BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS156H12

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU24516.1|  hypothetical protein MIMGU_mgv1a0010411mg               321   2e-105   Erythranthe guttata [common monkey flower]
ref|XP_004171086.1|  PREDICTED: chaperone protein ClpC, chloropla...    322   1e-104   
emb|CBI15747.3|  unnamed protein product                                322   6e-102   Vitis vinifera
ref|XP_011083076.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    325   1e-101   
gb|KCW48520.1|  hypothetical protein EUGRSUZ_K02198                     315   1e-101   Eucalyptus grandis [rose gum]
gb|KGN63436.1|  hypothetical protein Csa_1G000600                       322   4e-101   Cucumis sativus [cucumbers]
ref|XP_011073186.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    323   6e-101   Sesamum indicum [beniseed]
ref|XP_004252280.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    323   8e-101   
ref|XP_006346636.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    323   8e-101   Solanum tuberosum [potatoes]
ref|XP_009769540.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    323   9e-101   Nicotiana sylvestris
ref|XP_009615664.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    323   9e-101   Nicotiana tomentosiformis
ref|XP_009403788.1|  PREDICTED: chaperone protein ClpC1, chloropl...    323   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
sp|P31542.1|CLPAB_SOLLC  RecName: Full=ATP-dependent Clp protease...    323   1e-100   Solanum lycopersicum
ref|XP_008464372.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    322   1e-100   Cucumis melo [Oriental melon]
ref|XP_009798134.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    322   1e-100   Nicotiana sylvestris
gb|EEC77204.1|  hypothetical protein OsI_15716                          319   2e-100   Oryza sativa Indica Group [Indian rice]
emb|CDO98310.1|  unnamed protein product                                322   2e-100   Coffea canephora [robusta coffee]
ref|XP_009592686.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    322   2e-100   Nicotiana tomentosiformis
ref|XP_009592687.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    322   2e-100   Nicotiana tomentosiformis
ref|XP_010663794.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    322   2e-100   Vitis vinifera
ref|XP_003523172.1|  PREDICTED: chaperone protein ClpC, chloropla...    322   3e-100   Glycine max [soybeans]
ref|XP_007137864.1|  hypothetical protein PHAVU_009G162100g             322   3e-100   Phaseolus vulgaris [French bean]
ref|XP_004501745.1|  PREDICTED: chaperone protein ClpC, chloropla...    321   3e-100   Cicer arietinum [garbanzo]
ref|XP_009387981.1|  PREDICTED: chaperone protein ClpC1, chloropl...    321   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010942381.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    321   5e-100   Elaeis guineensis
ref|XP_003526929.1|  PREDICTED: chaperone protein ClpC, chloropla...    321   5e-100   Glycine max [soybeans]
gb|AAL10478.1|  AT3g48870/T21J18_140                                    312   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003575034.2|  PREDICTED: chaperone protein ClpC1, chloropl...    321   6e-100   Brachypodium distachyon [annual false brome]
gb|EPS57458.1|  hypothetical protein M569_17359                         305   6e-100   Genlisea aurea
ref|XP_003575035.1|  PREDICTED: chaperone protein ClpC1, chloropl...    320   6e-100   Brachypodium distachyon [annual false brome]
ref|XP_003630582.1|  ATP-dependent Clp protease ATP-binding subun...    320   7e-100   Medicago truncatula
ref|XP_008457503.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    320   8e-100   Cucumis melo [Oriental melon]
ref|XP_004152900.1|  PREDICTED: chaperone protein ClpC, chloropla...    320   9e-100   Cucumis sativus [cucumbers]
ref|XP_004503801.1|  PREDICTED: chaperone protein ClpC, chloropla...    320   9e-100   Cicer arietinum [garbanzo]
ref|XP_008791045.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    320   9e-100   Phoenix dactylifera
ref|XP_010249192.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    320   1e-99    Nelumbo nucifera [Indian lotus]
emb|CAE05148.2|  OSJNBa0039C07.4                                        319   1e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393873.1|  PREDICTED: chaperone protein ClpC1, chloropl...    320   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006652229.1|  PREDICTED: chaperone protein ClpC1, chloropl...    319   1e-99    
ref|XP_010929657.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    320   1e-99    Elaeis guineensis
sp|Q7F9I1.2|CLPC1_ORYSJ  RecName: Full=Chaperone protein ClpC1, c...    319   2e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006341485.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    319   2e-99    Solanum tuberosum [potatoes]
