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    231   3e-82   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     229   3e-82   Vitis vinifera
ref|NP_001234477.1|  plasma membrane H+-ATPase                          227   4e-82   Solanum lycopersicum
ref|NP_001234775.1|  plasma membrane ATPase 1                           226   4e-82   Solanum lycopersicum
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    227   5e-82   
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           226   6e-82   Solanum tuberosum [potatoes]
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                226   6e-82   Nicotiana sylvestris
ref|XP_002864812.1|  AHA11-ATPASE 11                                    234   7e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           226   8e-82   Solanum tuberosum [potatoes]
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               227   8e-82   Erythranthe guttata [common monkey flower]
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    227   8e-82   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAA34099.1|  plasma membrane H+ ATPase                               226   1e-81   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                225   1e-81   Nicotiana sylvestris
emb|CAC29435.1|  P-type H+-ATPase                                       228   1e-81   Vicia faba [broad bean]
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         229   2e-81   Tarenaya hassleriana [spider flower]
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         225   2e-81   Eucalyptus grandis [rose gum]
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                227   2e-81   Nicotiana tomentosiformis
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      224   2e-81   Solanum tuberosum [potatoes]
gb|KJB19307.1|  hypothetical protein B456_003G094300                    228   2e-81   Gossypium raimondii
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     225   2e-81   Eucalyptus grandis [rose gum]
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    226   2e-81   Populus euphratica
gb|KJB19306.1|  hypothetical protein B456_003G094300                    228   2e-81   Gossypium raimondii
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     224   3e-81   Eucalyptus grandis [rose gum]
gb|KJB19302.1|  hypothetical protein B456_003G094300                    228   3e-81   Gossypium raimondii
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         223   3e-81   Prunus mume [ume]
gb|KJB19305.1|  hypothetical protein B456_003G094300                    228   3e-81   Gossypium raimondii
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         223   3e-81   Pyrus x bretschneideri [bai li]
gb|KJB19303.1|  hypothetical protein B456_003G094300                    228   3e-81   Gossypium raimondii
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         223   4e-81   
gb|AAA34052.1|  H+-translocating ATPase                                 225   4e-81   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                228   4e-81   Nicotiana sylvestris
dbj|BAD16689.1|  plasma membrane H+-ATPase                              227   4e-81   Daucus carota [carrots]
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   229   5e-81   Citrus sinensis [apfelsine]
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                224   5e-81   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             222   6e-81   Prunus persica
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    222   6e-81   Pyrus x bretschneideri [bai li]
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   228   6e-81   Citrus sinensis [apfelsine]
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             228   6e-81   Citrus clementina [clementine]
gb|AFC88896.1|  plasma membrane H+-ATPase                               228   7e-81   Melastoma malabathricum
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    228   8e-81   Citrus sinensis [apfelsine]
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    227   9e-81   
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    227   1e-80   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         227   1e-80   Jatropha curcas
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    225   1e-80   
dbj|BAC77532.1|  plasma membrane H+-ATPase                              222   1e-80   Sesbania rostrata
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like     224   2e-80   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         227   2e-80   Populus euphratica
gb|AAQ55291.1|  plasma membrane H+-ATPase                               223   4e-80   Juglans regia
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                223   4e-80   Cucumis melo [Oriental melon]
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                228   6e-80   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         227   7e-80   Glycine soja [wild soybean]
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    227   7e-80   Glycine max [soybeans]
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type          228   8e-80   Vitis vinifera
dbj|BAD16686.1|  plasma membrane H+-ATPase                              226   8e-80   Daucus carota [carrots]
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    227   9e-80   Glycine max [soybeans]
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    226   9e-80   Nelumbo nucifera [Indian lotus]
gb|KEH31901.1|  plasma membrane H+-ATPase                               221   1e-79   Medicago truncatula
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             225   1e-79   Phaseolus vulgaris [French bean]
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         229   2e-79   Phoenix dactylifera
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           228   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS66977.1|  hypothetical protein M569_07799                         222   2e-79   Genlisea aurea
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    223   3e-79   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           228   5e-79   Elaeis guineensis
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    224   6e-79   
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     226   6e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     226   7e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             224   7e-79   Phaseolus vulgaris [French bean]
ref|NP_201073.1|  H(+)-ATPase 11                                        224   9e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CAB41144.1|  H+-transporting ATPase-like protein                    222   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             224   1e-78   Phaseolus vulgaris [French bean]
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             224   1e-78   
ref|NP_190378.2|  H(+)-ATPase 4                                         221   1e-78   Arabidopsis thaliana [mouse-ear cress]
gb|KHN13245.1|  Plasma membrane ATPase 1                                232   1e-78   Glycine soja [wild soybean]
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    225   1e-78   Brassica rapa
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    224   2e-78   Brassica rapa
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    224   2e-78   Brassica rapa
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    220   2e-78   
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    220   2e-78   
dbj|BAA06629.1|  plasma membrane H+-ATPase                              236   2e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    221   2e-78   Cicer arietinum [garbanzo]
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    224   2e-78   Glycine max [soybeans]
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    224   3e-78   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    224   3e-78   
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    223   4e-78   Glycine max [soybeans]
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     227   4e-78   Phoenix dactylifera
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             224   4e-78   Capsella rubella
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                224   4e-78   Elaeis guineensis
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type         235   7e-78   Eucalyptus grandis [rose gum]
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                     235   7e-78   Eucalyptus grandis [rose gum]
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                     235   8e-78   Eucalyptus grandis [rose gum]
emb|CDY45757.1|  BnaC02g42250D                                          225   1e-77   Brassica napus [oilseed rape]
ref|XP_006837363.1|  hypothetical protein AMTR_s00111p00107570          226   2e-77   
ref|XP_007032427.1|  H(+)-ATPase 4 isoform 1                            223   2e-77   
gb|KJB33644.1|  hypothetical protein B456_006G023600                    224   3e-77   Gossypium raimondii
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                            223   3e-77   
gb|KJB33642.1|  hypothetical protein B456_006G023600                    224   3e-77   Gossypium raimondii
gb|KJB33641.1|  hypothetical protein B456_006G023600                    224   4e-77   Gossypium raimondii
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    223   4e-77   Cucumis sativus [cucumbers]
ref|NP_001067382.1|  Os12g0638700                                       222   5e-77   
gb|KJB33643.1|  hypothetical protein B456_006G023600                    223   5e-77   Gossypium raimondii
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          224   6e-77   Sorghum bicolor [broomcorn]
emb|CDP09440.1|  unnamed protein product                                224   9e-77   Coffea canephora [robusta coffee]
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           223   9e-77   Setaria italica
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    205   1e-76   Sesamum indicum [beniseed]
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              224   1e-76   
ref|XP_011031934.1|  PREDICTED: plasma membrane ATPase 1                223   2e-76   Populus euphratica
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           224   2e-76   Citrus sinensis [apfelsine]
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    224   2e-76   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    224   2e-76   Eucalyptus grandis [rose gum]
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     224   2e-76   Eucalyptus grandis [rose gum]
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             224   2e-76   Citrus clementina [clementine]
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  223   2e-76   Citrus sinensis [apfelsine]
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           223   3e-76   Setaria italica
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  223   3e-76   Citrus sinensis [apfelsine]
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    224   3e-76   Brachypodium distachyon [annual false brome]
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           219   3e-76   Oryza brachyantha
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    223   3e-76   Cucumis melo [Oriental melon]
gb|KEH24965.1|  plasma membrane H+-ATPase                               225   4e-76   Medicago truncatula
gb|KEH24964.1|  plasma membrane H+-ATPase                               225   4e-76   Medicago truncatula
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           225   5e-76   Setaria italica
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                222   5e-76   Brachypodium distachyon [annual false brome]
gb|KDP45466.1|  hypothetical protein JCGZ_09715                         223   6e-76   Jatropha curcas
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    223   6e-76   Brachypodium distachyon [annual false brome]
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    223   8e-76   
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like           220   8e-76   Brachypodium distachyon [annual false brome]
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             223   1e-75   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           223   1e-75   
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like           225   1e-75   Prunus mume [ume]
ref|XP_006375124.1|  H+-ATPase family protein                           222   1e-75   
ref|NP_001059093.1|  Os07g0191200                                       227   2e-75   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           227   2e-75   Oryza brachyantha
gb|EEC81667.1|  hypothetical protein OsI_25220                          227   2e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          223   2e-75   Sorghum bicolor [broomcorn]
gb|KDP28822.1|  hypothetical protein JCGZ_14593                         216   2e-75   Jatropha curcas
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    220   2e-75   
ref|XP_006440236.1|  hypothetical protein CICLE_v10018727mg             219   3e-75   
gb|KDO61318.1|  hypothetical protein CISIN_1g002151mg                   219   3e-75   Citrus sinensis [apfelsine]
ref|XP_006477127.1|  PREDICTED: ATPase 11, plasma membrane-type-like    219   3e-75   Citrus sinensis [apfelsine]
gb|EMT26085.1|  Plasma membrane ATPase 1                                221   3e-75   
dbj|BAK04567.1|  predicted protein                                      223   6e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92653.1|  predicted protein                                      223   7e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  232   7e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g             219   1e-74   Phaseolus vulgaris [French bean]
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                229   1e-74   Phoenix dactylifera
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          224   2e-74   Vitis vinifera
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       228   2e-74   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       227   2e-74   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     227   2e-74   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             233   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           226   8e-74   Elaeis guineensis
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           219   8e-74   Glycine max [soybeans]
gb|KHN34200.1|  ATPase 11, plasma membrane-type                         219   8e-74   Glycine soja [wild soybean]
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           220   9e-74   Sesamum indicum [beniseed]
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                219   1e-73   Erythranthe guttata [common monkey flower]
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                230   1e-73   Erythranthe guttata [common monkey flower]
gb|EMS59303.1|  Plasma membrane ATPase                                  227   1e-73   Triticum urartu
gb|EMS45119.1|  Plasma membrane ATPase 1                                214   2e-73   Triticum urartu
gb|AEQ27823.1|  PM H+-ATPase L                                          216   2e-73   Eichhornia crassipes
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                225   2e-73   Erythranthe guttata [common monkey flower]
ref|XP_011466246.1|  PREDICTED: plasma membrane ATPase 1-like iso...    223   2e-73   Fragaria vesca subsp. vesca
tpg|DAA42486.1|  TPA: H(+)-transporting ATPase                          223   2e-73   
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             229   2e-73   Elaeis guineensis
ref|NP_001105360.1|  membrane H(+)-ATPase1                              223   2e-73   Zea mays [maize]
ref|XP_004302360.1|  PREDICTED: plasma membrane ATPase 1-like iso...    223   2e-73   Fragaria vesca subsp. vesca
tpg|DAA50741.1|  TPA: hypothetical protein ZEAMMB73_722190              220   2e-73   
emb|CDP02191.1|  unnamed protein product                                213   2e-73   Coffea canephora [robusta coffee]
gb|EEC75974.1|  hypothetical protein OsI_13084                          216   3e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_002307856.1|  ATPase 6 family protein                            228   3e-73   Populus trichocarpa [western balsam poplar]
dbj|BAA01058.1|  H-ATPase                                               216   3e-73   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050947.1|  Os03g0689300                                       216   3e-73   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    224   4e-73   Phoenix dactylifera
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     217   4e-73   Tarenaya hassleriana [spider flower]
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    224   5e-73   Phoenix dactylifera
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           225   5e-73   Elaeis guineensis
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          224   9e-73   
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          224   9e-73   Medicago truncatula
gb|AAK31799.2|  plasma membrane H+ ATPase                               226   1e-72   Lilium longiflorum [Easter lily]
ref|XP_009348377.1|  PREDICTED: plasma membrane ATPase 1-like           211   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          227   1e-72   Amborella trichopoda
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             219   2e-72   Vitis vinifera
ref|XP_007039740.1|  H(+)-ATPase 11 isoform 1                           217   2e-72   
ref|XP_008378468.1|  PREDICTED: plasma membrane ATPase 1-like           211   2e-72   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    224   2e-72   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           224   2e-72   Cucumis melo [Oriental melon]
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             223   3e-72   Capsella rubella
ref|XP_007039741.1|  H(\\+)-transporting atpase plant/fungi plasm...    217   3e-72   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     226   3e-72   Populus euphratica
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           218   4e-72   
gb|EPS57651.1|  hypothetical protein M569_17165                         227   4e-72   Genlisea aurea
ref|XP_009799962.1|  PREDICTED: plasma membrane ATPase 1-like           214   4e-72   Nicotiana sylvestris
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     226   4e-72   Cucumis sativus [cucumbers]
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             224   5e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     220   5e-72   Sesamum indicum [beniseed]
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    224   5e-72   Tarenaya hassleriana [spider flower]
dbj|BAM20990.1|  plasma membrane H+-ATPase                              218   5e-72   Marchantia polymorpha
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 225   6e-72   
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           218   6e-72   Pyrus x bretschneideri [bai li]
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          220   6e-72   Sesamum indicum [beniseed]
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 225   7e-72   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     226   7e-72   Cucumis melo [Oriental melon]
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           222   7e-72   Cicer arietinum [garbanzo]
ref|XP_004245804.1|  PREDICTED: plasma membrane ATPase 1-like           213   7e-72   
ref|XP_003529039.1|  PREDICTED: plasma membrane ATPase 1-like iso...    208   7e-72   
gb|AAD46187.1|  plasma membrane proton ATPase                           214   7e-72   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CAN61424.1|  hypothetical protein VITISV_027272                     224   9e-72   Vitis vinifera
ref|XP_007012006.1|  H(+)-ATPase 8                                      221   9e-72   
gb|ABA18112.1|  putative plasma membrane ATPase                         222   9e-72   Arabidopsis arenosa
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             222   1e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_007204519.1|  hypothetical protein PRUPE_ppa018171mg             208   1e-71   Prunus persica
gb|AAV49159.1|  plasma membrane proton ATPase 5                         221   1e-71   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ABA18090.1|  putative plasma membrane ATPase                         222   1e-71   Olimarabidopsis pumila
gb|EAZ06139.1|  hypothetical protein OsI_28373                          226   1e-71   Oryza sativa Indica Group [Indian rice]
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        224   1e-71   Lilium longiflorum [Easter lily]
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    223   1e-71   Arabis alpina [alpine rockcress]
dbj|BAM20991.1|  plasma membrane H+-ATPase                              227   2e-71   Marchantia polymorpha
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     217   2e-71   Sesamum indicum [beniseed]
gb|KHN34527.1|  Plasma membrane ATPase 1                                207   2e-71   Glycine soja [wild soybean]
ref|XP_009609422.1|  PREDICTED: plasma membrane ATPase 1-like           212   2e-71   Nicotiana tomentosiformis
ref|XP_006359241.1|  PREDICTED: plasma membrane ATPase 1-like           211   2e-71   Solanum tuberosum [potatoes]
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           226   2e-71   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     223   2e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           225   2e-71   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           225   3e-71   
emb|CBI16656.3|  unnamed protein product                                213   3e-71   Vitis vinifera
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     217   3e-71   Sesamum indicum [beniseed]
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          221   3e-71   
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     220   3e-71   Nicotiana sylvestris
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     221   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          223   3e-71   Amborella trichopoda
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                224   3e-71   Cucumis melo [Oriental melon]
ref|XP_003633895.1|  PREDICTED: plasma membrane ATPase 1                213   3e-71   Vitis vinifera
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             218   3e-71   Setaria italica
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  219   4e-71   Elaeis guineensis
emb|CBI35956.3|  unnamed protein product                                219   4e-71   Vitis vinifera
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     219   4e-71   Nicotiana tomentosiformis
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     218   4e-71   Sesamum indicum [beniseed]
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           220   4e-71   Sesamum indicum [beniseed]
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     219   5e-71   Glycine max [soybeans]
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          216   5e-71   
gb|EMT25011.1|  Plasma membrane ATPase                                  229   5e-71   
ref|XP_007134481.1|  hypothetical protein PHAVU_010G050900g             204   5e-71   Phaseolus vulgaris [French bean]
dbj|BAM20989.1|  plasma membrane H+-ATPase                              219   5e-71   Marchantia polymorpha
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           232   5e-71   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          223   6e-71   Glycine soja [wild soybean]
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    223   6e-71   Glycine max [soybeans]
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     223   7e-71   
dbj|BAA37150.1|  p-type H+-ATPase                                       220   7e-71   Vicia faba [broad bean]
gb|AAY42948.1|  plasma membrane H+ ATPase                               220   7e-71   Lupinus albus
emb|CAB85495.1|  H+-ATPase                                              204   7e-71   Medicago truncatula
emb|CAB85494.1|  H+-ATPase                                              204   7e-71   Medicago truncatula
ref|XP_008363797.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    211   7e-71   
gb|KEH17835.1|  plasma membrane H+-ATPase                               204   8e-71   Medicago truncatula
ref|XP_009333704.1|  PREDICTED: ATPase 11, plasma membrane-type-like    210   8e-71   Pyrus x bretschneideri [bai li]
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             223   9e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     223   9e-71   Glycine max [soybeans]
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     221   1e-70   Morus notabilis
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                218   1e-70   Nelumbo nucifera [Indian lotus]
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    223   1e-70   Glycine max [soybeans]
emb|CAN78639.1|  hypothetical protein VITISV_031738                     219   1e-70   Vitis vinifera
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     219   1e-70   Populus euphratica
gb|KGN60742.1|  hypothetical protein Csa_2G009310                       223   1e-70   
ref|XP_010413571.1|  PREDICTED: ATPase 7, plasma membrane-type          210   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010512349.1|  PREDICTED: ATPase 7, plasma membrane-type-like     210   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010469197.1|  PREDICTED: ATPase 7, plasma membrane-type-like     210   1e-70   Camelina sativa [gold-of-pleasure]
gb|KEH37844.1|  plasma membrane H+-ATPase                               219   2e-70   Medicago truncatula
ref|XP_002511598.1|  H(\+)-transporting atpase plant/fungi plasma...    209   2e-70   
ref|XP_008238415.1|  PREDICTED: ATPase 11, plasma membrane-type-like    210   2e-70   Prunus mume [ume]
dbj|BAD19091.1|  putative H+-exporting ATPase                           218   2e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006290558.1|  hypothetical protein CARUB_v10016644mg             210   2e-70   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    222   2e-70   
dbj|BAD33363.1|  putative plasma membrane H+-ATPase                     224   2e-70   
ref|XP_007210973.1|  hypothetical protein PRUPE_ppa021822mg             210   2e-70   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    218   2e-70   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     221   2e-70   
emb|CAD29311.1|  plasma membrane H+-ATPase                              224   2e-70   
emb|CDP14278.1|  unnamed protein product                                222   2e-70   
ref|XP_002324564.1|  ATPase 6 family protein                            219   2e-70   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          222   2e-70   
ref|XP_002304716.2|  H+-ATPase family protein                           216   2e-70   
gb|KDP39917.1|  hypothetical protein JCGZ_03448                         212   2e-70   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           218   3e-70   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             214   3e-70   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    220   3e-70   
emb|CAD29312.1|  plasma membrane H+-ATPase                              216   3e-70   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           218   3e-70   
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     216   3e-70   
ref|XP_006402592.1|  hypothetical protein EUTSA_v10005774mg             209   4e-70   
ref|XP_007023381.1|  H(+)-ATPase 9                                      216   4e-70   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          220   4e-70   
ref|NP_189850.1|  H(+)-ATPase 8                                         218   4e-70   
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         221   4e-70   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             221   5e-70   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     219   5e-70   
ref|NP_001048395.2|  Os02g0797300                                       218   5e-70   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          223   5e-70   
ref|XP_004306988.1|  PREDICTED: plasma membrane ATPase 1                209   6e-70   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           217   6e-70   
ref|XP_002465931.1|  hypothetical protein SORBIDRAFT_01g048440          227   7e-70   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          215   7e-70   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     217   8e-70   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                221   8e-70   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          218   8e-70   
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    216   9e-70   
gb|ACL54575.1|  unknown                                                 214   9e-70   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  214   9e-70   
ref|XP_008369420.1|  PREDICTED: ATPase 11, plasma membrane-type-like    209   9e-70   
gb|KJB66333.1|  hypothetical protein B456_010G136300                    213   9e-70   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    220   9e-70   
ref|XP_008650595.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    221   1e-69   
ref|XP_010053511.1|  PREDICTED: ATPase 11, plasma membrane-type-like    206   1e-69   
gb|KEH32174.1|  plasma membrane H+-ATPase                               217   1e-69   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              218   1e-69   
ref|XP_006480483.1|  PREDICTED: ATPase 4, plasma membrane-type-li...    210   1e-69   
ref|XP_006480487.1|  PREDICTED: ATPase 4, plasma membrane-type-li...    210   1e-69   
tpg|DAA43142.1|  TPA: hypothetical protein ZEAMMB73_734128              221   1e-69   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       219   1e-69   
gb|EMT31912.1|  Plasma membrane ATPase 1                                219   1e-69   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           224   1e-69   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             215   1e-69   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             217   1e-69   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     221   1e-69   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       219   1e-69   
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           220   1e-69   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           214   1e-69   
gb|AEO22063.1|  plasma membrane H+-ATPase                               218   2e-69   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          214   2e-69   
emb|CDY42692.1|  BnaC04g22140D                                          205   2e-69   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                212   2e-69   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                213   2e-69   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             216   2e-69   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           228   2e-69   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      216   2e-69   
gb|EPS65442.1|  hypothetical protein M569_09334                         210   2e-69   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             217   2e-69   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             216   2e-69   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           218   2e-69   
ref|NP_001054118.1|  Os04g0656100                                       215   2e-69   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                216   2e-69   
ref|XP_008677590.1|  PREDICTED: uncharacterized protein LOC100383...    217   2e-69   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               217   2e-69   
ref|NP_191592.5|  H(+)-ATPase 7                                         204   3e-69   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     216   3e-69   
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                215   3e-69   
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                216   3e-69   
ref|NP_178762.1|  H(+)-ATPase 6                                         217   3e-69   
gb|AAB17186.1|  plasma membrane H+-ATPase                               215   3e-69   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     214   3e-69   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          218   3e-69   
ref|XP_002309321.1|  ATPase 6 family protein                            216   3e-69   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             210   3e-69   
gb|KHN44553.1|  Plasma membrane ATPase 1                                199   3e-69   
gb|AEQ27822.1|  PM H+-ATPase R                                          214   3e-69   
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like           228   3e-69   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         216   3e-69   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             218   4e-69   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          213   4e-69   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    216   4e-69   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             215   4e-69   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             218   4e-69   
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             216   4e-69   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     218   4e-69   
ref|XP_003521073.2|  PREDICTED: plasma membrane ATPase 1-like iso...    199   4e-69   
ref|XP_006428677.1|  hypothetical protein CICLE_v10011010mg             210   4e-69   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                216   4e-69   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          212   5e-69   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     217   5e-69   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          216   5e-69   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                216   5e-69   
gb|AAB84202.2|  plasma membrane proton ATPase                           212   5e-69   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             217   5e-69   
gb|KJB51811.1|  hypothetical protein B456_008G232800                    206   5e-69   
emb|CDY56993.1|  BnaA04g27340D                                          205   5e-69   
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    217   5e-69   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     213   5e-69   
gb|KJB82763.1|  hypothetical protein B456_013G212200                    215   5e-69   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    215   5e-69   
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     215   6e-69   
gb|EMT26270.1|  Plasma membrane ATPase                                  215   6e-69   
gb|EMS60594.1|  Plasma membrane ATPase                                  215   6e-69   
emb|CDY51650.1|  BnaAnng10900D                                          213   6e-69   
ref|XP_008798791.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     200   6e-69   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    213   6e-69   
emb|CDX72217.1|  BnaC07g42390D                                          213   7e-69   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    213   7e-69   
emb|CBW30173.1|  Plasma membrane ATPase 4                               213   7e-69   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    213   7e-69   
emb|CBW30211.1|  Plasma membrane ATPase                                 213   7e-69   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          215   7e-69   
gb|ACE77057.1|  plasma membrane proton pump                             210   7e-69   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  213   7e-69   
ref|XP_008798790.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     200   8e-69   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    213   8e-69   
ref|XP_002444096.1|  hypothetical protein SORBIDRAFT_07g007610          214   8e-69   
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          213   8e-69   
gb|ABR26203.1|  plasma membrane atpase 1                                219   8e-69   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           210   8e-69   
emb|CDX72218.1|  BnaC07g42400D                                          213   9e-69   
ref|XP_011089588.1|  PREDICTED: plasma membrane ATPase 1                205   9e-69   
ref|XP_002304299.1|  H+-ATPase family protein                           205   9e-69   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             213   1e-68   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   214   1e-68   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   1e-68   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       218   1e-68   
gb|KJB82762.1|  hypothetical protein B456_013G212200                    214   1e-68   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   214   1e-68   
gb|KHN17608.1|  Plasma membrane ATPase 4                                214   1e-68   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    214   1e-68   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             214   1e-68   
gb|EPS63245.1|  hypothetical protein M569_11541                         225   1e-68   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             214   1e-68   
ref|XP_010545150.1|  PREDICTED: ATPase 7, plasma membrane-type          202   1e-68   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     214   1e-68   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     214   1e-68   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    218   1e-68   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   1e-68   
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             216   1e-68   
ref|XP_008645605.1|  PREDICTED: uncharacterized protein LOC100383...    198   1e-68   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              213   1e-68   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              214   1e-68   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     213   2e-68   
gb|AFM52333.1|  plasma membrane H+-ATPase                               217   2e-68   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                215   2e-68   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             210   2e-68   
ref|XP_003573592.1|  PREDICTED: ATPase 2, plasma membrane-type-like     213   2e-68   
gb|KHN22686.1|  Plasma membrane ATPase 4                                214   2e-68   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           216   2e-68   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  212   2e-68   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          210   2e-68   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   2e-68   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    216   2e-68   
emb|CDX82608.1|  BnaC07g02580D                                          210   2e-68   
ref|XP_009138842.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 7, pl...    203   2e-68   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     213   2e-68   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     210   2e-68   
ref|XP_008369421.1|  PREDICTED: ATPase 11, plasma membrane-type-like    209   2e-68   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    213   2e-68   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    213   2e-68   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             207   2e-68   
dbj|BAK05828.1|  predicted protein                                      214   2e-68   
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    210   3e-68   
gb|AHK23067.1|  plasma membrane ATPase 4                                216   3e-68   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    213   3e-68   
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             210   3e-68   
gb|EPS73574.1|  hypothetical protein M569_01174                         209   3e-68   
gb|ABW25091.1|  plasma membrane proton pump                             215   3e-68   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     212   3e-68   
emb|CDY64741.1|  BnaCnng44750D                                          210   3e-68   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          210   3e-68   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          210   3e-68   
gb|AFW04239.1|  plasma membrane H+-ATPase                               214   3e-68   
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   214   3e-68   
ref|XP_010529048.1|  PREDICTED: ATPase 7, plasma membrane-type          201   3e-68   
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    210   3e-68   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     210   3e-68   
gb|KJB22048.1|  hypothetical protein B456_004G027300                    212   3e-68   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                213   3e-68   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             209   3e-68   
ref|NP_001190870.1|  H(+)-ATPase 2                                      211   3e-68   
dbj|BAD16685.1|  plasma membrane H+-ATPase                              212   4e-68   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             214   4e-68   
ref|XP_004300356.1|  PREDICTED: plasma membrane ATPase 1-like           206   4e-68   
ref|NP_200545.1|  H(+)-ATPase 3                                         215   4e-68   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      215   4e-68   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       215   4e-68   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          214   4e-68   
gb|KJB55190.1|  hypothetical protein B456_009G068100                    213   4e-68   
gb|AAR32129.2|  proton P-ATPase                                         214   4e-68   
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   213   4e-68   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  213   4e-68   
ref|NP_194748.1|  H(+)-ATPase 2                                         211   4e-68   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              211   5e-68   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    213   5e-68   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             213   5e-68   
gb|KJB55189.1|  hypothetical protein B456_009G068100                    212   5e-68   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           216   5e-68   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          207   5e-68   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             213   5e-68   
ref|XP_001782121.1|  predicted protein                                  214   5e-68   
emb|CDY67153.1|  BnaAnng23670D                                          207   5e-68   
gb|ABR18001.1|  unknown                                                 209   5e-68   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             210   5e-68   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   213   6e-68   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     210   6e-68   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          210   6e-68   
ref|XP_004986083.1|  PREDICTED: plasma membrane ATPase 1-like iso...    197   6e-68   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             210   6e-68   
ref|XP_010497432.1|  PREDICTED: ATPase 8, plasma membrane-type-like     219   6e-68   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           215   6e-68   
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           213   6e-68   



>ref|XP_007037195.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
 gb|EOY21696.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
Length=1607

 Score =   240 bits (612),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE+DA+ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+
Sbjct  141  DGRWSEQDAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score =   100 bits (248),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVLDAVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKESKFLK+
Sbjct  6    EVLDAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLVIFGHNKLEEKKESKFLKY  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score =   230 bits (587),  Expect(2) = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   107 bits (267),  Expect(2) = 8e-84, Method: Composition-based stats.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFGHNKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTAAAQERLAIFGHNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_010256122.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Nelumbo 
nucifera]
Length=970

 Score =   231 bits (590),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (256),  Expect(2) = 7e-83, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E+L+AVLKE VDLENIPIEEVFENLRC+KDGLT++AAQERL IFGHNKLEEKKESK LKF
Sbjct  6    EILEAVLKEAVDLENIPIEEVFENLRCSKDGLTTEAAQERLAIFGHNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_006838797.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
 gb|ERN01366.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
Length=956

 Score =   231 bits (588),  Expect(2) = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (257),  Expect(2) = 9e-83, Method: Composition-based stats.
 Identities = 65/71 (92%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKE VDLENIPIEEVFENLRCTK+GLTS AAQERL IFGHNKLEEKKESK LKF
Sbjct  6    EVLEAVLKEAVDLENIPIEEVFENLRCTKEGLTSDAAQERLGIFGHNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=957

 Score =   226 bits (577),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  90   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  150  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  210  GEIEAVVIATGVHTFF  225


 Score =   107 bits (268),  Expect(2) = 1e-82, Method: Composition-based stats.
 Identities = 65/72 (90%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRC+K+GLTS+AA+ERL IFGHNKLEEK+ESKF+K
Sbjct  6    PEVLDAVLKETVDLENIPIEEVFENLRCSKEGLTSEAAEERLTIFGHNKLEEKQESKFIK  65

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  66   FLGFMWNPLSWV  77



>emb|CDP14881.1| unnamed protein product [Coffea canephora]
Length=950

 Score =   230 bits (587),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (258),  Expect(2) = 1e-82, Method: Composition-based stats.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AV+KETVDLENIPIEEVFENLRCTK+GLTS+ AQERL IFG+NKLEEKKESK LK
Sbjct  5    PEVLEAVVKETVDLENIPIEEVFENLRCTKEGLTSEGAQERLAIFGYNKLEEKKESKLLK  64

Query  181  flgfMWNPLSWV  216
            +LGFMWNPLSWV
Sbjct  65   YLGFMWNPLSWV  76



>ref|XP_010256132.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Nelumbo 
nucifera]
Length=956

 Score =   231 bits (589),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/136 (98%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (256),  Expect(2) = 1e-82, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E+L+AVLKE VDLENIPIEEVFENLRC+KDGLT++AAQERL IFGHNKLEEKKESK LKF
Sbjct  6    EILEAVLKEAVDLENIPIEEVFENLRCSKDGLTTEAAQERLAIFGHNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_008437674.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis melo]
Length=956

 Score =   231 bits (589),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSE+D
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGD+ISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDVISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   102 bits (255),  Expect(2) = 1e-82, Method: Composition-based stats.
 Identities = 64/72 (89%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+AA+ERL IFGHNKLEEKKESKFLK
Sbjct  5    PEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEAAEERLKIFGHNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; AltName: Full=Proton 
pump 3 [Nicotiana plumbaginifolia]
 gb|AAA34098.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   226 bits (576),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWKEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   107 bits (266),  Expect(2) = 2e-82, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKESKF K
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKESKFSK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_006279959.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
 gb|EOA12857.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
Length=956

 Score =   235 bits (599),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIVLANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+
Sbjct  141  DGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGE+EAVVIATGVHTFF
Sbjct  201  YSGSTCKQGELEAVVIATGVHTFF  224


 Score = 97.8 bits (242),  Expect(2) = 3e-82, Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWVPDA  225
            LGFMWNPLSWV +A
Sbjct  66   LGFMWNPLSWVMEA  79



>ref|XP_009626987.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana tomentosiformis]
Length=956

 Score =   226 bits (576),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWKEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   106 bits (265),  Expect(2) = 3e-82, Method: Composition-based stats.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_004152442.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004157811.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   231 bits (588),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/136 (97%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSE+D
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGD+ISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDVISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   101 bits (252),  Expect(2) = 3e-82, Method: Composition-based stats.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+ A+ERL IFGHNKLEEKKESK LK
Sbjct  5    PEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEGAEERLKIFGHNKLEEKKESKVLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_002270344.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Vitis vinifera]
 ref|XP_010663416.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Vitis vinifera]
 emb|CBI15286.3| unnamed protein product [Vitis vinifera]
Length=956

 Score =   229 bits (583),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (257),  Expect(2) = 3e-82, Method: Composition-based stats.
 Identities = 64/72 (89%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLENIPIEEVFENLRC+++GLTS+AAQERL IFG+N+LEEKKESKFLK
Sbjct  5    PEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAQERLAIFGYNRLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum]
 gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum]
 gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum]
Length=956

 Score =   227 bits (578),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWNEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (262),  Expect(2) = 4e-82, Method: Composition-based stats.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersicum]
 sp|P22180.1|PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Solanum lycopersicum]
 gb|AAA34173.1| H+-ATPase [Solanum lycopersicum]
 prf||1803518A H ATPase
Length=956

 Score =   226 bits (577),  Expect(2) = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWDEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (262),  Expect(2) = 4e-82, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTREGLTATAAQERLSIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_002322127.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF06254.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=967

 Score =   227 bits (579),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSE+D
Sbjct  89   NGGGKPPDWQDFVGIITLLFINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   104 bits (260),  Expect(2) = 5e-82, Method: Composition-based stats.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GLTSQAA+ERL IFGHNKLEEKKE KFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLSIFGHNKLEEKKERKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   226 bits (576),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWNEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (262),  Expect(2) = 6e-82, Method: Composition-based stats.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_009799220.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana sylvestris]
Length=956

 Score =   226 bits (575),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWMEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   106 bits (264),  Expect(2) = 6e-82, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIP+EEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPVEEVFENLRCTKEGLTAAAAQERLSIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_002864812.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41071.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
Length=956

 Score =   234 bits (597),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIVLANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E+DA+ILVPGDI+S+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+
Sbjct  141  DGRWGEQDAAILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGE+EAVVIATGVHTFF
Sbjct  201  YSGSTCKQGELEAVVIATGVHTFF  224


 Score = 97.4 bits (241),  Expect(2) = 7e-82, Method: Composition-based stats.
 Identities = 60/74 (81%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+A+LKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAILKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWVPDA  225
            LGFMWNPLSWV +A
Sbjct  66   LGFMWNPLSWVMEA  79



>ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   226 bits (575),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWDEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (263),  Expect(2) = 8e-82, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTTAAQERLSIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>gb|EYU35893.1| hypothetical protein MIMGU_mgv1a0008591mg, partial [Erythranthe 
guttata]
Length=689

 Score =   227 bits (578),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAK+LRDGRW+EED
Sbjct  90   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKILRDGRWNEED  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  150  AAMLVPGDIISIKLGDIIPADSRLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  210  GEIEAIVIATGVHTFF  225


 Score =   104 bits (259),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPI+EVFENLRCT++GLTS+AA+ERL IFGHNKLEEK+ESKFLK
Sbjct  6    PEVLDAVLKETVDLENIPIDEVFENLRCTREGLTSEAAEERLAIFGHNKLEEKRESKFLK  65

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  66   FLGFMWNPLSWV  77



>sp|Q08435.1|PMA1_NICPL RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Nicotiana plumbaginifolia]
 gb|AAA34094.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=957

 Score =   227 bits (578),  Expect(2) = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EED
Sbjct  90   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWKEED  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  150  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  210  GEIEAIVIATGVHTFF  225


 Score =   104 bits (259),  Expect(2) = 8e-82, Method: Composition-based stats.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKK+SK LK
Sbjct  6    PEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTATAAQERLAIFGYNKLEEKKDSKLLK  65

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  66   FLGFMWNPLSWV  77



>gb|AAA34099.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia]
Length=388

 Score =   226 bits (575),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWKEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (261),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_009793289.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana sylvestris]
Length=956

 Score =   225 bits (574),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWDEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (261),  Expect(2) = 1e-81, Method: Composition-based stats.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGPAAQERLAIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>emb|CAC29435.1| P-type H+-ATPase [Vicia faba]
Length=958

 Score =   228 bits (582),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  231  IMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRD  410
            IMAIALANGG K PDWQDFVGIITLL+INSTISFI++NNAGNAAAALMA LAPKAKVLRD
Sbjct  84   IMAIALANGGNKAPDWQDFVGIITLLIINSTISFIDQNNAGNAAAALMASLAPKAKVLRD  143

Query  411  GRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIY  590
            GRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+Y
Sbjct  144  GRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKAPGDGVY  203

Query  591  SGSTCKQGEIEAVVIATGVHTFF  659
            SGSTCKQGEIE VVIATGVHTFF
Sbjct  204  SGSTCKQGEIECVVIATGVHTFF  226


 Score =   102 bits (253),  Expect(2) = 1e-81, Method: Composition-based stats.
 Identities = 61/75 (81%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PE L AVLKETVDLENIPI+EVFENLRC+++GLTS+AA++RL IFGHNKLEEK+ESK LK
Sbjct  7    PETLQAVLKETVDLENIPIDEVFENLRCSREGLTSEAAEQRLTIFGHNKLEEKRESKLLK  66

Query  181  flgfMWNPLSWVPDA  225
            FLGFMWNPLSWV +A
Sbjct  67   FLGFMWNPLSWVMEA  81



>ref|XP_010550649.1| PREDICTED: ATPase 11, plasma membrane-type [Tarenaya hassleriana]
Length=956

 Score =   229 bits (584),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSE+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (250),  Expect(2) = 2e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKE VDLEN+PIEEVFENLRC+KDGLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKEAVDLENVPIEEVFENLRCSKDGLTTQAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_010037634.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW49371.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=956

 Score =   225 bits (573),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ LVPGDI+SVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AADLVPGDIVSVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (261),  Expect(2) = 2e-81, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKESKFLK
Sbjct  5    PEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_009607762.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana tomentosiformis]
Length=957

 Score =   227 bits (578),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EED
Sbjct  90   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWKEED  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  150  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  210  GEIEAIVIATGVHTFF  225