ref|XP_010678345.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    319   2e-99    Beta vulgaris subsp. vulgaris [field beet]
sp|P31541.1|CLPAA_SOLLC  RecName: Full=ATP-dependent Clp protease...    319   3e-99    Solanum lycopersicum
ref|XP_004235839.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    319   3e-99    
gb|KEH35794.1|  ATP-dependent Clp protease ATP-binding subunit          318   5e-99    Medicago truncatula
ref|XP_009404743.1|  PREDICTED: chaperone protein ClpC1, chloropl...    318   5e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB19711.1|  hypothetical protein B456_003G116200                    315   5e-99    Gossypium raimondii
ref|XP_009368798.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    318   7e-99    Pyrus x bretschneideri [bai li]
ref|XP_008374277.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    318   8e-99    
ref|XP_004975454.1|  PREDICTED: chaperone protein ClpC1, chloropl...    317   9e-99    Setaria italica
gb|KEH35688.1|  ATP-dependent Clp protease ATP-binding subunit          317   9e-99    Medicago truncatula
ref|XP_008663153.1|  PREDICTED: chaperone protein ClpC1, chloropl...    317   9e-99    Zea mays [maize]
ref|XP_008239551.1|  PREDICTED: chaperone protein ClpC, chloropla...    317   1e-98    Prunus mume [ume]
gb|EAZ30583.1|  hypothetical protein OsJ_14634                          319   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007210385.1|  hypothetical protein PRUPE_ppa001062mg             317   1e-98    Prunus persica
gb|AAD02267.1|  ClpC protease                                           317   1e-98    Spinacia oleracea
ref|XP_002447724.1|  hypothetical protein SORBIDRAFT_06g014590          317   1e-98    Sorghum bicolor [broomcorn]
ref|XP_004975455.1|  PREDICTED: chaperone protein ClpC1, chloropl...    317   1e-98    Setaria italica
ref|XP_006485108.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    317   2e-98    Citrus sinensis [apfelsine]
ref|XP_008392716.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    317   2e-98    Malus domestica [apple tree]
ref|XP_004297496.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    317   2e-98    Fragaria vesca subsp. vesca
ref|XP_009337515.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    317   2e-98    Pyrus x bretschneideri [bai li]
gb|EEE52971.1|  hypothetical protein OsJ_35634                          314   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010036860.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    316   3e-98    Eucalyptus grandis [rose gum]
ref|XP_010036862.1|  PREDICTED: chaperone protein ClpC, chloropla...    315   5e-98    Eucalyptus grandis [rose gum]
sp|P35100.1|CLPC_PEA  RecName: Full=Chaperone protein ClpC, chlor...    315   5e-98    Pisum sativum [garden pea]
dbj|BAJ99801.1|  predicted protein                                      315   8e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004960741.1|  PREDICTED: chaperone protein ClpC2, chloropl...    315   9e-98    Setaria italica
ref|NP_001066442.1|  Os12g0230100                                       315   1e-97    
ref|XP_006663917.1|  PREDICTED: chaperone protein ClpC2, chloropl...    315   1e-97    Oryza brachyantha
ref|NP_001169540.1|  uncharacterized protein LOC100383416               315   1e-97    Zea mays [maize]
ref|XP_010238595.1|  PREDICTED: chaperone protein ClpC2, chloropl...    315   1e-97    Brachypodium distachyon [annual false brome]
ref|XP_006290258.1|  hypothetical protein CARUB_v10016640mg             311   1e-97    
gb|KJB07945.1|  hypothetical protein B456_001G054700                    314   1e-97    Gossypium raimondii
gb|KJB19710.1|  hypothetical protein B456_003G116200                    314   1e-97    Gossypium raimondii
ref|XP_007159971.1|  hypothetical protein PHAVU_002G282500g             314   1e-97    Phaseolus vulgaris [French bean]
emb|CDX84888.1|  BnaA03g13420D                                          312   2e-97    
ref|XP_010472984.1|  PREDICTED: chaperone protein ClpC1, chloropl...    312   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010250553.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    313   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_003525431.1|  PREDICTED: chaperone protein ClpC, chloropla...    313   3e-97    Glycine max [soybeans]
gb|KDO51290.1|  hypothetical protein CISIN_1g003094mg                   312   3e-97    Citrus sinensis [apfelsine]
gb|ABK95905.1|  unknown                                                 311   4e-97    Populus trichocarpa [western balsam poplar]
ref|XP_006374569.1|  hypothetical protein POPTR_0015s11640g             311   4e-97    
ref|XP_011042955.1|  PREDICTED: chaperone protein ClpC, chloropla...    313   4e-97    Populus euphratica
ref|XP_006376920.1|  hypothetical protein POPTR_0012s10770g             313   4e-97    