 Score =   103 bits (256),  Expect(2) = 2e-81, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKESKFLK
Sbjct  6    PEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTVTAAQERLAIFGYNKLEEKKESKFLK  65

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  66   FLGFMWNPLSWV  77



>ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum]
 emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=956

 Score =   224 bits (571),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWNEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PAD RLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIVPADRRLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (262),  Expect(2) = 2e-81, Method: Composition-based stats.
 Identities = 67/72 (93%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>gb|KJB19307.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=879

 Score =   228 bits (582),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   101 bits (252),  Expect(2) = 2e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KCW49372.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=920

 Score =   225 bits (573),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ LVPGDI+SVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AADLVPGDIVSVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (261),  Expect(2) = 2e-81, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKESKFLK
Sbjct  5    PEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_011028703.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
 ref|XP_011028704.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
Length=956

 Score =   226 bits (576),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (257),  Expect(2) = 2e-81, Method: Composition-based stats.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GLTSQAA+ERL IFGHNKLEEKKE KFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLAIFGHNKLEEKKERKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KJB19306.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=987

 Score =   228 bits (581),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   101 bits (252),  Expect(2) = 2e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KCW49373.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=925

 Score =   224 bits (572),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ LVPGDI+SVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AADLVPGDIVSVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   105 bits (261),  Expect(2) = 3e-81, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKESKFLK
Sbjct  5    PEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>gb|KJB19302.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   228 bits (582),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   101 bits (251),  Expect(2) = 3e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_008239652.1| PREDICTED: ATPase 11, plasma membrane-type [Prunus mume]
Length=956

 Score =   223 bits (568),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E++
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKSPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   106 bits (264),  Expect(2) = 3e-81, Method: Composition-based stats.
 Identities = 65/72 (90%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>gb|KJB19305.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   228 bits (581),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   101 bits (252),  Expect(2) = 3e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_009369365.1| PREDICTED: ATPase 11, plasma membrane-type [Pyrus x bretschneideri]
Length=956

 Score =   223 bits (568),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKSPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEI+AVVIATGVHTFF
Sbjct  209  GEIDAVVIATGVHTFF  224


 Score =   106 bits (264),  Expect(2) = 3e-81, Method: Composition-based stats.
 Identities = 65/72 (90%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>gb|KJB19303.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
 gb|KJB19304.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=925

 Score =   228 bits (581),  Expect(2) = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   101 bits (251),  Expect(2) = 3e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_008374513.1| PREDICTED: ATPase 11, plasma membrane-type [Malus domestica]
Length=956

 Score =   223 bits (568),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKSPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEI+AVVIATGVHTFF
Sbjct  209  GEIDAVVIATGVHTFF  224


 Score =   106 bits (264),  Expect(2) = 4e-81, Method: Composition-based stats.
 Identities = 65/72 (90%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   225 bits (574),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWDEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (258),  Expect(2) = 4e-81, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GL+  AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLSGPAAQERLAIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_009798932.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana sylvestris]
Length=957

 Score =   228 bits (580),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EED
Sbjct  90   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWKEED  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  150  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  210  GEIEAIVIATGVHTFF  225


 Score =   101 bits (252),  Expect(2) = 4e-81, Method: Composition-based stats.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT  AA+ERL IFG+NKLEEKK+SKFLK
Sbjct  6    PEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTVTAAEERLAIFGYNKLEEKKDSKFLK  65

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  66   FLGFMWNPLSWV  77



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   227 bits (578),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWNEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score =   102 bits (253),  Expect(2) = 4e-81, Method: Composition-based stats.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLE+IPIEEVFENLRC+KDGLTS  A ERL IFGHNKLEE KE KFLK
Sbjct  5    PEVLEAVLKETVDLESIPIEEVFENLRCSKDGLTSSGAAERLTIFGHNKLEEVKERKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>gb|KDO76027.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
 gb|KDO76028.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=672

 Score =   229 bits (583),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPK KVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKGKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (248),  Expect(2) = 5e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_009610426.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana tomentosiformis]
Length=956

 Score =   224 bits (572),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWDEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (258),  Expect(2) = 5e-81, Method: Composition-based stats.
 Identities = 66/72 (92%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCTK+GL+  AAQERL IFG+NKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTKEGLSGPAAQERLAIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_007210395.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
 emb|CAB69824.1| plasma membrane H+ ATPase [Prunus persica]
 gb|EMJ11594.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
Length=956

 Score =   222 bits (566),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E++
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A +LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  149  AGVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKSPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   106 bits (264),  Expect(2) = 6e-81, Method: Composition-based stats.
 Identities = 65/72 (90%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_009343433.1| PREDICTED: ATPase 11, plasma membrane-type-like [Pyrus x bretschneideri]
Length=956

 Score =   222 bits (565),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGI+TLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIMTLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESL VTK PGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLAVTKSPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   106 bits (265),  Expect(2) = 6e-81, Method: Composition-based stats.
 Identities = 65/72 (90%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>gb|KDO76029.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=673

 Score =   228 bits (582),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPK KVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKGKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (248),  Expect(2) = 6e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
 gb|ESR52905.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
Length=954

 Score =   228 bits (581),  Expect(2) = 6e-81, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPK KVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKGKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (248),  Expect(2) = 6e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|AFC88896.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=956

 Score =   228 bits (580),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED
Sbjct  89   NGGGKPPDWQDFVGIITLLFINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (249),  Expect(2) = 7e-81, Method: Composition-based stats.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKE VDLENIPIEEVFENLRC+K+GLT+Q+A+ERL IFG NKLEEKKESKFLK
Sbjct  5    PEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTTQSAEERLAIFGQNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=954

 Score =   228 bits (581),  Expect(2) = 8e-81, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPK KVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKGKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (248),  Expect(2) = 8e-81, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_002318614.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEE96834.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=966

 Score =   227 bits (579),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (249),  Expect(2) = 9e-81, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEV ENLRC+++GLT+QAA+ERL IFGHNKLEEKKE KFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKERKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_002511508.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF52110.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=801

 Score =   227 bits (578),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAK+LRDGRWSE+D
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKILRDGRWSEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (250),  Expect(2) = 1e-80, Method: Composition-based stats.
 Identities = 63/71 (89%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KDP31195.1| hypothetical protein JCGZ_11571 [Jatropha curcas]
Length=956

 Score =   227 bits (579),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (248),  Expect(2) = 1e-80, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKE VDLENIPIEEVFENLRC+K+GLT++AA+ERL IFGHNKLEEK+ESKFLKF
Sbjct  6    EVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTTEAAEERLAIFGHNKLEEKQESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_004171391.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 4, plasma membrane-type-like 
[Cucumis sativus]
Length=959

 Score =   225 bits (573),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAALMA LAP+AK+LRDGRWS +D
Sbjct  92   NGGGKPPDWQDFVGIIALLLINSTISFIEENNAGNAAAALMASLAPQAKILRDGRWSVQD  151

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  152  ASVLVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  211

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  212  GEIEAVVIATGVHTFF  227


 Score =   102 bits (254),  Expect(2) = 1e-80, Method: Composition-based stats.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK LK
Sbjct  8    PEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESKVLK  67

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  68   FLGFMWNPLSWV  79



>dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=956

 Score =   222 bits (566),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKAPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   104 bits (260),  Expect(2) = 1e-80, Method: Composition-based stats.
 Identities = 65/72 (90%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLENIPIEEVFENLRC+++GLTS+AA+ERL IFGHNKLEEKKESKFLK
Sbjct  5    PEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAEERLAIFGHNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_004138147.1| PREDICTED: ATPase 4, plasma membrane-type-like [Cucumis sativus]
Length=959

 Score =   224 bits (572),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAALMA LAP+AK+LRDGRWS +D
Sbjct  92   NGGGKPPDWQDFVGIIALLLINSTISFIEENNAGNAAAALMASLAPQAKILRDGRWSVQD  151

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  152  ASVLVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  211

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  212  GEIEAVVIATGVHTFF  227


 Score =   102 bits (254),  Expect(2) = 2e-80, Method: Composition-based stats.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK LK
Sbjct  8    PEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESKVLK  67

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  68   FLGFMWNPLSWV  79



>ref|XP_011042618.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
 ref|XP_011042619.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
Length=956

 Score =   227 bits (578),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   100 bits (248),  Expect(2) = 2e-80, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLENIPIEEV ENLRC+++GLT+QAA+ERL IFGHNKLEEKKE KFLKF
Sbjct  6    EVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKERKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia]
Length=956

 Score =   223 bits (567),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGII LL INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+WSE D
Sbjct  89   NGGGKPPDWQDFVGIIVLLFINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWSEYD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDI+S+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIVSIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score =   103 bits (256),  Expect(2) = 4e-80, Method: Composition-based stats.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKE VDLENIPIEEVFENLRC+K+GLT+ AA+ERL IFGHNKLEEKK+SKFLK
Sbjct  5    PEVLDAVLKEVVDLENIPIEEVFENLRCSKEGLTTVAAEERLAIFGHNKLEEKKDSKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_008453171.1| PREDICTED: plasma membrane ATPase 3 [Cucumis melo]
Length=959

 Score =   223 bits (569),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAALMA LAP+AK+LRDGRWS +D
Sbjct  92   NGGGKPPDWQDFVGIIALLLINSTISFIEENNAGNAAAALMASLAPQAKILRDGRWSVQD  151

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ
Sbjct  152  ASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  211

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  212  GEIEAVVIATGVHTFF  227


 Score =   102 bits (254),  Expect(2) = 4e-80, Method: Composition-based stats.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK LK
Sbjct  8    PEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESKILK  67

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  68   FLGFMWNPLSWV  79



>ref|XP_010678593.1| PREDICTED: plasma membrane ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=963

 Score =   228 bits (581),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMA LAPKAK+LRDGRWSEED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMASLAPKAKILRDGRWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKNPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 97.1 bits (240),  Expect(2) = 6e-80, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKE VDLENIP+EEVFENLRC+K+GLTS AAQERL IFG NKLEEKKESK LKF
Sbjct  6    EVLEAVLKEAVDLENIPLEEVFENLRCSKEGLTSDAAQERLAIFGPNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KHN19372.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   227 bits (578),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 97.8 bits (242),  Expect(2) = 7e-80, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    QVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_003527056.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=956

 Score =   227 bits (578),  Expect(2) = 7e-80, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 97.8 bits (242),  Expect(2) = 7e-80, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    QVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_002282263.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 ref|XP_010661009.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 emb|CBI35033.3| unnamed protein product [Vitis vinifera]
Length=955

 Score =   228 bits (580),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+WSEED
Sbjct  89   NGGGKPPDWQDFVGIITLLFINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDILPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 97.4 bits (241),  Expect(2) = 8e-80, Method: Composition-based stats.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVL+AVLKE VDLENIPIEEVF+NLRC  +GL+++AA ERL IFGHNKLEEK+ESK LK
Sbjct  5    PEVLEAVLKEAVDLENIPIEEVFQNLRCNANGLSTEAANERLAIFGHNKLEEKEESKVLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   226 bits (576),  Expect(2) = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWNEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 99.0 bits (245),  Expect(2) = 8e-80, Method: Composition-based stats.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLE+IPIEEVFENLRC+KDGLTS  A ERL IFGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLESIPIEEVFENLRCSKDGLTSSGALERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_003523043.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN08862.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   227 bits (578),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 97.8 bits (242),  Expect(2) = 9e-80, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    QVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_010272214.1| PREDICTED: ATPase 11, plasma membrane-type-like [Nelumbo nucifera]
Length=955

 Score =   226 bits (577),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPK KVLRDG+WSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKGKVLRDGKWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 98.2 bits (243),  Expect(2) = 9e-80, Method: Composition-based stats.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  7    VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkfl  186
            +L+AVLKE VDLENIPIEEVFENLRC K+GLT++AAQERL IFGHNKLEEK+ESK LKFL
Sbjct  7    ILEAVLKEAVDLENIPIEEVFENLRCNKEGLTTEAAQERLVIFGHNKLEEKQESKILKFL  66

Query  187  gfMWNPLSWV  216
            GFMWNPLSWV
Sbjct  67   GFMWNPLSWV  76



>gb|KEH31901.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   221 bits (564),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  91   NGGGKAPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  150

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  151  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  210

Query  612  GEIEAVVIATGVHTFF  659
            GEIE VVIATGVHTFF
Sbjct  211  GEIEGVVIATGVHTFF  226


 Score =   102 bits (254),  Expect(2) = 1e-79, Method: Composition-based stats.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PE L+AVLKETVDLENIPIEEVFENLRC+++GLTS+AA++RL IFGHNKLEEK+ESKFLK
Sbjct  7    PETLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAEQRLTIFGHNKLEEKRESKFLK  66

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  67   FLGFMWNPLSWV  78



>ref|XP_007138219.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
 gb|ESW10213.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
Length=956

 Score =   225 bits (573),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSE+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDI+S+KLGDIIPAD+RLL+GDPLKIDQSALTGESLPV+KGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIVSIKLGDIIPADSRLLEGDPLKIDQSALTGESLPVSKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 99.0 bits (245),  Expect(2) = 1e-79, Method: Composition-based stats.
 Identities = 61/71 (86%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            +VL+AVLKETVDLENIP+EEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKE KFLKF
Sbjct  6    QVLEAVLKETVDLENIPVEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKERKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_008807875.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807876.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807878.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807879.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
Length=956

 Score =   229 bits (583),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  SAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 94.7 bits (234),  Expect(2) = 2e-79, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEK+ESK LKFLG
Sbjct  8    LDAVLKEAVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKEESKILKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_009398402.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score =   228 bits (581),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  94   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEEE  153

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  154  AAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  213

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  214  GELEAVVIATGVHTFF  229


 Score = 95.1 bits (235),  Expect(2) = 2e-79, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  73   FMWNPLSWV  81



>gb|EPS66977.1| hypothetical protein M569_07799, partial [Genlisea aurea]
Length=922

 Score =   222 bits (565),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGG KPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+WSEE+
Sbjct  86   NGGNKPPDWQDFVGIITLLMINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWSEEE  145

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPAD+RLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  146  ASILVPGDIISIKLGDIIPADSRLLEGDPLKIDQSALTGESLPVTKSPGDGVYSGSTCKQ  205

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  206  GEIEAVVIATGVHTFF  221


 Score =   101 bits (252),  Expect(2) = 2e-79, Method: Composition-based stats.
 Identities = 63/72 (88%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPI+EV ENLRC+++GL+S++AQERL IFGHNKLEEKKESKFLK
Sbjct  2    PEVLDAVLKETVDLENIPIDEVLENLRCSREGLSSESAQERLAIFGHNKLEEKKESKFLK  61

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  62   FLGFMWNPLSWV  73



>ref|XP_010112580.1| ATPase 11, plasma membrane-type [Morus notabilis]
 gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis]
Length=950

 Score =   223 bits (568),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSE+D
Sbjct  89   NGGGKPPDWQDFVGIITLLFINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+ ADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIVAADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 99.8 bits (247),  Expect(2) = 3e-79, Method: Composition-based stats.
 Identities = 62/72 (86%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PE L+AVLKETVDLENIPIEEVFENLRC+K+GLT++AA++RL IFG+NKLEEKKESKFLK
Sbjct  5    PEALEAVLKETVDLENIPIEEVFENLRCSKEGLTTEAAEQRLTIFGYNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>ref|XP_010923303.1| PREDICTED: plasma membrane ATPase 3-like [Elaeis guineensis]
Length=956

 Score =   228 bits (582),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 94.0 bits (232),  Expect(2) = 5e-79, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLENIP+EEVFENLRCT++GLT++ A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  8    LEAVLKEAVDLENIPLEEVFENLRCTREGLTTEQAEERLAIFGHNKLEEKKESKILKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_010459221.1| PREDICTED: ATPase 11, plasma membrane-type-like [Camelina sativa]
Length=956

 Score =   224 bits (571),  Expect(2) = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 97.4 bits (241),  Expect(2) = 6e-79, Method: Composition-based stats.
 Identities = 61/71 (86%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLTS+AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIEEVFESLRCSREGLTSEAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_009398400.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score =   226 bits (576),  Expect(2) = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EE+
Sbjct  94   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWKEEE  153

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  154  SAILVPGDIISIKLGDIIPADSRLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  213

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  214  GEIEAVVIATGVHTFF  229


 Score = 95.5 bits (236),  Expect(2) = 6e-79, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  73   FMWNPLSWV  81



>ref|XP_009398401.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   226 bits (576),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EE+
Sbjct  94   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWKEEE  153

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  154  SAILVPGDIISIKLGDIIPADSRLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  213

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  214  GEIEAVVIATGVHTFF  229


 Score = 95.5 bits (236),  Expect(2) = 7e-79, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  73   FMWNPLSWV  81



>ref|XP_007155352.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27346.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=810

 Score =   224 bits (570),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKAPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 97.4 bits (241),  Expect(2) = 7e-79, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            +VL+AVLKETVDLENIPIEEV ENLRC+++GL+S+AA+ERL IFGHNKLEEK+ESKFLKF
Sbjct  6    QVLEAVLKETVDLENIPIEEVLENLRCSREGLSSEAAEERLTIFGHNKLEEKRESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|NP_201073.1| H(+)-ATPase 11 [Arabidopsis thaliana]
 sp|Q9LV11.1|PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type; AltName: Full=Proton 
pump 11 [Arabidopsis thaliana]
 dbj|BAA97214.1| plasma membrane proton ATPase-like [Arabidopsis thaliana]
 gb|AAM78085.1| AT5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AAR23718.1| At5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AED97641.1| H(+)-ATPase 11 [Arabidopsis thaliana]
Length=956

 Score =   224 bits (572),  Expect(2) = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 96.7 bits (239),  Expect(2) = 9e-79, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>emb|CAB41144.1| H+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=960

 Score =   222 bits (565),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  93   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  152

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK  GDG+YSGSTCKQ
Sbjct  153  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKSSGDGVYSGSTCKQ  212

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  213  GEIEAVVIATGVHTFF  228


 Score = 99.4 bits (246),  Expect(2) = 1e-78, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKE VDLEN+PIEEVFENLRC+K+GLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  10   EVLEAVLKEAVDLENVPIEEVFENLRCSKEGLTTQAADERLALFGHNKLEEKKESKFLKF  69

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  70   LGFMWNPLSWV  80



>ref|XP_007155353.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27347.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=955

 Score =   224 bits (570),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKAPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 97.1 bits (240),  Expect(2) = 1e-78, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            +VL+AVLKETVDLENIPIEEV ENLRC+++GL+S+AA+ERL IFGHNKLEEK+ESKFLKF
Sbjct  6    QVLEAVLKETVDLENIPIEEVLENLRCSREGLSSEAAEERLTIFGHNKLEEKRESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_006394361.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
 dbj|BAJ34039.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31647.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
Length=956

 Score =   224 bits (571),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 96.7 bits (239),  Expect(2) = 1e-78, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|NP_190378.2| H(+)-ATPase 4 [Arabidopsis thaliana]
 sp|Q9SU58.2|PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type; AltName: Full=Proton 
pump 4 [Arabidopsis thaliana]
 dbj|BAC42716.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE78350.1| H(+)-ATPase 4 [Arabidopsis thaliana]
Length=960

 Score =   221 bits (564),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  93   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  152

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK  GDG+YSGSTCKQ
Sbjct  153  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKSSGDGVYSGSTCKQ  212

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  213  GEIEAVVIATGVHTFF  228


 Score = 99.4 bits (246),  Expect(2) = 1e-78, Method: Composition-based stats.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKE VDLEN+PIEEVFENLRC+K+GLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  10   EVLEAVLKEAVDLENVPIEEVFENLRCSKEGLTTQAADERLALFGHNKLEEKKESKFLKF  69