ref|XP_010250552.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    313   5e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002977161.1|  hypothetical protein SELMODRAFT_176012             312   5e-97    
ref|XP_002965312.1|  hypothetical protein SELMODRAFT_439163             313   6e-97    Selaginella moellendorffii
ref|NP_001190035.1|  Clp ATPase                                         313   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555578.1|  PREDICTED: chaperone protein ClpC1, chloropl...    313   6e-97    Tarenaya hassleriana [spider flower]
ref|XP_009132682.1|  PREDICTED: chaperone protein ClpC1, chloropl...    313   6e-97    Brassica rapa
gb|KDP22549.1|  hypothetical protein JCGZ_26380                         313   7e-97    Jatropha curcas
ref|XP_002511102.1|  ATP-dependent clp protease, putative               312   7e-97    Ricinus communis
emb|CDY45800.1|  BnaC03g16230D                                          312   1e-96    Brassica napus [oilseed rape]
ref|NP_568746.1|  ATP-dependent Clp protease ATP-binding subunit ...    312   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040255.1|  PREDICTED: chaperone protein ClpC, chloropla...    312   1e-96    Populus euphratica
ref|XP_002865831.1|  heat shock protein 93-V                            312   1e-96    
ref|NP_566912.2|  Clp ATPase                                            312   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402040.1|  hypothetical protein EUTSA_v10012603mg             312   1e-96    Eutrema salsugineum [saltwater cress]
ref|XP_006279971.1|  hypothetical protein CARUB_v10025837mg             312   1e-96    Capsella rubella
ref|XP_010442575.1|  PREDICTED: chaperone protein ClpC1, chloropl...    311   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010482409.1|  PREDICTED: chaperone protein ClpC1, chloropl...    311   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010442573.1|  PREDICTED: chaperone protein ClpC1, chloropl...    311   2e-96    
ref|XP_010536587.1|  PREDICTED: chaperone protein ClpC1, chloropl...    311   2e-96    Tarenaya hassleriana [spider flower]
ref|XP_010536586.1|  PREDICTED: chaperone protein ClpC1, chloropl...    311   2e-96    Tarenaya hassleriana [spider flower]
ref|XP_002877635.1|  AtClpC                                             311   2e-96    
ref|XP_006367832.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    311   3e-96    Solanum tuberosum [potatoes]
gb|EEC69045.1|  hypothetical protein OsI_37876                          316   3e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010426385.1|  PREDICTED: chaperone protein ClpC2, chloropl...    311   3e-96    Camelina sativa [gold-of-pleasure]
emb|CAN78847.1|  hypothetical protein VITISV_010724                     310   3e-96    Vitis vinifera
ref|XP_010503529.1|  PREDICTED: chaperone protein ClpC2, chloropl...    311   3e-96    Camelina sativa [gold-of-pleasure]
ref|XP_001779162.1|  predicted protein                                  310   4e-96    
ref|XP_003532383.1|  PREDICTED: chaperone protein ClpC, chloropla...    310   4e-96    Glycine max [soybeans]
gb|KHN16879.1|  Chaperone protein ClpC, chloroplastic                   310   5e-96    Glycine soja [wild soybean]
emb|CAB87915.1|  AtClpC                                                 311   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001766010.1|  predicted protein                                  308   5e-96    
ref|XP_008811697.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    310   6e-96    Phoenix dactylifera
ref|XP_009411804.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    310   6e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006290259.1|  hypothetical protein CARUB_v10016640mg             311   7e-96    
ref|XP_001756645.1|  predicted protein                                  310   7e-96    
ref|XP_007038115.1|  CLPC                                               310   8e-96    
ref|XP_010519480.1|  PREDICTED: chaperone protein ClpC1, chloropl...    309   2e-95    Tarenaya hassleriana [spider flower]
ref|XP_010515218.1|  PREDICTED: chaperone protein ClpC2, chloropl...    308   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_001766888.1|  predicted protein                                  306   3e-95    
gb|AAC04687.1|  ClpC                                                    308   3e-95    Arabidopsis thaliana [mouse-ear cress]
gb|EYU21822.1|  hypothetical protein MIMGU_mgv1a000973mg                308   3e-95    Erythranthe guttata [common monkey flower]
emb|CDY05878.1|  BnaC08g20550D                                          308   3e-95    
emb|CDY64710.1|  BnaA06g38690D                                          306   4e-95    Brassica napus [oilseed rape]
ref|XP_010550758.1|  PREDICTED: chaperone protein ClpC1, chloropl...    307   9e-95    Tarenaya hassleriana [spider flower]
ref|XP_009149790.1|  PREDICTED: LOW QUALITY PROTEIN: chaperone pr...    306   2e-94    