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  70   LGFMWNPLSWV  80



>gb|KHN13245.1| Plasma membrane ATPase 1 [Glycine soja]
Length=956

 Score =   232 bits (592),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IM+IALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAK LR
Sbjct  81   AIMSIALANGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKFLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +
Sbjct  141  DGKWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEI AVVIATGVHTFF
Sbjct  201  YSGSTCKQGEINAVVIATGVHTFF  224


 Score = 88.6 bits (218),  Expect(2) = 1e-78, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E + AVLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKESK LKF
Sbjct  6    EAMHAVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLVIFGHNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWVPDA  225
            LGFMWNPLSWV +A
Sbjct  66   LGFMWNPLSWVMEA  79



>ref|XP_009130230.1| PREDICTED: ATPase 11, plasma membrane-type isoform X3 [Brassica 
rapa]
Length=939

 Score =   225 bits (573),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 95.5 bits (236),  Expect(2) = 1e-78, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_009130228.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Brassica 
rapa]
Length=979

 Score =   224 bits (572),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 95.5 bits (236),  Expect(2) = 2e-78, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_009130229.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Brassica 
rapa]
Length=956

 Score =   224 bits (572),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 95.5 bits (236),  Expect(2) = 2e-78, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_004508787.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=979

 Score =   220 bits (561),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  91   NGGGKAPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  150

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  151  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  210

Query  612  GEIEAVVIATGVHTFF  659
            GEIE VVIATGVHTFF
Sbjct  211  GEIEGVVIATGVHTFF  226


 Score = 99.8 bits (247),  Expect(2) = 2e-78, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKFLK
Sbjct  7    PEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKFLK  66

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  67   FLGFMWNPLSWV  78



>ref|XP_004508788.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=960

 Score =   220 bits (561),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  91   NGGGKAPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  150

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  151  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  210

Query  612  GEIEAVVIATGVHTFF  659
            GEIE VVIATGVHTFF
Sbjct  211  GEIEGVVIATGVHTFF  226


 Score = 99.8 bits (247),  Expect(2) = 2e-78, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKFLK
Sbjct  7    PEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKFLK  66

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  67   FLGFMWNPLSWV  78



>dbj|BAA06629.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=957

 Score =   236 bits (601),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIVLANGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            +GRWSEE+A+ILVPGDIISVK GDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+
Sbjct  141  NGRWSEEEAAILVPGDIISVKRGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 84.3 bits (207),  Expect(2) = 2e-78, Method: Composition-based stats.
 Identities = 54/72 (75%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKESKFLKFLG
Sbjct  8    LEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGLNRLEEKKESKFLKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X3 [Cicer 
arietinum]
Length=958

 Score =   221 bits (563),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  91   NGGGKAPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  150

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  151  AAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  210

Query  612  GEIEAVVIATGVHTFF  659
            GEIE VVIATGVHTFF
Sbjct  211  GEIEGVVIATGVHTFF  226


 Score = 99.0 bits (245),  Expect(2) = 2e-78, Method: Composition-based stats.
 Identities = 60/72 (83%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKFLK
Sbjct  7    PEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKFLK  66

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  67   FLGFMWNPLSWV  78



>ref|XP_003525017.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN48653.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   224 bits (570),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKAPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 96.3 bits (238),  Expect(2) = 2e-78, Method: Composition-based stats.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            +VL+AVLKETVDLENIPIEEV ENLRC ++GL+S+AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    QVLEAVLKETVDLENIPIEEVLENLRCGREGLSSEAAEERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_010444121.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=956

 Score =   224 bits (572),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 95.1 bits (235),  Expect(2) = 3e-78, Method: Composition-based stats.
 Identities = 59/71 (83%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PI+EVFE+LRC+++GLT++AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIDEVFESLRCSREGLTTEAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_010444120.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=959

 Score =   224 bits (571),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 95.1 bits (235),  Expect(2) = 3e-78, Method: Composition-based stats.
 Identities = 59/71 (83%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+PI+EVFE+LRC+++GLT++AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVPIDEVFESLRCSREGLTTEAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_003549657.1| PREDICTED: ATPase 11, plasma membrane-type-like [Glycine max]
 gb|KHN18516.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   223 bits (567),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGK PDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKAPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 96.7 bits (239),  Expect(2) = 4e-78, Method: Composition-based stats.
 Identities = 61/71 (86%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            +VL+AVLKETVDLENIPIEEV ENLRC ++GL+S+AA+ERL IFGHNKLEEKKESKFLKF
Sbjct  6    QVLEAVLKETVDLENIPIEEVLENLRCGREGLSSEAAEERLTIFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_008796652.1| PREDICTED: plasma membrane ATPase 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008796653.1| PREDICTED: plasma membrane ATPase 3 isoform X2 [Phoenix dactylifera]
Length=956

 Score =   227 bits (578),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWKEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  209  GEIEAIVIATGVHTFF  224


 Score = 92.4 bits (228),  Expect(2) = 4e-78, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEKKESKFLKFLG
Sbjct  8    LEAVLKEAVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKKESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_006290560.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
 gb|EOA23458.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
Length=956

 Score =   224 bits (570),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWNEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS LTGESLPVTK PGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSTLTGESLPVTKSPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 95.5 bits (236),  Expect(2) = 4e-78, Method: Composition-based stats.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKE VDLEN+PIEEVFE LRC+K+GLT+QAA +RL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKEAVDLENVPIEEVFETLRCSKEGLTTQAADDRLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_010933786.1| PREDICTED: plasma membrane ATPase 3 [Elaeis guineensis]
Length=956

 Score =   224 bits (572),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWREEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  SAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 94.4 bits (233),  Expect(2) = 4e-78, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  8    LDAVLKEVVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKKESKILKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_010028675.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW83493.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=955

 Score =   235 bits (600),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+
Sbjct  141  DGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 82.8 bits (203),  Expect(2) = 7e-78, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  7    VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkfl  186
            VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKESKF KFL
Sbjct  7    VLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKESKFFKFL  66

Query  187  gfMWNPLSWV  216
            GFMWNPLSWV
Sbjct  67   GFMWNPLSWV  76



>gb|KCW83494.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=954

 Score =   235 bits (600),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+
Sbjct  141  DGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 82.8 bits (203),  Expect(2) = 7e-78, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  7    VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkfl  186
            VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKESKF KFL
Sbjct  7    VLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKESKFFKFL  66

Query  187  gfMWNPLSWV  216
            GFMWNPLSWV
Sbjct  67   GFMWNPLSWV  76



>gb|KCW83495.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=924

 Score =   235 bits (599),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGDG+
Sbjct  141  DGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 82.8 bits (203),  Expect(2) = 8e-78, Method: Composition-based stats.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  7    VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkfl  186
            VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKESKF KFL
Sbjct  7    VLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKESKFFKFL  66

Query  187  gfMWNPLSWV  216
            GFMWNPLSWV
Sbjct  67   GFMWNPLSWV  76



>emb|CDY45757.1| BnaC02g42250D [Brassica napus]
Length=962

 Score =   225 bits (573),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW E+D
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWGEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVHTFF
Sbjct  209  GELEAVVIATGVHTFF  224


 Score = 92.4 bits (228),  Expect(2) = 1e-77, Method: Composition-based stats.
 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AVLKETVDLEN+ IEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKESKFLKF
Sbjct  6    EVLEAVLKETVDLENVAIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_006837363.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
 gb|ERN00217.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
Length=1007

 Score =   226 bits (577),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANGGGK PD+ DF GI+ LLVINSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  125  AIMAIALANGGGKDPDYIDFCGIVILLVINSTISFIEENNAGNAAAALMARLAPKAKVLR  184

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSEEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  185  DGRWSEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDGV  244

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  245  YSGSTCKQGEIEAVVIATGVHTFF  268


 Score = 90.5 bits (223),  Expect(2) = 2e-77, Method: Composition-based stats.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAV KE VDLENIPIEEVFE+L CT++GLTS+A QERL++FG+NKLEEKKESK LKFLG
Sbjct  52   LDAVNKEAVDLENIPIEEVFESLECTQEGLTSEAVQERLELFGYNKLEEKKESKLLKFLG  111

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV ++
Sbjct  112  FMWNPLSWVMES  123



>ref|XP_007032427.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY03353.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
Length=994

 Score =   223 bits (569),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKV RDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLFINSTISFIEENNAGNAAAALMARLAPKAKVFRDGKWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGD IYSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDSIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 93.2 bits (230),  Expect(2) = 2e-77, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E LDAVLKE VDLEN+P+EEVF+ LRC KDGLT++AA++RL IFG+NKLEEKKESK LKF
Sbjct  6    ETLDAVLKEAVDLENVPLEEVFQTLRCNKDGLTTEAAEQRLAIFGYNKLEEKKESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KJB33644.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=811

 Score =   224 bits (572),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKV RDG+WSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLTINSTISFIEENNAGNAAAALMARLAPKAKVFRDGKWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLLDGDPLKIDQS+LTGESLPVTKGPGD IYSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLDGDPLKIDQSSLTGESLPVTKGPGDSIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 91.7 bits (226),  Expect(2) = 3e-77, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ESK LKF
Sbjct  6    ETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_007032428.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY03354.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
Length=956

 Score =   223 bits (569),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKV RDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLFINSTISFIEENNAGNAAAALMARLAPKAKVFRDGKWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGD IYSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDSIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 92.8 bits (229),  Expect(2) = 3e-77, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E LDAVLKE VDLEN+P+EEVF+ LRC KDGLT++AA++RL IFG+NKLEEKKESK LKF
Sbjct  6    ETLDAVLKEAVDLENVPLEEVFQTLRCNKDGLTTEAAEQRLAIFGYNKLEEKKESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KJB33642.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=946

 Score =   224 bits (572),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKV RDG+WSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLTINSTISFIEENNAGNAAAALMARLAPKAKVFRDGKWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLLDGDPLKIDQS+LTGESLPVTKGPGD IYSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLDGDPLKIDQSSLTGESLPVTKGPGDSIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 91.7 bits (226),  Expect(2) = 3e-77, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ESK LKF
Sbjct  6    ETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KJB33641.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=956

 Score =   224 bits (570),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKV RDG+WSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLTINSTISFIEENNAGNAAAALMARLAPKAKVFRDGKWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLLDGDPLKIDQS+LTGESLPVTKGPGD IYSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLDGDPLKIDQSSLTGESLPVTKGPGDSIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 91.7 bits (226),  Expect(2) = 4e-77, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ESK LKF
Sbjct  6    ETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_004148685.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004162585.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   223 bits (567),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMA LAPKAKVLRDG+W EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMAHLAPKAKVLRDGKWVEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ASVLVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 92.8 bits (229),  Expect(2) = 4e-77, Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFGHNKLEEKKESK LKF
Sbjct  6    EVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGHNKLEEKKESKLLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|NP_001067382.1| Os12g0638700 [Oryza sativa Japonica Group]
 emb|CAD29296.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|ABA99607.1| Plasma membrane ATPase 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30401.1| Os12g0638700 [Oryza sativa Japonica Group]
Length=956

 Score =   222 bits (566),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  209  GEIEAIVIATGVHTFF  224


 Score = 93.2 bits (230),  Expect(2) = 5e-77, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>gb|KJB33643.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=871

 Score =   223 bits (569),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKV RDG+WSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLTINSTISFIEENNAGNAAAALMARLAPKAKVFRDGKWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLLDGDPLKIDQS+LTGESLPVTKGPGD IYSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLDGDPLKIDQSSLTGESLPVTKGPGDSIYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 91.7 bits (226),  Expect(2) = 5e-77, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ESK LKF
Sbjct  6    ETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_002442618.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
 gb|EES16456.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
Length=956

 Score =   224 bits (572),  Expect(2) = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 90.5 bits (223),  Expect(2) = 6e-77, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLENIP+EEVFENLRC+++GL++Q AQ+RL+IFG NKLEEK+ESKFLKFLG
Sbjct  8    LEAVLKEAVDLENIPLEEVFENLRCSREGLSTQQAQQRLEIFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>emb|CDP09440.1| unnamed protein product [Coffea canephora]
Length=966

 Score =   224 bits (570),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IM+IALANGGGK PD QDFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMSIALANGGGKGPDIQDFVGILLLLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  141  DGKWSEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEI+AVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIDAVVIATGVHTFF  224


 Score = 90.5 bits (223),  Expect(2) = 9e-77, Method: Composition-based stats.
 Identities = 56/72 (78%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAV+KE VDLENIP+EEVF+NL+CT+ GL+S A +ERLD+FG NKLEEKKESK LKFLG
Sbjct  8    LDAVIKEAVDLENIPLEEVFDNLKCTRKGLSSDAVKERLDLFGFNKLEEKKESKVLKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>ref|XP_004963335.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   223 bits (567),  Expect(2) = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGD++S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDVVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 92.0 bits (227),  Expect(2) = 9e-77, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP+EEVFENLRC+++GL++Q AQ+RL+IFG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKEAVDLENIPLEEVFENLRCSREGLSTQQAQQRLEIFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_011071717.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 3 [Sesamum 
indicum]
Length=952

 Score =   205 bits (522),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 127/136 (93%), Gaps = 4/136 (3%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIISVKLGD         +GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  ASILVPGDIISVKLGDX----XXXXEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  204

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  205  GEIEAIVIATGVHTFF  220


 Score =   108 bits (270),  Expect(2) = 1e-76, Method: Composition-based stats.
 Identities = 67/72 (93%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            PEVLDAVLKETVDLENIPIEEVFENLRCT++GLT++AAQERL IFGHNKLEEKKESKFLK
Sbjct  5    PEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTEAAQERLAIFGHNKLEEKKESKFLK  64

Query  181  flgfMWNPLSWV  216
            FLGFMWNPLSWV
Sbjct  65   FLGFMWNPLSWV  76



>tpg|DAA54787.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=812

 Score =   224 bits (572),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.0 bits (219),  Expect(2) = 1e-76, Method: Composition-based stats.
 Identities = 55/69 (80%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLENIP+EEVFENLRC+++GL+++ AQ+RL+IFG NKLEEK+ESKFLKFLG
Sbjct  8    LEAVLKEAVDLENIPLEEVFENLRCSREGLSTEQAQQRLEIFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_011031934.1| PREDICTED: plasma membrane ATPase 1 [Populus euphratica]
Length=965

 Score =   223 bits (567),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LA+GG K  D+ DFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIGLAHGGNKSADYHDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSEE+AS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  141  DGRWSEEEASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKSPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 91.3 bits (225),  Expect(2) = 2e-76, Method: Composition-based stats.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDA+ KE VDLENIP+EEVFENLRCT++GLT+   +ERLD+FG+NKLEE+KE+K LKFLG
Sbjct  8    LDAINKEAVDLENIPLEEVFENLRCTREGLTANEVRERLDLFGYNKLEEQKENKLLKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>ref|XP_006482527.1| PREDICTED: plasma membrane ATPase 1-like [Citrus sinensis]
Length=956

 Score =   224 bits (571),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMA LAPK+KVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMASLAPKSKVLRDGKWMEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  AAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.7 bits (221),  Expect(2) = 2e-76, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ESK LKF
Sbjct  6    ETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_008673350.1| PREDICTED: uncharacterized protein LOC100502231 isoform X1 [Zea 
mays]
 tpg|DAA54786.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=956

 Score =   224 bits (572),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.0 bits (219),  Expect(2) = 2e-76, Method: Composition-based stats.
 Identities = 55/69 (80%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLENIP+EEVFENLRC+++GL+++ AQ+RL+IFG NKLEEK+ESKFLKFLG
Sbjct  8    LEAVLKEAVDLENIPLEEVFENLRCSREGLSTEQAQQRLEIFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_010029279.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 ref|XP_010029280.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW56160.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=954

 Score =   224 bits (571),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLFINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ASILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.4 bits (220),  Expect(2) = 2e-76, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLEN+PI EVF+ LRC  +GLTS+AAQERL IFGHNKLEEK+ESKFLKFLG
Sbjct  8    LEAVLKEAVDLENVPIAEVFQTLRCQPNGLTSEAAQERLAIFGHNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>gb|KCW56159.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=963

 Score =   224 bits (570),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLFINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ASILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.4 bits (220),  Expect(2) = 2e-76, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLEN+PI EVF+ LRC  +GLTS+AAQERL IFGHNKLEEK+ESKFLKFLG
Sbjct  8    LEAVLKEAVDLENVPIAEVFQTLRCQPNGLTSEAAQERLAIFGHNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_006431062.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
 gb|ESR44302.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
Length=956

 Score =   224 bits (570),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGI+TLL+INSTISFIEENNAGNAAAALMA LAPK+KVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIVTLLLINSTISFIEENNAGNAAAALMASLAPKSKVLRDGKWMEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  AAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.7 bits (221),  Expect(2) = 2e-76, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ESK LKF
Sbjct  6    ETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KDO72464.1| hypothetical protein CISIN_1g0021762mg [Citrus sinensis]
Length=875

 Score =   223 bits (569),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGI+TLL+INSTISFIEENNAGNAAAALMA LAPK+KVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIVTLLLINSTISFIEENNAGNAAAALMASLAPKSKVLRDGKWMEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  AAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.7 bits (221),  Expect(2) = 2e-76, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ESK LKF
Sbjct  6    ETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_004982139.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=954

 Score =   223 bits (569),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDI+S+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDIVSIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.7 bits (221),  Expect(2) = 3e-76, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP+EEVFENLRC+  GLTS+ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKEAVDLENIPLEEVFENLRCSHGGLTSEQAQQRLQIFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>gb|KDO72462.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
 gb|KDO72463.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
Length=924

 Score =   223 bits (569),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGI+TLL+INSTISFIEENNAGNAAAALMA LAPK+KVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIVTLLLINSTISFIEENNAGNAAAALMASLAPKSKVLRDGKWMEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  AAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.7 bits (221),  Expect(2) = 3e-76, Method: Composition-based stats.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ESK LKF
Sbjct  6    ETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_010228253.1| PREDICTED: plasma membrane ATPase 3-like isoform X1 [Brachypodium 
distachyon]
Length=991

 Score =   224 bits (571),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWNEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  SAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 88.6 bits (218),  Expect(2) = 3e-76, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE+VDLENIP+EEVFENLRC+++GL+S  A++RL IFG NKLEEKKESKFLKFLG
Sbjct  8    LDAVLKESVDLENIPLEEVFENLRCSREGLSSTQAEQRLAIFGPNKLEEKKESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_006664787.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=956

 Score =   219 bits (558),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKG GDG+YSGST KQ
Sbjct  149  AAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGAGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  209  GEIEAIVIATGVHTFF  224


 Score = 93.6 bits (231),  Expect(2) = 3e-76, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_008459294.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis melo]
Length=956

 Score =   223 bits (567),  Expect(2) = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMA LAPKAKVLRDG+W EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMAHLAPKAKVLRDGKWVEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ASVLVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 90.1 bits (222),  Expect(2) = 3e-76, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFG NKLEEKKESK LKF
Sbjct  6    EVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGQNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KEH24965.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   225 bits (574),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGG KPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EED
Sbjct  89   NGGNKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWVEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ASILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 87.0 bits (214),  Expect(2) = 4e-76, Method: Composition-based stats.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E + AVL E VDLEN+PIEEVF+ LRC  +GLT++AA+ERL IFGHNKLEEK+ESKFLKF
Sbjct  6    EAMHAVLTEAVDLENVPIEEVFQTLRCDSNGLTTKAAEERLAIFGHNKLEEKQESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KEH24964.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=956