emb|CDX68504.1|  BnaC01g25820D                                          306   2e-94    
ref|XP_009151567.1|  PREDICTED: chaperone protein ClpC2, chloropl...    305   3e-94    Brassica rapa
ref|XP_008777394.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    301   4e-94    
ref|XP_006404210.1|  hypothetical protein EUTSA_v10010105mg             305   4e-94    Eutrema salsugineum [saltwater cress]
emb|CDX83052.1|  BnaA01g20520D                                          305   4e-94    
gb|KJB19712.1|  hypothetical protein B456_003G116200                    304   1e-93    Gossypium raimondii
ref|XP_002322299.1|  ATP-dependent clp protease ATP-binding subun...    301   2e-92    
ref|XP_010446016.1|  PREDICTED: chaperone protein ClpC1, chloropl...    291   2e-92    
ref|XP_010921845.1|  PREDICTED: ATP-dependent Clp protease ATP-bi...    299   9e-92    Elaeis guineensis
sp|P46523.1|CLPA_BRANA  RecName: Full=ATP-dependent Clp protease ...    297   2e-91    Brassica napus [oilseed rape]
gb|ADN33858.1|  ATP-dependent clp protease                              298   3e-91    Cucumis melo subsp. melo
ref|XP_004138021.1|  PREDICTED: chaperone protein ClpC, chloropla...    295   2e-90    
ref|XP_005648968.1|  hypothetical protein COCSUDRAFT_28166              291   1e-89    Coccomyxa subellipsoidea C-169
gb|KHG07735.1|  Chaperone ClpC, chloroplastic                           288   4e-88    Gossypium arboreum [tree cotton]
ref|XP_005844402.1|  hypothetical protein CHLNCDRAFT_32555              285   5e-87    Chlorella variabilis
gb|KHN31263.1|  Chaperone protein ClpC, chloroplastic                   283   4e-86    Glycine soja [wild soybean]
ref|XP_010099042.1|  Chaperone protein ClpC                             276   5e-86    
gb|AIM41270.1|  chloroplast ATP-dependent Clp protease chaperone ...    283   7e-86    Nicotiana benthamiana
gb|KIZ07494.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     283   8e-86    Monoraphidium neglectum
ref|XP_011401568.1|  ATP-dependent Clp protease ATP-binding subun...    282   1e-85    Auxenochlorella protothecoides
gb|AIM41269.1|  chloroplast ATP-dependent Clp protease chaperone ...    282   2e-85    Nicotiana benthamiana
ref|XP_002952540.1|  hypothetical protein VOLCADRAFT_75431              281   3e-85    Volvox carteri f. nagariensis
gb|EMS54417.1|  ATP-dependent Clp protease ATP-binding subunit cl...    265   6e-84    Triticum urartu
gb|EMT29644.1|  ATP-dependent Clp protease ATP-binding subunit cl...    271   1e-82    
gb|EMT20629.1|  ATP-dependent Clp protease ATP-binding subunit cl...    271   3e-82    
gb|EMT20100.1|  ATP-dependent Clp protease ATP-binding subunit cl...    265   6e-82    
ref|XP_003576089.1|  PREDICTED: chaperone protein ClpC2, chloropl...    272   1e-81    Brachypodium distachyon [annual false brome]
ref|XP_006436942.1|  hypothetical protein CICLE_v100308631mg            251   2e-81    
ref|XP_007509860.1|  predicted protein                                  271   2e-81    Bathycoccus prasinos
gb|EMS45024.1|  ATP-dependent Clp protease ATP-binding subunit cl...    267   3e-81    Triticum urartu
dbj|BAK06755.1|  predicted protein                                      269   9e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIY94281.1|  ATP-dependent Clp protease ATP-binding subunit ClpC     253   2e-80    Monoraphidium neglectum
ref|NP_001067671.1|  Os11g0267400                                       268   3e-80    
ref|XP_002505550.1|  predicted protein                                  267   4e-80    Micromonas commoda
ref|XP_003063658.1|  predicted protein                                  266   7e-80    Micromonas pusilla CCMP1545
gb|EMS46268.1|  ATP-dependent Clp protease ATP-binding subunit cl...    266   1e-79    Triticum urartu
gb|EDZ93048.1|  Clp domain protein                                      254   3e-79    Arthrospira maxima CS-328
ref|XP_010472973.1|  PREDICTED: chaperone protein ClpC1, chloropl...    254   4e-79    Camelina sativa [gold-of-pleasure]
ref|XP_003082910.1|  Chaperone HSP104 and related ATP-dependent C...    262   9e-79    
gb|EMT29575.1|  ATP-dependent Clp protease ATP-binding subunit cl...    265   1e-78    
ref|WP_012305779.1|  ATP-dependent Clp protease ATP-binding protein     262   1e-78    Synechococcus
ref|XP_001422509.1|  chaperone, Hsp100 family, ClpC-type                262   2e-78    Ostreococcus lucimarinus CCE9901
emb|CEG02027.1|  Clp, N-terminal                                        263   2e-78    Ostreococcus tauri
ref|WP_039899756.1|  Clp protease ClpX                                  259   4e-78    Microcystis sp. T1-4
ref|WP_036000319.1|  Clp protease ClpX                                  260   5e-78    [Leptolyngbya] sp. JSC-1
ref|WP_023074118.1|  atp-dependent clp protease atp-binding protein     260   5e-78    Leptolyngbya sp. Heron Island J
ref|WP_022603946.1|  ATPase with chaperone activity, ATP-binding ...    260   5e-78    Rubidibacter lacunae