 Score =   225 bits (573),  Expect(2) = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGG KPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW EED
Sbjct  89   NGGNKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWVEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ASILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 87.4 bits (215),  Expect(2) = 4e-76, Method: Composition-based stats.
 Identities = 55/71 (77%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E + AVL E VDLEN+PIEEVF+ LRC  +GLT++AA+ERL IFGHNKLEEK+ESKFLKF
Sbjct  6    EAMHAVLTEAVDLENVPIEEVFQTLRCDSNGLTTKAAEERLAIFGHNKLEEKQESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_004955721.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   225 bits (573),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  SAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 87.0 bits (214),  Expect(2) = 5e-76, Method: Composition-based stats.
 Identities = 55/69 (80%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIPIEEVFENLRC+  GL+++ A++RL IFG NKLEEK+ESK LKFLG
Sbjct  8    LDAVLKEAVDLENIPIEEVFENLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKVLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_003578172.1| PREDICTED: plasma membrane ATPase 1 [Brachypodium distachyon]
Length=959

 Score =   222 bits (565),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAK+LRDGRW+EED
Sbjct  92   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKILRDGRWTEED  151

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGD++S+KLGDIIPADARLL+GDPLKIDQSALTGESLP TKGPGDG+YSGST KQ
Sbjct  152  AAILVPGDVVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKGPGDGVYSGSTVKQ  211

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  212  GEIEAVVIATGVHTFF  227


 Score = 90.1 bits (222),  Expect(2) = 5e-76, Method: Composition-based stats.
 Identities = 55/69 (80%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE+VDLENIP+EEVFENLRC++ GL++Q AQ+RL+IFG NKLEE++ESKFLKFLG
Sbjct  11   LEAVLKESVDLENIPLEEVFENLRCSRQGLSAQQAQQRLEIFGPNKLEEEEESKFLKFLG  70

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  71   FMWNPLSWV  79



>gb|KDP45466.1| hypothetical protein JCGZ_09715 [Jatropha curcas]
Length=956

 Score =   223 bits (569),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRD RW EED
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDERWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ASILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 88.6 bits (218),  Expect(2) = 6e-76, Method: Composition-based stats.
 Identities = 55/71 (77%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E L+AVLKE VDLEN+PIEEVF+ LRC  +GLT++AA++RL IFG+NKLEEK+ESKFLKF
Sbjct  6    ETLEAVLKEVVDLENVPIEEVFQTLRCNSNGLTTEAAEQRLTIFGYNKLEEKQESKFLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_010228254.1| PREDICTED: plasma membrane ATPase 3-like isoform X2 [Brachypodium 
distachyon]
Length=956

 Score =   223 bits (569),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWNEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQS+LTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  SAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSSLTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 88.2 bits (217),  Expect(2) = 6e-76, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE+VDLENIP+EEVFENLRC+++GL+S  A++RL IFG NKLEEKKESKFLKFLG
Sbjct  8    LDAVLKESVDLENIPLEEVFENLRCSREGLSSTQAEQRLAIFGPNKLEEKKESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_008650970.1| PREDICTED: uncharacterized protein LOC100216710 isoform X1 [Zea 
mays]
 tpg|DAA59903.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=956

 Score =   223 bits (569),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGG KPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRW+EE+
Sbjct  89   NGGNKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  SAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 88.2 bits (217),  Expect(2) = 8e-76, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIPIEEVFENLRC+  GLT++ A++RL IFG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKEAVDLENIPIEEVFENLRCSPQGLTTEQAEQRLAIFGPNKLEEKQESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_003561110.1| PREDICTED: plasma membrane ATPase 1-like [Brachypodium distachyon]
Length=956

 Score =   220 bits (560),  Expect(2) = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLP TKGPGDG+YSGST KQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPATKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEI+AVVIATGVHTFF
Sbjct  209  GEIKAVVIATGVHTFF  224


 Score = 91.7 bits (226),  Expect(2) = 8e-76, Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP++EVFENLRC ++GLTSQ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKEVVDLENIPVDEVFENLRCGREGLTSQQAQQRLQIFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_007214948.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
 gb|EMJ16147.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
Length=956

 Score =   223 bits (568),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMA LAPKAKV R GRW EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMAHLAPKAKVFRGGRWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 87.8 bits (216),  Expect(2) = 1e-75, Method: Composition-based stats.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E LDAVLKE VDLEN+P+EEVF  LRC + GLTS+AA++RL IFG+NKLEEKKESK LKF
Sbjct  6    ETLDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_009417143.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=955

 Score =   223 bits (567),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR G+WSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRGGKWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLGGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 88.6 bits (218),  Expect(2) = 1e-75, Method: Composition-based stats.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            ++AVLKE VDLENIP+EEVFENLRC ++GLT++ AQ+RL+IFG NKLEEKKESK LKFLG
Sbjct  8    MEAVLKEAVDLENIPLEEVFENLRCGREGLTAEQAQQRLEIFGPNKLEEKKESKVLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_008230721.1| PREDICTED: plasma membrane ATPase 1-like [Prunus mume]
Length=959

 Score =   225 bits (573),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMA LAPKAKV RDGRW E+D
Sbjct  92   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMAHLAPKAKVFRDGRWIEQD  151

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  152  ASILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  211

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  212  GEIEAVVIATGVHTFF  227


 Score = 85.9 bits (211),  Expect(2) = 1e-75, Method: Composition-based stats.
 Identities = 55/69 (80%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLEN+P+EEVF  LRC + GLTS+AA++RL IFG+NKLEEKKESK LKFLG
Sbjct  11   LDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEKKESKVLKFLG  70

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  71   FMWNPLSWV  79



>ref|XP_006375124.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP52921.1| H+-ATPase family protein [Populus trichocarpa]
Length=965

 Score =   222 bits (566),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LA+GG K  D+ DFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   AIMAIGLAHGGNKSADYHDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSEE+AS+LVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  141  DGRWSEEEASVLVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKSPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 88.2 bits (217),  Expect(2) = 1e-75, Method: Composition-based stats.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDA+ KE VDLENIP+EEVF+NL+CT++GLT+   +ERLD+FG+NKLEEKKESK LKFLG
Sbjct  8    LDAINKEAVDLENIPLEEVFDNLKCTREGLTANEVRERLDLFGYNKLEEKKESKLLKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>ref|NP_001059093.1| Os07g0191200 [Oryza sativa Japonica Group]
 emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAC83861.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAF21007.1| Os07g0191200 [Oryza sativa Japonica Group]
Length=957

 Score =   227 bits (579),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRWSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 83.2 bits (204),  Expect(2) = 2e-75, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKESKFLKFLG
Sbjct  8    LEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_006658357.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=957

 Score =   227 bits (579),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRWSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 82.8 bits (203),  Expect(2) = 2e-75, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKESKFLKFLG
Sbjct  8    LEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>gb|EEC81667.1| hypothetical protein OsI_25220 [Oryza sativa Indica Group]
 gb|EEE66722.1| hypothetical protein OsJ_23404 [Oryza sativa Japonica Group]
Length=951

 Score =   227 bits (579),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 136/136 (100%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRWSEE+
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  AAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 82.8 bits (203),  Expect(2) = 2e-75, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKESKFLKFLG
Sbjct  8    LEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_002459489.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
 gb|EER96010.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
Length=956

 Score =   223 bits (568),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGG KPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRW+EE+
Sbjct  89   NGGNKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  149  SAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 86.7 bits (213),  Expect(2) = 2e-75, Method: Composition-based stats.
 Identities = 54/69 (78%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIPIEEVFENLRC+  GL+++ A++RL IFG NKLEEK+ESK  KFLG
Sbjct  8    LDAVLKEAVDLENIPIEEVFENLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKIFKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>gb|KDP28822.1| hypothetical protein JCGZ_14593 [Jatropha curcas]
Length=966

 Score =   216 bits (549),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/136 (91%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            +GGGK PD+ DFVGI+ LLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+WSEED
Sbjct  89   HGGGKSPDYHDFVGIVILLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWSEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  149  ASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 94.4 bits (233),  Expect(2) = 2e-75, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAV+KE VDLENIP+EEVF++L+CTK+GL+S A QERLD+FGHNKLEEKKESK LKFLG
Sbjct  8    LDAVIKEAVDLENIPLEEVFDHLKCTKNGLSSDAVQERLDLFGHNKLEEKKESKILKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_008644894.1| PREDICTED: uncharacterized protein LOC100383411 isoform X1 [Zea 
mays]
Length=954

 Score =   220 bits (560),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWAEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGD+IS+KLGDIIPADARLLDGDPLKIDQS+LTGESLPVTKGPGDG YSGST KQ
Sbjct  149  AAVLVPGDVISIKLGDIIPADARLLDGDPLKIDQSSLTGESLPVTKGPGDGAYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.7 bits (221),  Expect(2) = 2e-75, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP+EEVFENLRC++ GLTS+ AQ+RL +FG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKEAVDLENIPLEEVFENLRCSRGGLTSEQAQQRLQLFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_006440236.1| hypothetical protein CICLE_v10018727mg [Citrus clementina]
 gb|ESR53476.1| hypothetical protein CICLE_v10018727mg [Citrus clementina]
Length=959

 Score =   219 bits (558),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   ALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  141  DGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 90.5 bits (223),  Expect(2) = 3e-75, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>gb|KDO61318.1| hypothetical protein CISIN_1g002151mg [Citrus sinensis]
Length=959

 Score =   219 bits (558),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   ALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  141  DGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 90.1 bits (222),  Expect(2) = 3e-75, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>ref|XP_006477127.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=958

 Score =   219 bits (558),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   ALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  141  DGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 90.1 bits (222),  Expect(2) = 3e-75, Method: Composition-based stats.
 Identities = 55/72 (76%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>gb|EMT26085.1| Plasma membrane ATPase 1 [Aegilops tauschii]
Length=969

 Score =   221 bits (562),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  90   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEEE  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDI+S+KLGDIIPADARLLDGDPLKIDQSALTGESLP TKGPGDG+YSGST KQ
Sbjct  150  AAVLVPGDIVSIKLGDIIPADARLLDGDPLKIDQSALTGESLPATKGPGDGVYSGSTVKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  210  GEIEAVVIATGVHTFF  225


 Score = 88.6 bits (218),  Expect(2) = 3e-75, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLE+IPI+EVFENLRC+  GLTS+ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9    LDAVLKEAVDLEHIPIDEVFENLRCSHQGLTSEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  69   FMWNPLSWV  77



>dbj|BAK04567.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   223 bits (567),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAK+LRDGRW+EED
Sbjct  90   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKILRDGRWTEED  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQSALTGESLP TKGPGDGIYSGST KQ
Sbjct  150  AAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKGPGDGIYSGSTVKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  210  GEIEAVVIATGVHTFF  225


 Score = 85.9 bits (211),  Expect(2) = 6e-75, Method: Composition-based stats.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9    LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  69   FMWNPLSWV  77



>dbj|BAJ92653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   223 bits (567),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/136 (94%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAK+LRDGRW+EED
Sbjct  90   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKILRDGRWTEED  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQSALTGESLP TKGPGDGIYSGST KQ
Sbjct  150  AAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKGPGDGIYSGSTVKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  210  GEIEAVVIATGVHTFF  225


 Score = 85.9 bits (211),  Expect(2) = 7e-75, Method: Composition-based stats.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9    LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  69   FMWNPLSWV  77



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   232 bits (592),  Expect(2) = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   AVMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  142  DGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 75.9 bits (185),  Expect(2) = 7e-75, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLE +PIEEVFE L+CT++GLTSQ    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNENVDLERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESKVLKFLG  68

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  69   FMWNPLSWV  77



>ref|XP_007151191.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
 gb|ESW23185.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
Length=956

 Score =   219 bits (558),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A +LVPGDI+SVKLGDIIPAD+RLL+GDPLKIDQSALTGESLPVTKGPGD +YSGSTCKQ
Sbjct  149  ACVLVPGDIVSVKLGDIIPADSRLLEGDPLKIDQSALTGESLPVTKGPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEI AVVIATGVHTFF
Sbjct  209  GEINAVVIATGVHTFF  224


 Score = 88.2 bits (217),  Expect(2) = 1e-74, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E + AVLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEK+ESK LKF
Sbjct  6    EAMHAVLKEAVDLENVPLEEVFQTLRCDSNGLTTKSAEERLSIFGHNKLEEKQESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   229 bits (585),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   AVMAIALANGSGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  142  DGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 77.8 bits (190),  Expect(2) = 1e-74, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IPIEEVFE L+CTK+GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV ++
Sbjct  69   FMWNPLSWVMES  80



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   224 bits (570),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI  LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 83.2 bits (204),  Expect(2) = 2e-74, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E+VDLE IPIEEVFE L+CTKDGLTS+  + RL IFGHNKLEEKKESK LKFLG
Sbjct  7    LEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEHRLQIFGHNKLEEKKESKILKFLG  66

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  67   FMWNPLSWV  75



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   228 bits (580),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  77   AVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAALMANLAPKTKVLR  136

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALTGESLPVTKGPGD +
Sbjct  137  DGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTKGPGDEV  196

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  197  FSGSTCKQGEIEAVVIATGVHTFF  220


 Score = 79.3 bits (194),  Expect(2) = 2e-74, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  64   FMWNPLSWV  72



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   227 bits (579),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  77   AVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAALMANLAPKTKVLR  136

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALTGESLPVTKGPGD +
Sbjct  137  DGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTKGPGDEV  196

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  197  FSGSTCKQGEIEAVVIATGVHTFF  220


 Score = 79.3 bits (194),  Expect(2) = 2e-74, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  64   FMWNPLSWV  72



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   227 bits (579),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  87   AVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAALMANLAPKTKVLR  146

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALTGESLPVTKGPGD +
Sbjct  147  DGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTGESLPVTKGPGDEV  206

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  207  FSGSTCKQGEIEAVVIATGVHTFF  230


 Score = 79.3 bits (194),  Expect(2) = 2e-74, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  14   LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  73

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  74   FMWNPLSWV  82



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   233 bits (595),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   AVMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSEEDA+ILVPGDIIS+KLGDI+PADARLLDGDPLKIDQSALTGESLPVTK PGD +
Sbjct  142  DGRWSEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALTGESLPVTKNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 72.4 bits (176),  Expect(2) = 3e-74, Method: Composition-based stats.
 Identities = 48/69 (70%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IP++EVFE L+CT++GL+S     RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  69   FMWNPLSWV  77



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   226 bits (577),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  79   AIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  138

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  139  DGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  198

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEA+VIATGVHTFF
Sbjct  199  FSGSTCKQGEIEAIVIATGVHTFF  222


 Score = 78.2 bits (191),  Expect(2) = 8e-74, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKFLG  65

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  66   FMWNPLSWV  74



>ref|XP_003554288.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=956

 Score =   219 bits (557),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAK LRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKFLRDGKWVEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKG GD +YSGSTCKQ
Sbjct  149  ASILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGHGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEI AVVIATGVHTFF
Sbjct  209  GEINAVVIATGVHTFF  224


 Score = 85.9 bits (211),  Expect(2) = 8e-74, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E +  VLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKESK LKF
Sbjct  6    EAMRVVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLAIFGHNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|KHN34200.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   219 bits (557),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAK LRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKFLRDGKWVEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKG GD +YSGSTCKQ
Sbjct  149  ASILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGHGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEI AVVIATGVHTFF
Sbjct  209  GEINAVVIATGVHTFF  224


 Score = 85.9 bits (211),  Expect(2) = 8e-74, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E +  VLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKESK LKF
Sbjct  6    EAMRVVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLAIFGHNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>ref|XP_011098566.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
 ref|XP_011098567.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
Length=955

 Score =   220 bits (560),  Expect(2) = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGG+PPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG W+EED
Sbjct  89   NGGGRPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGHWNEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGST KQ
Sbjct  149  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEA+VIATGVHTFF
Sbjct  209  GEIEALVIATGVHTFF  224


 Score = 84.7 bits (208),  Expect(2) = 9e-74, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E ++A+ +E VDLEN+P+EEVFENLRCT++GL+S+ A  RL+IFG NKLEEK+ESK LKF
Sbjct  6    EAMEALKREAVDLENVPLEEVFENLRCTREGLSSEDANRRLEIFGQNKLEEKEESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|EYU34115.1| hypothetical protein MIMGU_mgv1a000867mg [Erythranthe guttata]
Length=955

 Score =   219 bits (558),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG W+EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGHWNEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGD++S+KLGDIIPADARLLDGDPLKIDQSALTGESLP TK PGDG+YSGST KQ
Sbjct  149  AAVLVPGDVVSIKLGDIIPADARLLDGDPLKIDQSALTGESLPATKSPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 85.5 bits (210),  Expect(2) = 1e-73, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E ++A+ +E VDLENIPIEEVF+NLRCTK+GL+S+ A  RL+IFG+NKLEEK+ESK LKF
Sbjct  6    EAMEALKREAVDLENIPIEEVFDNLRCTKEGLSSEDAIRRLEIFGYNKLEEKEESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   230 bits (587),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+TLLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  78   AIMAIVLANGGGKPPDWQDFVGIMTLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  137

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  138  DGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKHPGDEV  197

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGE+EAVVIATGVHTFF
Sbjct  198  FSGSTCKQGELEAVVIATGVHTFF  221


 Score = 73.9 bits (180),  Expect(2) = 1e-73, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IPIEEVF  L+C+K+GLTS    +RL+IFG NKLEEKKESKFLKFLG
Sbjct  5    LEDIRNETVDLETIPIEEVFTQLKCSKEGLTSDEGAKRLEIFGPNKLEEKKESKFLKFLG  64

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV ++
Sbjct  65   FMWNPLSWVMES  76



>gb|EMS59303.1| Plasma membrane ATPase [Triticum urartu]
Length=1039

 Score =   227 bits (578),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 1/145 (1%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANGGG+PPDWQDFVGII LL++NSTIS+IEE+NAG++A ALMA LAPK KVLR
Sbjct  82   AIMAIALANGGGRPPDWQDFVGIIALLLLNSTISYIEESNAGSSAKALMANLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLL-DGDPLKIDQSALTGESLPVTKGPGDG  584
            DG+WSE+DASILVPGDIIS+KLGDI+PADARLL +GDPLKIDQSALTGESLPVTK PGD 
Sbjct  142  DGKWSEQDASILVPGDIISIKLGDIVPADARLLLEGDPLKIDQSALTGESLPVTKNPGDS  201

Query  585  IYSGSTCKQGEIEAVVIATGVHTFF  659
            +YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  VYSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 77.0 bits (188),  Expect(2) = 1e-73, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E L+ +  E VDLENIP+EEVFENL+C+  GLTS+  Q+R+ +FG NKLEEKKES+ LKF
Sbjct  7    EGLERIKNEAVDLENIPVEEVFENLQCSSAGLTSKDGQDRIAVFGPNKLEEKKESEILKF  66

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  67   LGFMWNPLSWV  77



>gb|EMS45119.1| Plasma membrane ATPase 1 [Triticum urartu]
Length=973

 Score =   214 bits (545),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKP DWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  92   NGGGKPSDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWTEEE  151

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLP TKG GDG+YSGST KQ
Sbjct  152  AAVLVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPATKGLGDGVYSGSTVKQ  211

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  212  GEIEAVVIATGVHTFF  227


 Score = 89.4 bits (220),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLE+IPI+EVFENLRC+ +GLTS+ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  11   LDAVLKEAVDLEHIPIDEVFENLRCSHEGLTSEQAQQRLQIFGPNKLEEKEESKFLKFLG  70