gb|KEH26264.1|  AAA family ATPase                                       249   6e-78    Medicago truncatula
ref|WP_026097796.1|  Clp protease ClpX                                  260   6e-78    Geitlerinema sp. PCC 7105
ref|WP_012162462.1|  ATP-dependent Clp protease ATP-binding protein     260   7e-78    Acaryochloris marina
ref|WP_030006722.1|  Clp protease ClpX                                  259   9e-78    Synechococcus sp. NKBG042902
ref|WP_010467511.1|  ATP-dependent Clp protease ATP-binding protein     259   1e-77    Acaryochloris sp. CCMEE 5410
ref|WP_006518530.1|  ATPase with chaperone activity, ATP-binding ...    259   1e-77    Leptolyngbya sp. PCC 7375
ref|WP_015191669.1|  ATPase AAA-2 domain protein                        259   1e-77    Stanieria cyanosphaera
ref|WP_006530480.1|  ATPase with chaperone activity, ATP-binding ...    259   1e-77    Gloeocapsa sp. PCC 73106
ref|WP_008179937.1|  ATP-dependent Clp protease ATP-binding protein     259   1e-77    Moorea producens
ref|WP_024545676.1|  Clp protease ClpX                                  259   2e-77    Synechococcus sp. NKBG15041c
ref|WP_004160623.1|  ATP-dependent Clp protease ATP-binding subun...    259   2e-77    Microcystis
ref|XP_006844532.1|  hypothetical protein AMTR_s00016p00164160          258   2e-77    
ref|WP_011056163.1|  ATP-dependent Clp protease ATP-binding protein     259   2e-77    Thermosynechococcus
ref|WP_002732350.1|  ATP-dependent Clp protease ATP-binding protein     258   3e-77    Microcystis aeruginosa
ref|WP_002777520.1|  ATP-dependent Clp protease ATP-binding protein     258   3e-77    Microcystis aeruginosa
ref|WP_004158851.1|  ATP-dependent Clp protease ATP-binding protein     258   3e-77    Microcystis aeruginosa
ref|WP_002796578.1|  ATP-dependent Clp protease ATP-binding protein     258   3e-77    Microcystis
ref|WP_019498394.1|  ATP-dependent Clp protease ATP-binding protein     258   3e-77    Pseudanabaena sp. PCC 6802
ref|WP_012599251.1|  ATP-dependent Clp protease ATP-binding protein     258   3e-77    Cyanothece sp. PCC 7424
ref|WP_015147858.1|  chaperone ATPase                                   258   3e-77    Oscillatoria acuminata
ref|WP_015145231.1|  chaperone ATPase                                   258   4e-77    Pleurocapsa minor
ref|WP_002765002.1|  ATP-dependent Clp protease ATP-binding protein     258   4e-77    Microcystis aeruginosa
ref|WP_024123912.1|  ATP-dependent Clp protease ATPase subunit ClpC     258   4e-77    Thermosynechococcus sp. NK55a
ref|WP_017289117.1|  ATP-dependent Clp protease ATP-binding protein     258   5e-77    Leptolyngbya boryana
ref|WP_010873410.1|  ATP-dependent Clp protease ATP-binding protein     258   6e-77    Synechocystis
ref|WP_015170572.1|  ATPase                                             258   6e-77    Geitlerinema sp. PCC 7407
ref|WP_028949334.1|  Clp protease ClpX                                  257   6e-77    Synechocystis sp. PCC 6714
ref|WP_009555478.1|  ATPase with chaperone activity, ATP-binding ...    257   6e-77    Oscillatoriales cyanobacterium JSC-12
ref|WP_006512495.1|  ATPase with chaperone activity, ATP-binding ...    257   6e-77    Xenococcus sp. PCC 7305
ref|WP_036485541.1|  Clp protease ClpX                                  257   7e-77    Myxosarcina sp. GI1
ref|WP_012630051.1|  ATP-dependent Clp protease ATP-binding protein     257   7e-77    Cyanothece sp. PCC 7425
ref|WP_040939432.1|  Clp protease ClpX                                  257   1e-76    
ref|WP_040943370.1|  Clp protease ClpX                                  257   1e-76    
ref|WP_015225278.1|  ATPase                                             257   1e-76    Halothece sp. PCC 7418
ref|WP_015126250.1|  chaperone ATPase                                   257   1e-76    Synechococcus sp. PCC 6312
ref|WP_040054326.1|  Clp protease ClpX                                  257   1e-76    
gb|AJA71272.1|  HSP100                                                  256   1e-76    Pyropia haitanensis
ref|YP_007947862.1|  Clp protease ATP binding subunit                   256   1e-76    Pyropia haitanensis
ref|WP_015132374.1|  ATPase                                             256   2e-76    Leptolyngbya sp. PCC 7376
ref|YP_537014.1|  Clp protease ATP binding subunit                      256   2e-76    Pyropia yezoensis
ref|WP_039726508.1|  MULTISPECIES: Clp protease ClpX                    256   2e-76    Lyngbya confervoides
ref|WP_019504000.1|  ATP-dependent Clp protease ATP-binding protein     256   2e-76    Pleurocapsa sp. PCC 7319
ref|WP_017717294.1|  ATP-dependent Clp protease ATP-binding protein     256   2e-76    Oscillatoria sp. PCC 10802
ref|WP_015166859.1|  chaperone ATPase                                   256   2e-76    Synechococcus sp. PCC 7502
gb|AIA21360.1|  Clp protease ATP binding subunit                        256   2e-76    Pyropia kanakaensis