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  71   FMWNPLSWV  79



>gb|AEQ27823.1| PM H+-ATPase L [Eichhornia crassipes]
Length=956

 Score =   216 bits (549),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGG+PPDWQDFVGII LL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEE+
Sbjct  89   NGGGEPPDWQDFVGIIALLMINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWSEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKG GDG+YSGST KQ
Sbjct  149  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGAGDGVYSGSTRKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 87.8 bits (216),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            ++AVLKE VDLENI +EEVF+NLRC ++GLTSQ AQERL IFG NKLEEKKESKFLKFLG
Sbjct  8    MEAVLKEVVDLENISLEEVFDNLRCNREGLTSQQAQERLTIFGQNKLEEKKESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   225 bits (574),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFVGILVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PG  +
Sbjct  140  DGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKHPGAEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 77.8 bits (190),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+  ET+DLE++PIEEVF  L+CT++GLTS+   +RLDIFG NKLEEK+ESKFLKFLG
Sbjct  7    LEAIKNETIDLEHMPIEEVFAELKCTREGLTSEEGAKRLDIFGPNKLEEKQESKFLKFLG  66

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV ++
Sbjct  67   FMWNPLSWVMES  78



>ref|XP_011466246.1| PREDICTED: plasma membrane ATPase 1-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=966

 Score =   223 bits (567),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAP AKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPTAKVLRDGKWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDI+PADARLLDGDPLKIDQS+LTGESLPVTK PGD +YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDILPADARLLDGDPLKIDQSSLTGESLPVTKSPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 80.5 bits (197),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E L+ V+KE VDLE++PIEEVF  LRC + GLTS+AAQ+RL +FG+NKLEEKKESK LKF
Sbjct  6    EGLEVVVKEAVDLEHVPIEEVFLTLRCDEHGLTSEAAQQRLALFGYNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>tpg|DAA42486.1| TPA: H(+)-transporting ATPase [Zea mays]
Length=949

 Score =   223 bits (569),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGG KPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRW+EE+
Sbjct  92   NGGNKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWAEEE  151

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  152  SAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  211

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  212  GEIEAVVIATGVHTFF  227


 Score = 80.1 bits (196),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENI I+EVFE+LRC+  GL+++ A++RL IFG NKLEEK+ESKFLKFLG
Sbjct  11   LDAVLKEAVDLENIAIQEVFESLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKFLKFLG  70

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  71   FMWNPLSWV  79



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   229 bits (585),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   AIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW EE+A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  142  DGRWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 73.9 bits (180),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIPIEEVF+ L+CT++GLTS     RL +FG NKLEEKKESKFLKFLG
Sbjct  9    LEEIKNETVDLENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESKFLKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV ++
Sbjct  69   FMWNPLSWVMES  80



>ref|NP_001105360.1| membrane H(+)-ATPase1 [Zea mays]
 gb|AAB60276.1| H(+)-transporting ATPase [Zea mays]
Length=949

 Score =   223 bits (569),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGG KPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+GRW+EE+
Sbjct  92   NGGNKPPDWQDFVGIITLLIINSTISFIEENNAGNAAAALMARLAPKAKVLRNGRWAEEE  151

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTKGPGDG+YSGSTCKQ
Sbjct  152  SAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGPGDGVYSGSTCKQ  211

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  212  GEIEAVVIATGVHTFF  227


 Score = 80.1 bits (196),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENI I+EVFE+LRC+  GL+++ A++RL IFG NKLEEK+ESKFLKFLG
Sbjct  11   LDAVLKEAVDLENIAIQEVFESLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKFLKFLG  70

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  71   FMWNPLSWV  79



>ref|XP_004302360.1| PREDICTED: plasma membrane ATPase 1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=956

 Score =   223 bits (567),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAP AKVLRDG+W EED
Sbjct  89   NGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPTAKVLRDGKWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDI+PADARLLDGDPLKIDQS+LTGESLPVTK PGD +YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDILPADARLLDGDPLKIDQSSLTGESLPVTKSPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 80.9 bits (198),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E L+ V+KE VDLE++PIEEVF  LRC + GLTS+AAQ+RL +FG+NKLEEKKESK LKF
Sbjct  6    EGLEVVVKEAVDLEHVPIEEVFLTLRCDEHGLTSEAAQQRLALFGYNKLEEKKESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>tpg|DAA50741.1| TPA: hypothetical protein ZEAMMB73_722190 [Zea mays]
Length=1149

 Score =   220 bits (560),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+
Sbjct  290  NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRDGRWAEEE  349

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGD+IS+KLGDIIPADARLLDGDPLKIDQS+LTGESLPVTKGPGDG YSGST KQ
Sbjct  350  AAVLVPGDVISIKLGDIIPADARLLDGDPLKIDQSSLTGESLPVTKGPGDGAYSGSTVKQ  409

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  410  GEIEAVVIATGVHTFF  425


 Score = 83.2 bits (204),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLENIP+EEVFENLRC++ GLTS+ AQ+RL +FG NKLEEK+ +       
Sbjct  202  LDAVLKEAVDLENIPLEEVFENLRCSRGGLTSEQAQQRLQLFGPNKLEEKELNWPWLQES  261

Query  190  f-------MWNPLSWV  216
                    MWNPLSWV
Sbjct  262  KFLKFLGFMWNPLSWV  277



>emb|CDP02191.1| unnamed protein product [Coffea canephora]
Length=967

 Score =   213 bits (542),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGI  LL+INS+ISF EENNAGNAAAALMARL+PKAKVLRDG WSE+D
Sbjct  89   NGGGKPPDWQDFVGITILLLINSSISFYEENNAGNAAAALMARLSPKAKVLRDGSWSEQD  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALTGESLPV+K P +G+YSGSTCKQ
Sbjct  149  ASILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGESLPVSKAPREGVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 89.7 bits (221),  Expect(2) = 2e-73, Method: Composition-based stats.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            E ++A+ KE VDLENIP+EEVFENLRCTK+GL+S+ AQ RL IFG+NKLEEK+ESK LKF
Sbjct  6    EAMEALKKEAVDLENIPLEEVFENLRCTKEGLSSEDAQRRLQIFGYNKLEEKEESKVLKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|EEC75974.1| hypothetical protein OsI_13084 [Oryza sativa Indica Group]
 gb|EEE59727.1| hypothetical protein OsJ_12166 [Oryza sativa Japonica Group]
Length=966

 Score =   216 bits (550),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+G W+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRNGSWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLP TKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 86.7 bits (213),  Expect(2) = 3e-73, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   228 bits (582),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAA+LMA LAPK KVLR
Sbjct  74   AIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAASLMAGLAPKTKVLR  133

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE+DA+ILVPGDIIS+KLGDIIPADARL+ GDPLKIDQSALTGESLPVTK PG G+
Sbjct  134  DGKWSEQDAAILVPGDIISIKLGDIIPADARLMVGDPLKIDQSALTGESLPVTKYPGSGV  193

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  194  YSGSTCKQGEIEAVVIATGVHTFF  217


 Score = 74.3 bits (181),  Expect(2) = 3e-73, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            ++ +  E++DLE IPIEEVFE L+CTK+GL +   +ERL IFG NKLEEKKESK LKFLG
Sbjct  1    MEDIKNESIDLEKIPIEEVFEKLKCTKEGLRTTEGEERLRIFGPNKLEEKKESKILKFLG  60

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  61   FMWNPLSWVMEA  72



>dbj|BAA01058.1| H-ATPase [Oryza sativa Japonica Group]
 prf||1906387A H ATPase
Length=956

 Score =   216 bits (550),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+G W+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRNGSWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLP TKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 86.7 bits (213),  Expect(2) = 3e-73, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|NP_001050947.1| Os03g0689300 [Oryza sativa Japonica Group]
 emb|CAD29294.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|AAT81733.1| H-ATPase [Oryza sativa Japonica Group]
 gb|ABF98274.1| Plasma membrane ATPase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12861.1| Os03g0689300 [Oryza sativa Japonica Group]
Length=956

 Score =   216 bits (550),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVLR+G W+EE+
Sbjct  89   NGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVLRNGSWTEEE  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLP TKGPGDG+YSGST KQ
Sbjct  149  AAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKGPGDGVYSGSTVKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 86.7 bits (213),  Expect(2) = 3e-73, Method: Composition-based stats.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ESKFLKFLG
Sbjct  8    LDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   224 bits (572),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  79   AIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  138

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLP TK PGD +
Sbjct  139  DGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKNPGDEV  198

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEA+VIATGVHTFF
Sbjct  199  FSGSTCKQGEIEAIVIATGVHTFF  222


 Score = 77.8 bits (190),  Expect(2) = 4e-73, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKE K LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLG  65

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  66   FMWNPLSWV  74



>ref|XP_010531800.1| PREDICTED: ATPase 4, plasma membrane-type-like [Tarenaya hassleriana]
Length=954

 Score =   217 bits (552),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAALMA LAPK KVLRDG+W EED
Sbjct  88   NGGGKPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAALMAHLAPKTKVLRDGKWIEED  147

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            ASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTKG GD +YSGSTCKQ
Sbjct  148  ASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKGSGDSVYSGSTCKQ  207

Query  612  GEIEAVVIATGVHTFF  659
            GE++AVVIATGVHTFF
Sbjct  208  GEVKAVVIATGVHTFF  223


 Score = 85.5 bits (210),  Expect(2) = 4e-73, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            +DAVLKE VDLEN+P+ EVFE LRC  +GL+++AA++RL IFGHNKLEEK+ESKFLKFLG
Sbjct  7    MDAVLKEAVDLENVPMAEVFETLRCDTNGLSTKAAEQRLAIFGHNKLEEKQESKFLKFLG  66

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  67   FMWNPLSWV  75



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   224 bits (572),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  79   AIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  138

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLP TK PGD +
Sbjct  139  DGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPATKNPGDEV  198

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEA+VIATGVHTFF
Sbjct  199  FSGSTCKQGEIEAIVIATGVHTFF  222


 Score = 77.8 bits (190),  Expect(2) = 5e-73, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKE K LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLG  65

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  66   FMWNPLSWV  74



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   225 bits (574),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  79   AIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  138

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  139  DGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  198

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEA+VIATGVHTFF
Sbjct  199  FSGSTCKQGEIEAIVIATGVHTFF  222


 Score = 76.6 bits (187),  Expect(2) = 5e-73, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIP++EVFE L+C+++GLTS   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEQIKNETVDLENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKFLG  65

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  66   FMWNPLSWV  74



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   224 bits (572),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANG GKPPDWQDFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   ALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVT+ PGD +
Sbjct  142  DGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTRNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGE+EAVVIATGVHTFF
Sbjct  202  YSGSTCKQGELEAVVIATGVHTFF  225


 Score = 76.6 bits (187),  Expect(2) = 9e-73, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKK+SK LKFLG
Sbjct  9    LEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKILKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  69   FMWNPLSWVMEA  80



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   224 bits (572),  Expect(2) = 9e-73, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANG GKPPDWQDFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   ALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVT+ PGD +
Sbjct  142  DGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTRNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGE+EAVVIATGVHTFF
Sbjct  202  YSGSTCKQGELEAVVIATGVHTFF  225


 Score = 76.6 bits (187),  Expect(2) = 9e-73, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKK+SK LKFLG
Sbjct  9    LEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKDSKILKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  69   FMWNPLSWVMEA  80



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   226 bits (577),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFVGIMVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEA+VIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAIVIATGVHTFF  223


 Score = 74.3 bits (181),  Expect(2) = 1e-72, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IP+EEVF  L+CTK+GLT+   ++RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEEIKNETVDLERIPVEEVFTQLKCTKEGLTTAEGEQRLQIFGPNKLEEKKESKFLKFLG  66

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  67   FMWNPLSWV  75



>ref|XP_009348377.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=966

 Score =   211 bits (538),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +I+A+A   GG +P D+ DFVGI+ LLVINSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  82   AIIAVAFTQGGSQPADYHDFVGILVLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            +G+W+EEDA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  142  NGKWAEEDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDGV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIE VVIATGVHTFF
Sbjct  202  YSGSTCKQGEIEGVVIATGVHTFF  225


 Score = 89.4 bits (220),  Expect(2) = 1e-72, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDA++KE VDLEN+P+ EVF++L+CT+DGL+S   QERLD+FG+NKLEEKKESK LKFLG
Sbjct  9    LDAIIKEAVDLENVPLSEVFDHLKCTRDGLSSDEVQERLDLFGYNKLEEKKESKILKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  69   FMWNPLSWVMEA  80



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   227 bits (578),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  78   ALMAIVLANGQGKPPDWQDFVGIVALLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  137

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  138  DGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKSPGDEV  197

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  198  FSGSTCKQGEIEAVVIATGVHTFF  221


 Score = 73.6 bits (179),  Expect(2) = 1e-72, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLE+IPIEEVFE L+C+K+GLTS     RL IFG NKLEEKKESK LKFLG
Sbjct  5    LEQIKNEAVDLEHIPIEEVFEQLKCSKEGLTSDEGANRLQIFGPNKLEEKKESKILKFLG  64

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  65   FMWNPLSWV  73



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   219 bits (557),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGG+ PDWQDFVGI+ LL INSTISFIEENNAGNAAAALMA LAPKAKVLR
Sbjct  78   AIMAIVLANGGGEDPDWQDFVGIVVLLFINSTISFIEENNAGNAAAALMAGLAPKAKVLR  137

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE++A ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQ+ALTGESLPVT+ PGD +
Sbjct  138  DGRWSEQEAEILVPGDVISIKLGDIIPADARLLEGDPLKIDQAALTGESLPVTRNPGDEV  197

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  198  FSGSTCKQGEIEAVVIATGVHTFF  221


 Score = 81.3 bits (199),  Expect(2) = 2e-72, Method: Composition-based stats.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            ++L+ +  ETVDLE IP+EEVFE L+CT+DGLT++  ++RL IFG NKLEEK+ESK LKF
Sbjct  3    DILEEIKNETVDLERIPVEEVFEQLKCTRDGLTTEEGEKRLQIFGPNKLEEKEESKLLKF  62

Query  184  lgfMWNPLSWVPDA  225
            LGFMWNPLSWV +A
Sbjct  63   LGFMWNPLSWVMEA  76



>ref|XP_007039740.1| H(+)-ATPase 11 isoform 1 [Theobroma cacao]
 gb|EOY24241.1| H(+)-ATPase 11 isoform 1 [Theobroma cacao]
Length=966

 Score =   217 bits (553),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI+LA+GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  83   ALMAISLAHGGGKDIDYHDFVGILALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL GDPLKIDQSALTGESLPVTK PG GI
Sbjct  143  DGKWSEEDASVLVPGDIISIKLGDIIPADARLLQGDPLKIDQSALTGESLPVTKHPGHGI  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  203  YSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 82.8 bits (203),  Expect(2) = 2e-72, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
             +A+ KE VDLENIP+EEVFE L+CT+ GL+S   Q+RLD+FG+NKLEEKKE+K LKFLG
Sbjct  10   FEAISKEIVDLENIPVEEVFEKLKCTEGGLSSDEVQKRLDLFGYNKLEEKKENKILKFLG  69

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  70   FMWNPLSWVMEA  81



>ref|XP_008378468.1| PREDICTED: plasma membrane ATPase 1-like [Malus domestica]
Length=966

 Score =   211 bits (537),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +I+A+A   GG +P D+ DFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  82   AIIAVAFTQGGSQPADYHDFVGILVLLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            +G+W+EEDA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  142  NGKWAEEDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDGV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIE VVIATGVHTFF
Sbjct  202  YSGSTCKQGEIEGVVIATGVHTFF  225


 Score = 89.0 bits (219),  Expect(2) = 2e-72, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDA++KE VDLEN+P+ EVF++L+CT+DGL+S   QERLD+FG+NKLEEKKESK LKFLG
Sbjct  9    LDAIIKEAVDLENVPLNEVFDHLKCTRDGLSSDEVQERLDLFGYNKLEEKKESKILKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  69   FMWNPLSWVMEA  80



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   224 bits (571),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANGGG+PPDWQDFVGII LL INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  83   ALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNAAAALMAGLAPKTKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK P D +
Sbjct  143  DGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPSDEV  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  203  FSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 75.9 bits (185),  Expect(2) = 2e-72, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLE+IPIEEVFE L+CT++GLTS+    RL +FG NKLEEKKESK LKFLG
Sbjct  10   LEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKLLKFLG  69

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  70   FMWNPLSWVMEA  81



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   224 bits (571),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANGGG+PPDWQDFVGII LL INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  83   ALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNAAAALMAGLAPKTKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK P D +
Sbjct  143  DGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPSDEV  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  203  FSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 75.9 bits (185),  Expect(2) = 2e-72, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLE+IPIEEVFE L+CT++GLTS+    RL +FG NKLEEKKESK LKFLG
Sbjct  10   LEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKILKFLG  69

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  70   FMWNPLSWVMEA  81



>ref|XP_006279360.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
 gb|ABA18104.1| putative plasma membrane ATPase [Capsella rubella]
 gb|EOA12258.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
Length=948

 Score =   223 bits (567),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAA+ALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAASALMANLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E++A+ILVPGD+IS+KLGDI+PADARLL GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALTGESLPVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 77.0 bits (188),  Expect(2) = 3e-72, Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            D + KE VDLE IP+EEVFE L+CTK+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  193  MWNPLSWVPDA  225
            MWNPLSWV ++
Sbjct  68   MWNPLSWVMES  78



>ref|XP_007039741.1| H(\\+)-transporting atpase plant/fungi plasma membrane type, 
putative isoform 2 [Theobroma cacao]
 gb|EOY24242.1| H(\\+)-transporting atpase plant/fungi plasma membrane type, 
putative isoform 2 [Theobroma cacao]
Length=897

 Score =   217 bits (553),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI+LA+GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  83   ALMAISLAHGGGKDIDYHDFVGILALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL GDPLKIDQSALTGESLPVTK PG GI
Sbjct  143  DGKWSEEDASVLVPGDIISIKLGDIIPADARLLQGDPLKIDQSALTGESLPVTKHPGHGI  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  203  YSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 82.0 bits (201),  Expect(2) = 3e-72, Method: Composition-based stats.
 Identities = 51/72 (71%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
             +A+ KE VDLENIP+EEVFE L+CT+ GL+S   Q+RLD+FG+NKLEEKKE+K LKFLG
Sbjct  10   FEAISKEIVDLENIPVEEVFEKLKCTEGGLSSDEVQKRLDLFGYNKLEEKKENKILKFLG  69

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  70   FMWNPLSWVMEA  81



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =   226 bits (576),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  74   AIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  133

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            D +WSE+DA+ILVPGDIIS+KLGDIIPADARL++GDPLKIDQSALTGESLPVTK PG G+
Sbjct  134  DRKWSEQDAAILVPGDIISIKLGDIIPADARLMEGDPLKIDQSALTGESLPVTKYPGSGV  193

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  194  YSGSTCKQGEIEAVVIATGVHTFF  217


 Score = 73.2 bits (178),  Expect(2) = 3e-72, Method: Composition-based stats.
 Identities = 48/72 (67%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            ++ +  E++DLE IPIEEV E L+CTK+GL++   +ERL IFG NKLEEKKESK LKFLG
Sbjct  1    MEDIKNESIDLEKIPIEEVLEKLKCTKEGLSTTEGEERLRIFGPNKLEEKKESKILKFLG  60

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  61   FMWNPLSWVMEA  72



>ref|XP_008341531.1| PREDICTED: plasma membrane ATPase 1-like [Malus domestica]
Length=956