ref|WP_010317861.1|  ATP-dependent Clp protease ATP-binding protein     256   2e-76    Synechococcus sp. CB0205
ref|YP_009027615.1|  Clp protease ATP binding subunit                   256   2e-76    Pyropia perforata
gb|AFC40000.1|  Clp protease ATP binding subunit                        256   3e-76    Porphyra umbilicalis
ref|WP_015223717.1|  ATPase                                             256   3e-76    
ref|WP_035989117.1|  Clp protease ClpX                                  256   3e-76    Leptolyngbya sp. KIOST-1
ref|WP_015162264.1|  ATPase with chaperone activity, ATP-binding ...    256   3e-76    Chamaesiphon minutus
ref|WP_012954277.1|  ATP-dependent Clp protease ATP-binding protein     256   3e-76    Candidatus Atelocyanobacterium thalassa
ref|WP_013324812.1|  ATP-dependent Clp protease ATP-binding protein     256   3e-76    Cyanothece sp. PCC 7822
ref|NP_053942.1|  Clp protease ATP binding subunit                      256   3e-76    Porphyra purpurea
ref|WP_012594749.1|  ATP-dependent Clp protease ATP-binding protein     256   3e-76    Cyanothece sp. PCC 8801
ref|WP_015783654.1|  ATP-dependent Clp protease ATP-binding protein     256   3e-76    Cyanothece sp. PCC 8802
ref|WP_006852318.1|  ATP-dependent Clp protease ATP-binding protein     256   3e-76    Synechococcus sp. WH 8016
ref|WP_006454749.1|  ATP-dependent Clp protease ATP-binding protein     256   3e-76    Synechococcus sp. PCC 7335
ref|WP_015201320.1|  ATPase                                             256   3e-76    Crinalium epipsammum
ref|WP_017300481.1|  ATP-dependent Clp protease ATP-binding protein     255   3e-76    Nodosilinea nodulosa
ref|WP_026785489.1|  MULTISPECIES: Clp protease ClpX                    255   4e-76    Planktothrix
ref|WP_042153862.1|  Clp protease ClpX                                  255   4e-76    Planktothrix agardhii
ref|WP_026795885.1|  MULTISPECIES: Clp protease ClpX                    255   4e-76    Planktothrix
gb|KIJ80614.1|  Clp protease ClpX                                       255   4e-76    Scytonema tolypothrichoides VB-61278
ref|WP_027250152.1|  Clp protease ClpX                                  255   4e-76    Planktothrix agardhii
ref|WP_007353377.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    255   4e-76    Kamptonema
gb|KDO51291.1|  hypothetical protein CISIN_1g003094mg                   253   4e-76    Citrus sinensis [apfelsine]
gb|AIA21566.1|  Clp protease ATP binding subunit                        255   5e-76    Pyropia fucicola
ref|WP_015227883.1|  chaperone ATPase                                   255   5e-76    Dactylococcopsis salina
ref|XP_010687844.1|  PREDICTED: chaperone protein ClpC, chloropla...    256   5e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|WP_015185589.1|  chaperone ATPase                                   255   5e-76    Microcoleus sp. PCC 7113
ref|YP_007878188.1|  Clp protease ATP binding subunit                   255   6e-76    Calliarthron tuberculosum
ref|WP_017318713.1|  ATP-dependent Clp protease ATP-binding protein     255   6e-76    Mastigocladopsis repens
ref|YP_007627346.1|  Clp protease ATP binding subunit                   255   6e-76    Chondrus crispus [carageen]
gb|KIE07407.1|  Clp protease ClpX                                       255   6e-76    Tolypothrix bouteillei VB521301
ref|WP_009784332.1|  ATP-dependent Clp protease ATP-binding protein     254   7e-76    Lyngbya sp. PCC 8106
ref|WP_008312190.1|  ATPase with chaperone activity, ATP-binding ...    254   7e-76    Leptolyngbya sp. PCC 6406
ref|XP_010687841.1|  PREDICTED: chaperone protein ClpC, chloropla...    256   7e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|WP_027842712.1|  Clp protease ClpX                                  254   7e-76    Mastigocoleus testarum
ref|WP_006618428.1|  ATP-dependent Clp protease ATP-binding protein     254   7e-76    Arthrospira platensis
ref|WP_017293405.1|  ATP-dependent Clp protease ATP-binding protein     254   7e-76    Geminocystis herdmanii
ref|WP_041035515.1|  Clp protease ClpX                                  254   9e-76    Tolypothrix campylonemoides
ref|WP_006102932.1|  ATP-dependent Clp protease ATP-binding protein     254   9e-76    Coleofasciculus chthonoplastes
ref|WP_017320177.1|  ATP-dependent Clp protease ATP-binding protein     254   1e-75    cyanobacterium PCC 7702
ref|WP_017741509.1|  ATP-dependent Clp protease ATP-binding protein     254   1e-75    Scytonema hofmannii
ref|WP_011612018.1|  ATP-dependent Clp protease ATP-binding protein     254   1e-75    Trichodesmium erythraeum
ref|WP_006620698.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    254   1e-75    Arthrospira
ref|WP_037222416.1|  Clp protease ClpX                                  254   1e-75    
ref|WP_009626822.1|  ATPase AAA-2 domain protein                        254   1e-75    Pseudanabaena biceps