 Score =   218 bits (554),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/136 (91%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDF+GII LL+INSTISFIEENNAGNAAAALMARLAPKAKV RDGRW EED
Sbjct  89   NGGGKPPDWQDFIGIIALLIINSTISFIEENNAGNAAAALMARLAPKAKVFRDGRWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGD+IS+KLGDIIPADARLLDGD LKIDQSALTGESLPVTKGPG  +YSGSTCKQ
Sbjct  149  ASVLVPGDVISIKLGDIIPADARLLDGDALKIDQSALTGESLPVTKGPGSSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 81.3 bits (199),  Expect(2) = 4e-72, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLE++P+EEVF  LRC K GLTS+A ++RL IFG NKLEEKKESK LKFLG
Sbjct  8    LDAVLKEAVDLEHVPLEEVFVTLRCNKHGLTSEAVEQRLAIFGFNKLEEKKESKVLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPL+WV
Sbjct  68   FMWNPLAWV  76



>gb|EPS57651.1| hypothetical protein M569_17165 [Genlisea aurea]
Length=955

 Score =   227 bits (579),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANGGGK PDWQDFVGI+ LL++NSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  86   AIMAIALANGGGKAPDWQDFVGIVVLLIVNSTISFIEENNAGNAAAALMAGLAPKTKVLR  145

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  146  DGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  205

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  206  FSGSTCKQGEIEAVVIATGVHTFF  229


 Score = 71.6 bits (174),  Expect(2) = 4e-72, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 6/75 (8%)
 Frame = +1

Query  10   LDAVLKETVDL------ENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  171
            L+A+  ETVDL      EN+PIEEVF  L CT++GLTS   ++RL+IFG N+LEEKKESK
Sbjct  7    LEAIRNETVDLVSDNKTENLPIEEVFTQLNCTREGLTSDEGKKRLEIFGPNQLEEKKESK  66

Query  172  flkflgfMWNPLSWV  216
             LKFLGFMWNPLSWV
Sbjct  67   ILKFLGFMWNPLSWV  81



>ref|XP_009799962.1| PREDICTED: plasma membrane ATPase 1-like [Nicotiana sylvestris]
Length=966

 Score =   214 bits (545),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMA+ L +G  K  D+QDFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  83   AIMALFLPHGKHKEIDYQDFVGIVALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  143  DGKWSEEDAAVLVPGDIISIKLGDIIPADARLLNGDPLKIDQSALTGESLPVTKNPGDGV  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  203  YSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 84.7 bits (208),  Expect(2) = 4e-72, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+  ETVDLENIPI+EVFENL+CT++GL S   ++RL++FGHNKLEEKKESK LKFLG
Sbjct  10   LEAINNETVDLENIPIKEVFENLKCTEEGLNSTEVEKRLNVFGHNKLEEKKESKILKFLG  69

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  70   FMWNPLSWVMEA  81



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004165941.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=948

 Score =   226 bits (576),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  79   AIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  138

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W EE+A+ILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  139  DGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKHPGDEV  198

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  199  FSGSTCKQGEIEAVVIATGVHTFF  222


 Score = 72.8 bits (177),  Expect(2) = 4e-72, Method: Composition-based stats.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ V  E +DLE IP+EEVFE L+CTK+GL++   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEDVKNENIDLERIPVEEVFEQLKCTKEGLSTAEGEKRLQIFGPNKLEEKKESKLLKFLG  65

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  66   FMWNPLSWV  74



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   224 bits (570),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAIALANG  K PDWQDFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   AVMAIALANGDNKDPDWQDFVGIIVLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  142  DGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 75.1 bits (183),  Expect(2) = 5e-72, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IPIEEVFE L+CTK GL+S+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEDIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESKILKFLG  68

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  69   FMWNPLSWV  77



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   220 bits (561),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPD+ DF+GI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDYPDFIGIVVLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESL VTK PGD +
Sbjct  140  DGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 78.6 bits (192),  Expect(2) = 5e-72, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIPIEEVF+ L+C++DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDIRNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  67   FMWNPLSWV  75



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   224 bits (572),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANGGG+PPDWQDF+GI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  78   AIMAIALANGGGRPPDWQDFLGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  137

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E++A+ILVPGDI+S+KLGDIIPADARLL+GDPLK+DQSALTGESLPVT+GPGD +
Sbjct  138  DGKWGEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTRGPGDEV  197

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  198  FSGSTCKQGEIEAVVIATGVHTFF  221


 Score = 73.9 bits (180),  Expect(2) = 5e-72, Method: Composition-based stats.
 Identities = 48/72 (67%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLE IP+EEVF+ L+CT++GLT++  + RL IFG NKLEEKKESK LKFLG
Sbjct  5    LENIKNEAVDLEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFLG  64

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  65   FMWNPLSWVMEA  76



>dbj|BAM20990.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=954

 Score =   218 bits (554),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 133/136 (98%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGG+PPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPK+KVLRDG W+E+D
Sbjct  91   NGGGRPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKSKVLRDGVWAEQD  150

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  151  AVILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKHPGDGVYSGSTCKQ  210

Query  612  GEIEAVVIATGVHTFF  659
            GE+EAVVIATGVH+FF
Sbjct  211  GEVEAVVIATGVHSFF  226


 Score = 80.9 bits (198),  Expect(2) = 5e-72, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
             +++  ETVDLE+IP+EEVFE LRCT+ GLTS   +ERL IFGHNKLEEK ESK LKFLG
Sbjct  10   FESINNETVDLEHIPLEEVFEQLRCTRQGLTSAEGEERLVIFGHNKLEEKSESKVLKFLG  69

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  70   FMWNPLSWV  78



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   225 bits (574),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   AIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W+E++A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTGESLPVTK PGD I
Sbjct  142  DGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKNPGDEI  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 73.2 bits (178),  Expect(2) = 6e-72, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IPIEEVFE L+CT++GL++     RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV ++
Sbjct  69   FMWNPLSWVMES  80



>ref|XP_009335819.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=956

 Score =   218 bits (556),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDF+GII LL+INSTISFIEENNAGNAAAALMARLAPKAKV RDGRW EED
Sbjct  89   NGGGKPPDWQDFIGIIALLIINSTISFIEENNAGNAAAALMARLAPKAKVFRDGRWIEED  148

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            AS+LVPGDIIS+KLGDIIPADARLLDGD LKIDQSALTGESLPVTK PGD +YSGSTCKQ
Sbjct  149  ASVLVPGDIISIKLGDIIPADARLLDGDALKIDQSALTGESLPVTKSPGDSVYSGSTCKQ  208

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  209  GEIEAVVIATGVHTFF  224


 Score = 80.1 bits (196),  Expect(2) = 6e-72, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDAVLKE VDLE++P+EEV+  LRC K GLTS+A ++RL IFG NKLEEKKESK LKFLG
Sbjct  8    LDAVLKEAVDLEHVPLEEVYVTLRCNKHGLTSEAVEQRLAIFGFNKLEEKKESKVLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPL+WV
Sbjct  68   FMWNPLAWV  76



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   220 bits (561),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPD+ DF+GI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDYPDFIGIVVLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESL VTK PGD +
Sbjct  140  DGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 78.2 bits (191),  Expect(2) = 6e-72, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIPIEEVF+ L+C++DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDIKNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  67   FMWNPLSWV  75



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   225 bits (573),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   AIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W+E++A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTGESLPVTK PGD I
Sbjct  142  DGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKNPGDEI  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 73.2 bits (178),  Expect(2) = 7e-72, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IPIEEVFE L+CT++GL++     RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV ++
Sbjct  69   FMWNPLSWVMES  80



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score =   226 bits (577),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  79   AIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  138

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEE+A+ILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  139  DGKWSEEEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  198

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEA+VIATGVHTFF
Sbjct  199  FSGSTCKQGEIEAIVIATGVHTFF  222


 Score = 72.0 bits (175),  Expect(2) = 7e-72, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ V  E VDLE IPIEEVFE L+C ++GL+S   ++RL IFG NKLEEKKESKFLKFLG
Sbjct  6    LEDVRNENVDLERIPIEEVFEQLKCNRNGLSSDEGEKRLQIFGPNKLEEKKESKFLKFLG  65

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  66   FMWNPLSWV  74



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   222 bits (565),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   ALMAIGLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W+E++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVT+ PGD +
Sbjct  142  DGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTRNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 76.6 bits (187),  Expect(2) = 7e-72, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKKESKFLKFLG
Sbjct  9    LEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESKFLKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  69   FMWNPLSWVMEA  80



>ref|XP_004245804.1| PREDICTED: plasma membrane ATPase 1-like [Solanum lycopersicum]
Length=966

 Score =   213 bits (541),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMA+ L +G  K  D+QDFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  83   AIMALFLPHGKHKGVDYQDFVGIVALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W+EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  143  DGKWNEEDAAVLVPGDIISIKLGDIIPADARLLNGDPLKIDQSALTGESLPVTKNPGDGV  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  203  YSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 85.9 bits (211),  Expect(2) = 7e-72, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+  ETVDLENIPI+EVFENL+CT++GL+S   ++RL++FGHNKLEEKKESK LKFLG
Sbjct  10   LEAINNETVDLENIPIKEVFENLKCTEEGLSSAEVEKRLNVFGHNKLEEKKESKILKFLG  69

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  70   FMWNPLSWVMEA  81



>ref|XP_003529039.1| PREDICTED: plasma membrane ATPase 1-like isoform 2 [Glycine max]
Length=966

 Score =   208 bits (530),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 6/150 (4%)
 Frame = +3

Query  228  SIMAIALANGGG------KPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlap  389
            ++MAI +A+GG       K  D+QDFVGI+ LL+INSTISFIEENNAGNAAAALMARLAP
Sbjct  81   ALMAIGMAHGGVNLHHSLKRGDYQDFVGIVLLLLINSTISFIEENNAGNAAAALMARLAP  140

Query  390  kaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTK  569
            KAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPV+K
Sbjct  141  KAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVSK  200

Query  570  GPGDGIYSGSTCKQGEIEAVVIATGVHTFF  659
             PGDG+YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  HPGDGVYSGSTCKQGEIEAVVIATGVHTFF  230


 Score = 89.7 bits (221),  Expect(2) = 7e-72, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A++KE VDLENIP+EEVF+NL+CT++GL+S+  Q+RLD+FG+NKLEEKKESK LKFLG
Sbjct  8    LEAIVKEAVDLENIPLEEVFDNLKCTREGLSSEQVQQRLDLFGYNKLEEKKESKILKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>gb|AAD46187.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=966

 Score =   214 bits (545),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMA+ L +G  K  D+QDFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  83   AIMALFLPHGKHKEIDYQDFVGIVALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  143  DGKWSEEDAAVLVPGDIISIKLGDIIPADARLLNGDPLKIDQSALTGESLPVTKNPGDGV  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  203  YSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 84.3 bits (207),  Expect(2) = 7e-72, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+  ETVDLENIPI+EVFENL+CT++GL S   ++RL++FGHNKLEEKKESK LKFLG
Sbjct  10   LEAINNETVDLENIPIKEVFENLKCTEEGLNSTEVEKRLNVFGHNKLEEKKESKILKFLG  69

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  70   FMWNPLSWV  78



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   224 bits (571),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI  LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  95   AIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  154

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  155  DGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  214

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  215  FSGSTCKQGEIEAVVIATGVHTFF  238


 Score = 73.9 bits (180),  Expect(2) = 9e-72, Method: Composition-based stats.
 Identities = 52/84 (62%), Positives = 58/84 (69%), Gaps = 15/84 (18%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleek----------  159
            L+ +  E+VDLE IPIEEVFE L+CTKDGLTS+  + RL IFGHNKLEEK          
Sbjct  7    LEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEXRLQIFGHNKLEEKKANFFYFITT  66

Query  160  -----keskflkflgfMWNPLSWV  216
                  ESK LKFLGFMWNPLSWV
Sbjct  67   LQYSFTESKILKFLGFMWNPLSWV  90



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   221 bits (563),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDFVGI+ LL INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   AIMAIVLANGGGKPPDWQDFVGIVALLFINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E+DA+ILVPGD+ISVKLGDIIPADARLL+GD LKIDQSALTGESLPVTK PGD +
Sbjct  142  DGKWGEQDAAILVPGDVISVKLGDIIPADARLLEGDALKIDQSALTGESLPVTKNPGDEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAVVIATGVHTFF  225


 Score = 76.6 bits (187),  Expect(2) = 9e-72, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IP+EEVFE L+CT++GLT+   ++RL+IFG NKLEEKKE KFLKFLG
Sbjct  9    LEQIKNETVDLERIPVEEVFEQLKCTREGLTTAEGEKRLEIFGPNKLEEKKECKFLKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  69   FMWNPLSWVMEA  80



>gb|ABA18112.1| putative plasma membrane ATPase [Arabidopsis arenosa]
Length=948

 Score =   222 bits (566),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAALMANLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E++ASILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGKWGEQEASILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 75.5 bits (184),  Expect(2) = 9e-72, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  193  MWNPLSWVPDA  225
            MWNPLSWV ++
Sbjct  68   MWNPLSWVMES  78



>ref|XP_002875581.1| hypothetical protein ARALYDRAFT_323063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51840.1| hypothetical protein ARALYDRAFT_323063 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score =   222 bits (566),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAALMANLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E++ASILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGKWGEQEASILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 75.5 bits (184),  Expect(2) = 1e-71, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  193  MWNPLSWVPDA  225
            MWNPLSWV ++
Sbjct  68   MWNPLSWVMES  78



>ref|XP_007204519.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica]
 gb|EMJ05718.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica]
Length=965

 Score =   208 bits (529),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  246  LANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSE  425
               GG KP D+ DF GI+ LLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDG+W+E
Sbjct  87   FTQGGSKPADYHDFFGILVLLVINSTISFIEENNAGNAAAALMARLAPKAKVLRDGKWAE  146

Query  426  EDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTC  605
            EDA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTC
Sbjct  147  EDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDGVYSGSTC  206

Query  606  KQGEIEAVVIATGVHTFF  659
            KQGEIEAVVIATGVHTFF
Sbjct  207  KQGEIEAVVIATGVHTFF  224


 Score = 89.4 bits (220),  Expect(2) = 1e-71, Method: Composition-based stats.
 Identities = 54/69 (78%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            LDA++KE VDLEN+P+EEVF++L+CT+DGL+S   QERLD+FG+NKLEEKKESKFLKFLG
Sbjct  8    LDAIIKEAVDLENVPLEEVFDHLKCTRDGLSSDEVQERLDLFGYNKLEEKKESKFLKFLG  67

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  68   FMWNPLSWV  76



>gb|AAV49159.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
 gb|AAV49160.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
Length=925

 Score =   221 bits (564),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IM+IALANGGGKPPDW DFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK K+LR
Sbjct  80   AIMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENNAGNAAAALMANLAPKTKILR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQ+ALTGESLPVTK PGD +
Sbjct  140  DGKWSEEDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQAALTGESLPVTKQPGDQV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGST KQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTVKQGEIEAVVIATGVHTFF  223


 Score = 75.9 bits (185),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLENIP+EEVF+ L+C+++GLT++  Q RL IFGHNKLEEKKE+K LKFLG
Sbjct  7    LEDIRNEQVDLENIPVEEVFQILKCSREGLTNEEGQNRLQIFGHNKLEEKKENKVLKFLG  66

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  67   FMWNPLSWVMEA  78



>gb|ABA18090.1| putative plasma membrane ATPase [Olimarabidopsis pumila]
Length=948

 Score =   222 bits (565),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAALMANLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E++A+ILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 75.5 bits (184),  Expect(2) = 1e-71, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  193  MWNPLSWVPDA  225
            MWNPLSWV ++
Sbjct  68   MWNPLSWVMES  78



>gb|EAZ06139.1| hypothetical protein OsI_28373 [Oryza sativa Indica Group]
Length=950

 Score =   226 bits (576),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAIALANGGG+PPDWQDFVGII LL+INSTIS+ EE+NAG+AAAALM  LAPK KVLR
Sbjct  81   AIMAIALANGGGRPPDWQDFVGIIALLLINSTISYWEESNAGSAAAALMKNLAPKTKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE DA +LVPGD+ISVKLGDI+PADARLLDGDPLKIDQSALTGESLPVTK PGD +
Sbjct  141  DGRWSETDAFVLVPGDVISVKLGDIVPADARLLDGDPLKIDQSALTGESLPVTKLPGDCV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEI+AVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIDAVVIATGVHTFF  224


 Score = 71.2 bits (173),  Expect(2) = 1e-71, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            + L+ +  E VDLE+IP+EEVF+NL+CT++GLT+     R  +FG NKLEEKKESK LKF
Sbjct  6    DALEQIKNEAVDLEHIPLEEVFQNLKCTREGLTNAEGDARTQVFGPNKLEEKKESKILKF  65

Query  184  lgfMWNPLSWV  216
            LGFMWNPLSWV
Sbjct  66   LGFMWNPLSWV  76



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   224 bits (571),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI +ANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  83   AIMAIVMANGGGKPPDWQDFVGIMVLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  143  DGKWSEQEACILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKNPGDEV  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEA+VIATGVHTFF
Sbjct  203  FSGSTCKQGEIEAIVIATGVHTFF  226


 Score = 72.8 bits (177),  Expect(2) = 1e-71, Method: Composition-based stats.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IP++EVF  L+CTK+GLT+   ++RL IFG NKLEEK ESKFLKFLG
Sbjct  10   LEEIKNETVDLERIPVDEVFAQLKCTKEGLTAAEGEKRLQIFGPNKLEEKTESKFLKFLG  69

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  70   FMWNPLSWV  78



>gb|KFK33846.1| hypothetical protein AALP_AA5G067500 [Arabis alpina]
Length=948

 Score =   223 bits (567),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAALMANLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E++ASILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGKWGEQEASILVPGDLISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 74.7 bits (182),  Expect(2) = 1e-71, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            D + KE VDLE IP+EEVFE L+C+K+GL+S    +RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGNKRLEIFGPNKLEEKSENKFLKFLGF  67

Query  193  MWNPLSWVPDA  225
            MWNPLSWV ++
Sbjct  68   MWNPLSWVMES  78



>dbj|BAM20991.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=947

 Score =   227 bits (578),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IM+IALANGGG+PPDWQDF+GIITLLVINSTISFIEENNAGNAAA+LMARLAPK KVLR
Sbjct  77   AIMSIALANGGGQPPDWQDFIGIITLLVINSTISFIEENNAGNAAASLMARLAPKTKVLR  136

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD +
Sbjct  137  DGKWSEQEAIILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKKPGDEV  196

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGE+EAVVIATGVH+FF
Sbjct  197  YSGSTCKQGELEAVVIATGVHSFF  220


 Score = 70.5 bits (171),  Expect(2) = 2e-71, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
             +++  E VDLE+IPI+EVF  L+CT++GL++   + RL IFG+NKLEEK ESK LKFLG
Sbjct  4    FESLTNEVVDLEHIPIDEVFVQLKCTREGLSTTEGEARLQIFGYNKLEEKNESKLLKFLG  63

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  64   FMWNPLSWVMEA  75



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   217 bits (552),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPD+ DF+GI+ LL INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDYPDFIGIVVLLFINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++ASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESL VTK PGD +
Sbjct  140  DGKWSEQEASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTKYPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 79.7 bits (195),  Expect(2) = 2e-71, Method: Composition-based stats.
 Identities = 54/69 (78%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ V  ETVDLENIPIEEVF+ L+CT+DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDVRNETVDLENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  67   FMWNPLSWV  75



>gb|KHN34527.1| Plasma membrane ATPase 1 [Glycine soja]
Length=960

 Score =   207 bits (527),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI +A+GGG+  D+QDF GI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  81   ALMAIGMAHGGGEGGDYQDFAGIVLLLLINSTISFIEENNAGNAAAALMARLAPKAKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPV+K PGDG+
Sbjct  141  DGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVSKHPGDGV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  YSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 89.4 bits (220),  Expect(2) = 2e-71, Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A++KE VDLENIP+EEVF+NL+CT++GL+S+  Q+RLD+FG+NKLEEKKESK LKFL 
Sbjct  8    LEAIVKEAVDLENIPLEEVFDNLKCTREGLSSEQVQQRLDLFGYNKLEEKKESKILKFLC  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>ref|XP_009609422.1| PREDICTED: plasma membrane ATPase 1-like [Nicotiana tomentosiformis]
 ref|XP_009609423.1| PREDICTED: plasma membrane ATPase 1-like [Nicotiana tomentosiformis]
Length=966

 Score =   212 bits (539),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMA+ L +G  K  D+QDFVGI+ LL+INSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  83   AIMALFLPHGKHKEIDYQDFVGIVALLIINSTISFIEENNAGNAAAALMARLAPKAKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEEDA++LVPGDIIS+KLGDIIP+DARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  143  DGKWSEEDAAVLVPGDIISIKLGDIIPSDARLLNGDPLKIDQSALTGESLPVTKNPGDGV  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGE+EAVVIATGVHTFF
Sbjct  203  YSGSTCKQGELEAVVIATGVHTFF  226


 Score = 84.7 bits (208),  Expect(2) = 2e-71, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+  ETVDLENIPI+EVFENL+CT++GL S   ++RL++FGHNKLEEKKESK LKFLG
Sbjct  10   LEAINNETVDLENIPIKEVFENLKCTEEGLNSTEVEKRLNVFGHNKLEEKKESKILKFLG  69

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  70   FMWNPLSWVMEA  81



>ref|XP_006359241.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=966

 Score =   211 bits (538),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMA+ L +G  K  D+QDFVGI+ LL+INSTISF+EENNAGNAAAALMARLAPKAKVLR
Sbjct  83   AIMALFLPHGKHKGVDYQDFVGIVALLIINSTISFMEENNAGNAAAALMARLAPKAKVLR  142

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W+EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+
Sbjct  143  DGKWNEEDAAVLVPGDIISIKLGDIIPADARLLNGDPLKIDQSALTGESLPVTKNPGDGV  202

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            YSGSTCKQGEIEAVVIATGVHTFF
Sbjct  203  YSGSTCKQGEIEAVVIATGVHTFF  226


 Score = 85.1 bits (209),  Expect(2) = 2e-71, Method: Composition-based stats.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+A+  ETVDLENIPI+EVFENL+CT++GL S   ++RL++FGHNKLEEKKESK LKFLG
Sbjct  10   LEAINNETVDLENIPIKEVFENLKCTEEGLNSAEVEKRLNVFGHNKLEEKKESKILKFLG  69

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  70   FMWNPLSWVMEA  81



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =   226 bits (575),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGG+PPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  88   AIMAIVLANGGGEPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  147

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGD I
Sbjct  148  DGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDEI  207

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  208  FSGSTCKQGEIEAVVIATGVHTFF  231


 Score = 70.9 bits (172),  Expect(2) = 2e-71, Method: Composition-based stats.
 Identities = 45/69 (65%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E+VDLE +P+ EVFE+L+C ++GLT++  ++RL IFG NKLEEK ESKFLKFLG
Sbjct  15   LEDIKNESVDLEKVPVSEVFEHLKCNQEGLTAEEGEDRLQIFGPNKLEEKTESKFLKFLG  74

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  75   FMWNPLSWV  83



>ref|XP_010687728.1| PREDICTED: ATPase 8, plasma membrane-type-like [Beta vulgaris 
subsp. vulgaris]
Length=954

 Score =   223 bits (567),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANGGG+PPDWQDFVGI+ LL+INSTISFIEENNAGNAAA+LMA LAPK KV+R
Sbjct  82   AVMAIVLANGGGRPPDWQDFVGIVVLLIINSTISFIEENNAGNAAASLMANLAPKTKVIR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W EEDASILVPGDIIS+KLGDIIPADARLL+GDPLK+DQ+ALTGESLPVTK PG+ +
Sbjct  142  DGKWGEEDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQAALTGESLPVTKYPGNEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEI+AVVIATGVHTFF
Sbjct  202  FSGSTCKQGEIKAVVIATGVHTFF  225


 Score = 73.9 bits (180),  Expect(2) = 2e-71, Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLE IP++EVF+ LRC+KDGL+S   ++RL IFG NKLEEKKESKFLKFLG
Sbjct  9    LEQIKNENVDLEQIPVDEVFKQLRCSKDGLSSAEGEKRLKIFGPNKLEEKKESKFLKFLG  68

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  69   FMWNPLSWVMEA  80



>ref|XP_004136313.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=952

 Score =   225 bits (573),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGG+PPDWQDFVG+I LL INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGRPPDWQDFVGVIALLFINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E+DASILVPGDIIS+KLGDIIPADARLL GDPLKIDQSALTGESLPVTK P D +
Sbjct  140  DGRWCEQDASILVPGDIISIKLGDIIPADARLLQGDPLKIDQSALTGESLPVTKNPSDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 71.6 bits (174),  Expect(2) = 2e-71, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            P  L  +  ++VDLE+IPI++VFE L+CT++GLTS+    RL +FG NKLEEKKESK LK
Sbjct  4    PITLQQIPNDSVDLEHIPIDDVFEKLKCTEEGLTSEEGASRLQVFGPNKLEEKKESKILK  63

Query  181  flgfMWNPLSWV  216
            F+GFMWNPLSWV
Sbjct  64   FMGFMWNPLSWV  75



>ref|XP_004168485.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=952

 Score =   225 bits (573),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGG+PPDWQDFVG+I LL INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGRPPDWQDFVGVIALLFINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E+DASILVPGDIIS+KLGDIIPADARLL GDPLKIDQSALTGESLPVTK P D +
Sbjct  140  DGRWCEQDASILVPGDIISIKLGDIIPADARLLQGDPLKIDQSALTGESLPVTKNPSDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 71.6 bits (174),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            P  L  +  ++VDLE+IPI++VFE L+CT++GLTS+    RL +FG NKLEEKKESK LK
Sbjct  4    PITLQQIPNDSVDLEHIPIDDVFEKLKCTEEGLTSEEGASRLQVFGPNKLEEKKESKILK  63

Query  181  flgfMWNPLSWV  216
            F+GFMWNPLSWV
Sbjct  64   FMGFMWNPLSWV  75



>emb|CBI16656.3| unnamed protein product [Vitis vinifera]
Length=958

 Score =   213 bits (543),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            +GGGKP D+ DFVGII LL++NSTISF+EENNAGNAAAALMARLAPKAKVLRDG+WSEED
Sbjct  90   HGGGKPTDYHDFVGIIILLIVNSTISFVEENNAGNAAAALMARLAPKAKVLRDGKWSEED  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  150  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDGVYSGSTCKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  210  GEIEAVVIATGVHTFF  225


 Score = 82.8 bits (203),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            +A+ KE VDLENIP+EEVFE+L+CT++GL+ +A Q+RLD+FG+NKLEE KE+K LKFLGF
Sbjct  10   EAINKEAVDLENIPLEEVFEHLKCTREGLSHEAFQQRLDLFGYNKLEEIKENKILKFLGF  69

Query  193  MWNPLSWV  216
            MWNPLSWV
Sbjct  70   MWNPLSWV  77



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   217 bits (553),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPD+ DF+GI+ LL+INSTISFIEENN+GNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDYPDFIGIVVLLIINSTISFIEENNSGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESL VTK PGD +
Sbjct  140  DGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEI+AVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIDAVVIATGVHTFF  223


 Score = 79.0 bits (193),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIPIEEVF+ L+CT+DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDIRNETVDLENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGPNKLEEKKESKFLKFLG  66

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  67   FMWNPLSWV  75



>ref|XP_010514696.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514698.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514699.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514700.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
Length=948

 Score =   221 bits (562),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAALMANLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E++A+ILVPGD+IS+KLGDI+PADARLL GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALTGESLPVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 75.5 bits (184),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  193  MWNPLSWVPDA  225
            MWNPLSWV ++
Sbjct  68   MWNPLSWVMES  78



>ref|XP_009775735.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana sylvestris]
Length=925

 Score =   220 bits (561),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IM+IALANGGGKPPDW DFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK K+LR
Sbjct  80   AIMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENNAGNAAAALMANLAPKTKILR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEE+ASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQ+ALTGESLPVTK PGD +
Sbjct  140  DGKWSEEEASILVPGDLISVKLGDIIPADARLLEGDPLKIDQAALTGESLPVTKQPGDQV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGST KQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTVKQGEIEAVVIATGVHTFF  223


 Score = 76.3 bits (186),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLENIP+EEVF+ L+C+++GLT++  Q RL IFGHNKLEEKKE+K LKFLG
Sbjct  7    LEDIRNEQVDLENIPVEEVFQILKCSREGLTNEEGQNRLQIFGHNKLEEKKENKVLKFLG  66

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  67   FMWNPLSWVMEA  78



>ref|XP_010425792.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
 ref|XP_010425793.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
 ref|XP_010425794.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   221 bits (562),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAALMANLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+W E++A+ILVPGD+IS+KLGDI+PADARLL GDPLKIDQSALTGESLPVTK PGD +
Sbjct  140  DGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALTGESLPVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 75.5 bits (184),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  193  MWNPLSWVPDA  225
            MWNPLSWV ++
Sbjct  68   MWNPLSWVMES  78



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   223 bits (567),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  82   ALMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  141

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE++A+ILVPGD+IS+KLGDI+PADARLL GDPLKIDQSALTGESLPVTK PG+ +
Sbjct  142  DGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKIDQSALTGESLPVTKHPGEEV  201

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEA+VIATGVHTFF
Sbjct  202  FSGSTCKQGEIEAIVIATGVHTFF  225


 Score = 73.6 bits (179),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E +DLE IPIEEVFE L+C+K+GL+S+  ++RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNEAIDLERIPIEEVFELLKCSKEGLSSEEGEQRLQIFGPNKLEEKKESKVLKFLG  68

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  69   FMWNPLSWV  77



>ref|XP_008466309.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=952

 Score =   224 bits (572),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGG+PPDWQDFVG+I LL INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGRPPDWQDFVGVIALLFINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRW E+DASILVPGDIIS+KLGDIIPADARLL GDPLKIDQSALTGESLPVTK P D +
Sbjct  140  DGRWCEQDASILVPGDIISIKLGDIIPADARLLQGDPLKIDQSALTGESLPVTKNPSDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 71.6 bits (174),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  1    PEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflk  180
            P  L  +  E+VDLE+ PI++VFE L+CTK+GLTS+    RL +FG NKLEEKKESK LK
Sbjct  4    PITLQQLRNESVDLEHSPIDDVFEKLKCTKEGLTSEEGASRLQVFGPNKLEEKKESKILK  63

Query  181  flgfMWNPLSWV  216
            F+GFMWNPLSWV
Sbjct  64   FMGFMWNPLSWV  75



>ref|XP_003633895.1| PREDICTED: plasma membrane ATPase 1 [Vitis vinifera]
Length=968

 Score =   213 bits (542),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            +GGGKP D+ DFVGII LL++NSTISF+EENNAGNAAAALMARLAPKAKVLRDG+WSEED
Sbjct  90   HGGGKPTDYHDFVGIIILLIVNSTISFVEENNAGNAAAALMARLAPKAKVLRDGKWSEED  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALTGESLPVTK PGDG+YSGSTCKQ
Sbjct  150  AAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPGDGVYSGSTCKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  210  GEIEAVVIATGVHTFF  225


 Score = 82.8 bits (203),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 49/68 (72%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  13   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  192
            +A+ KE VDLENIP+EEVFE+L+CT++GL+ +A Q+RLD+FG+NKLEE KE+K LKFLGF
Sbjct  10   EAINKEAVDLENIPLEEVFEHLKCTREGLSHEAFQQRLDLFGYNKLEEIKENKILKFLGF  69

Query  193  MWNPLSWV  216
            MWNPLSWV
Sbjct  70   MWNPLSWV  77



>ref|XP_004973040.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=950

 Score =   218 bits (556),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGG+PPDWQDFVGI+ LL+INS IS++EE+NAG+AA ALMA LAPKAKVLRDGRWSE++
Sbjct  85   NGGGRPPDWQDFVGIVVLLIINSLISYMEESNAGSAAQALMANLAPKAKVLRDGRWSEQE  144

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A++LVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTKGPGD IYSGSTCKQ
Sbjct  145  AAVLVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKGPGDSIYSGSTCKQ  204

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  205  GEIEAVVIATGVHTFF  220


 Score = 77.4 bits (189),  Expect(2) = 3e-71, Method: Composition-based stats.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLENIP+EEVF+ L+CT  GL+S+ AQ R+D+FG NKLEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPVEEVFQTLKCTNKGLSSEEAQARIDVFGPNKLEEKKESKILKFLG  63

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  64   FMWNPLSWV  72



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   219 bits (559),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/136 (91%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            NGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLRDGRWSE+D
Sbjct  90   NGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGRWSEQD  149

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALTGESLPVTK PGD ++SGSTCKQ
Sbjct  150  AAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGESLPVTKSPGDEVFSGSTCKQ  209

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  210  GEIEAVVIATGVHTFF  225


 Score = 76.3 bits (186),  Expect(2) = 4e-71, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE IPIEEVFE L+CT++GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  69   FMWNPLSWV  77



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   219 bits (557),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGG+ PDWQDFVGI+ LL INSTISFIEENNAGNAAAALMA LAPKAKVLR
Sbjct  80   AIMAIVLANGGGEDPDWQDFVGIVVLLFINSTISFIEENNAGNAAAALMAGLAPKAKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DGRWSE++A ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQ+ALTGESLPVT+ PGD +
Sbjct  140  DGRWSEQEAEILVPGDVISIKLGDIIPADARLLEGDPLKIDQAALTGESLPVTRNPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 76.6 bits (187),  Expect(2) = 4e-71, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
            ++L+ +  ETVDLE IP+EEVFE L+CT+DGLT++  ++RL IFG NKLEEK+ +     
Sbjct  3    DILEEIKNETVDLERIPVEEVFEQLKCTRDGLTTEEGEKRLQIFGPNKLEEKEANSLCSR  62

Query  184  lgf--MWNPLSWVPDA  225
                 MWNPLSWV +A
Sbjct  63   AFLGFMWNPLSWVMEA  78



>ref|XP_009610942.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana tomentosiformis]
Length=926

 Score =   219 bits (558),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++M+IALANGGGKPPDW DFVGI+ LL+INSTISFIEENNAGNAAAALMA LAPK K+LR
Sbjct  81   AVMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENNAGNAAAALMANLAPKTKILR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEE+ASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQ+ALTGESLPVTK PGD +
Sbjct  141  DGKWSEEEASILVPGDMISVKLGDIIPADARLLEGDPLKIDQAALTGESLPVTKQPGDQV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGST KQGEIEAVVIATGVHTFF
Sbjct  201  FSGSTVKQGEIEAVVIATGVHTFF  224


 Score = 76.6 bits (187),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +1

Query  4    EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  183
             +L+ +  E VDLENIP+EEVF+ L+C+++GLT++  Q RL IFGHNKLEEKKE+K LKF
Sbjct  6    SLLEDIRNEQVDLENIPVEEVFQCLKCSREGLTNEEGQNRLQIFGHNKLEEKKENKVLKF  65

Query  184  lgfMWNPLSWVPDA  225
            LGFMWNPLSWV +A
Sbjct  66   LGFMWNPLSWVMEA  79



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   218 bits (555),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPD+ DF+GI+ LL INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  80   AIMAIVLANGGGKPPDYPDFIGIVVLLFINSTISFIEENNAGNAAAALMAGLAPKTKVLR  139

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALTGESL VTK PGD +
Sbjct  140  DGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTGESLAVTKHPGDEV  199

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  200  FSGSTCKQGEIEAVVIATGVHTFF  223


 Score = 77.8 bits (190),  Expect(2) = 4e-71, Method: Composition-based stats.
 Identities = 52/69 (75%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLENIPIEEVF+ L+C++DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDIKNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  67   FMWNPLSWV  75



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   220 bits (561),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            ++MAI LANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  81   ALMAIVLANGSGQPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTGESLPVTK P D +
Sbjct  141  DGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKNPYDEV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  FSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 75.1 bits (183),  Expect(2) = 4e-71, Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  ETVDLE +PIEEVFE L+CT++GL+S+    R+ IFG NKLEEKKESK LKFLG
Sbjct  8    LEQIKNETVDLEKVPIEEVFEQLKCTREGLSSEEGANRIQIFGPNKLEEKKESKLLKFLG  67

Query  190  fMWNPLSWVPDA  225
            FMWNPLSWV +A
Sbjct  68   FMWNPLSWVMEA  79



>ref|XP_006597964.1| PREDICTED: ATPase 8, plasma membrane-type-like [Glycine max]
Length=862

 Score =   219 bits (557),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  228  SIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  407
            +IMAI LANGGGKPPDWQDF GI+ LL+INSTISFIEENNAGNAAAALMA LAPK KVLR
Sbjct  81   AIMAIVLANGGGKPPDWQDFTGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLR  140

Query  408  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGI  587
            DG+WSEE+A+ILVPGD+IS+KLG I+PADARLL+GDPLKIDQSALTGESLPVT+ PG  +
Sbjct  141  DGKWSEEEAAILVPGDVISIKLGVIVPADARLLEGDPLKIDQSALTGESLPVTRNPGQQV  200

Query  588  YSGSTCKQGEIEAVVIATGVHTFF  659
            +SGSTCKQGEIEAVVIATGVHTFF
Sbjct  201  FSGSTCKQGEIEAVVIATGVHTFF  224


 Score = 76.6 bits (187),  Expect(2) = 5e-71, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  25   KETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMWNP  204
            KE +DLENIP+EEVFE L+CT++GLTS   ++RL IFG NKLEEKK+SK  KFLGFMWNP
Sbjct  13   KENIDLENIPVEEVFEKLKCTREGLTSAEGEKRLQIFGPNKLEEKKDSKLRKFLGFMWNP  72

Query  205  LSWV  216
            LSWV
Sbjct  73   LSWV  76



>ref|NP_001105470.1| plasma-membrane H+ATPase2 [Zea mays]
 emb|CAA59800.1| H(+)-transporting ATPase [Zea mays]
Length=948

 Score =   216 bits (550),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  252  NGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLRDGRWSEED  431
            N GGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAALMA LAPK KVLRDGRW E++
Sbjct  85   NSGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAALMANLAPKTKVLRDGRWGEQE  144

Query  432  ASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALTGESLPVTKGPGDGIYSGSTCKQ  611
            A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALTGESLPVTKGPGD ++SGSTCKQ
Sbjct  145  AAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGESLPVTKGPGDEVFSGSTCKQ  204

Query  612  GEIEAVVIATGVHTFF  659
            GEIEAVVIATGVHTFF
Sbjct  205  GEIEAVVIATGVHTFF  220


 Score = 79.3 bits (194),  Expect(2) = 5e-71, Method: Composition-based stats.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +1

Query  10   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  189
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  190  fMWNPLSWV  216
            FMWNPLSWV
Sbjct  64   FMWNPLSWV  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320