ref|WP_008226206.1|  ATP-dependent Clp protease, ATP-binding subu...    254   1e-75    Richelia intracellularis
ref|WP_023066904.1|  istB-like ATP binding family protein               254   1e-75    Lyngbya aestuarii
ref|WP_008231833.1|  ATP-dependent Clp protease, ATP-binding subu...    254   1e-75    Richelia intracellularis
ref|WP_041677108.1|  Clp protease ClpX                                  254   1e-75    Synechococcus elongatus
dbj|BAD79443.1|  ATP-dependent Clp protease regulatory subunit ClpC     254   1e-75    Synechococcus elongatus PCC 6301
gb|KGG12250.1|  ATP-dependent Clp protease                              254   1e-75    Prochlorococcus sp. MIT 0601
ref|WP_026086125.1|  Clp protease ClpX                                  254   2e-75    Fischerella muscicola
ref|WP_036902654.1|  Clp protease ClpX                                  254   2e-75    Prochlorococcus sp. MIT 0601
ref|WP_006632591.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    253   2e-75    Oscillatoriales
ref|WP_007098208.1|  ATP-dependent Clp protease ATP-binding protein     254   2e-75    Synechococcus sp. RS9916
ref|WP_016879619.1|  ATP-dependent Clp protease ATP-binding protein     253   2e-75    Chlorogloeopsis fritschii
ref|WP_015157369.1|  ATPase                                             253   2e-75    Cyanobacteria [blue-green bacteria]
ref|WP_016863560.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    253   2e-75    
ref|WP_015219504.1|  ATPase                                             253   2e-75    
ref|WP_026722984.1|  Clp protease ClpX                                  253   2e-75    
ref|WP_039713557.1|  Clp protease ClpX                                  253   3e-75    
gb|AAB67745.1|  ClpC                                                    253   3e-75    
ref|WP_011377512.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    253   3e-75    
ref|WP_015117004.1|  chaperone ATPase                                   253   3e-75    
ref|WP_011618961.1|  ATP-dependent Clp protease ATP-binding protein     253   3e-75    
gb|AJO68399.1|  Clp protease ATP binding subunit                        253   3e-75    
gb|KGG32385.1|  ATP-dependent Clp protease                              253   4e-75    
ref|WP_015189078.1|  ATPase AAA-2 domain protein                        253   4e-75    
ref|WP_011125259.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    253   4e-75    
ref|WP_009543682.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    253   4e-75    
ref|YP_008144810.1|  ATP-dependent Clp protease ATP-binding subun...    253   4e-75    
ref|WP_026086344.1|  MULTISPECIES: Clp protease ClpX                    253   4e-75    
ref|WP_008274497.1|  ATP-dependent Clp protease ATP-binding protein     253   4e-75    
gb|EHC12174.1|  ATPase AAA-2 domain protein                             253   5e-75    
gb|AAX96334.1|  Clp amino terminal domain, putative                     254   5e-75    
ref|WP_011432255.1|  ATP-dependent Clp protease ATP-binding protein     252   5e-75    
ref|WP_017324677.1|  ATP-dependent Clp protease ATP-binding protein     252   5e-75    
ref|WP_026734190.1|  Clp protease ClpX                                  252   5e-75    
gb|EAY80574.1|  hypothetical protein OsI_35755                          254   5e-75    
ref|WP_018396432.1|  ATP-dependent Clp protease ATP-binding protein     252   5e-75    
ref|WP_032523561.1|  Clp protease ClpX                                  253   5e-75    
ref|WP_017306413.1|  ATP-dependent Clp protease ATP-binding protein     252   5e-75    
ref|WP_041555480.1|  Clp protease ClpX                                  252   6e-75    
ref|WP_015166218.1|  ATPase                                             252   6e-75    
ref|WP_036917931.1|  MULTISPECIES: Clp protease ClpX                    253   6e-75    
gb|KGF90612.1|  ATP-dependent Clp protease                              252   6e-75    
gb|KGG15432.1|  ATP-dependent Clp protease                              252   6e-75    
ref|WP_032514205.1|  Clp protease ClpX                                  252   7e-75    
ref|WP_011317764.1|  ATP-dependent Clp protease ATP-binding protein     252   7e-75    
ref|WP_036910555.1|  MULTISPECIES: Clp protease ClpX                    252   8e-75    
ref|WP_044521582.1|  Clp protease ClpX                                  252   8e-75    
ref|WP_011360176.1|  ATP-dependent Clp protease ATP-binding protein     252   8e-75    
ref|WP_011364587.1|  ATP-dependent Clp protease ATP-binding protein     252   8e-75    
dbj|BAB74698.1|  endopeptidase Clp ATP-binding chain                    252   9e-75    
ref|WP_011818625.1|  ATP-dependent Clp protease ATP-binding protein     252   1e-74    
ref|WP_011429552.1|  ATP-dependent Clp protease ATP-binding protein     251   1e-74    
ref|WP_025961281.1|  Clp protease ClpX                                  252   1e-74    
ref|WP_011142062.1|  ATP-dependent Clp protease ATP-binding protein     251   1e-74    
gb|AJH65889.1|  ATP-dependent Clp protease                              251   1e-74    
gb|AFY46028.1|  ATPase with chaperone activity, ATP-binding subunit     252   1e-74    
ref|WP_017712666.1|  ATP-dependent Clp protease ATP-binding protein     251   1e-74    
ref|WP_007303900.1|  ATP-dependent Clp protease ATP-binding protein     251   1e-74    
ref|WP_038554285.1|  Clp protease ClpX                                  251   1e-74    
gb|AHF63374.1|  ATPase                                                  251   1e-74    
gb|KGG13948.1|  ATP-dependent Clp protease                              251   1e-74    
ref|YP_009019572.1|  Clp protease ATP binding subunit                   251   1e-74    
ref|WP_015107874.1|  chaperone ATPase                                   251   1e-74    
ref|WP_006910091.1|  ATP-dependent Clp protease ATP-binding protein     251   1e-74    
ref|WP_007100194.1|  ATP-dependent Clp protease ATP-binding protein     251   2e-74    
ref|WP_019474998.1|  hypothetical protein                               248   2e-74    
ref|WP_036909986.1|  Clp protease ClpX                                  251   2e-74    
ref|WP_009789541.1|  ATP-dependent Clp protease ATP-binding protein     251   2e-74    
ref|WP_009632308.1|  ATPase with chaperone activity, ATP-binding ...    251   2e-74    
ref|WP_011127803.1|  ATP-dependent Clp protease ATP-binding protein     251   2e-74    
ref|WP_035153450.1|  Clp protease ClpX                                  251   2e-74    
ref|WP_011825646.1|  ATP-dependent Clp protease ATP-binding protein     251   2e-74    
ref|WP_012195650.1|  ATP-dependent Clp protease ATP-binding protein     251   3e-74    
ref|WP_011820486.1|  ATP-dependent Clp protease ATP-binding protein     251   3e-74    
ref|WP_032522603.1|  Clp protease ClpX                                  251   3e-74    
ref|WP_006277610.1|  ATP-dependent Clp protease ATP-binding protein     250   3e-74    
ref|YP_063564.1|  Clp protease ATP binding subunit                      250   3e-74    
ref|WP_011130433.1|  ATP-dependent Clp protease ATP-binding protein     251   3e-74    
ref|WP_044105586.1|  Clp protease ClpX                                  250   3e-74    
ref|WP_019491687.1|  ATP-dependent Clp protease ATP-binding protein     250   3e-74    
ref|WP_009342297.1|  ATP-dependent Clp protease ATP-binding protein     250   3e-74    
ref|WP_015111477.1|  ATPase                                             250   3e-74    
emb|CAK23961.1|  ATP-dependent Clp protease ATP-binding subunit c...    250   4e-74    
ref|WP_015128787.1|  ATPase                                             250   4e-74    
ref|WP_021832536.1|  ATP-dependent Clp protease, ATP-binding subu...    250   4e-74    
ref|WP_007309413.1|  ATP-dependent Clp protease ATP-binding protein     249   4e-74    
ref|WP_023174246.1|  ATPase AAA-2 domain protein                        250   4e-74    
ref|WP_017651562.1|  ATP-dependent Clp protease ATP-binding protein     250   4e-74    
ref|WP_041428551.1|  Clp protease ClpX                                  250   4e-74    
ref|WP_028951828.1|  Clp protease ClpX                                  250   5e-74    
ref|WP_043691512.1|  Clp protease ClpX                                  250   5e-74    
ref|WP_025964345.1|  Clp protease ClpX                                  250   5e-74    
gb|AHY04404.1|  ATP-dependent clp protease ATP binding subunit          249   5e-74    
gb|AIM41271.1|  chloroplast ATP-dependent Clp protease chaperone ...    251   6e-74    
ref|WP_025930513.1|  Clp protease ClpX                                  249   6e-74    
ref|WP_042850567.1|  Clp protease ClpX                                  249   7e-74    
ref|WP_010303504.1|  ATP-dependent Clp protease ATP-binding protein     249   7e-74    
ref|WP_006041704.1|  ATP-dependent Clp protease ATP-binding protein     249   7e-74    
ref|WP_002807987.1|  ATP-dependent Clp protease ATP-binding protein     249   8e-74    
ref|WP_025881712.1|  MULTISPECIES: Clp protease ClpX                    249   8e-74    
ref|WP_025941830.1|  Clp protease ClpX                                  249   8e-74    
ref|WP_032515069.1|  Clp protease ClpX                                  249   9e-74    
ref|WP_025954710.1|  Clp protease ClpX                                  249   9e-74    
ref|WP_029976482.1|  Clp protease ClpX                                  249   9e-74    
ref|WP_025928515.1|  Clp protease ClpX                                  249   9e-74    
ref|WP_025923359.1|  Clp protease ClpX                                  249   9e-74    
ref|WP_025970276.1|  Clp protease ClpX                                  249   9e-74    
ref|WP_025959792.1|  Clp protease ClpX                                  249   9e-74    
ref|WP_025956785.1|  Clp protease ClpX                                  249   9e-74    
ref|WP_025890951.1|  MULTISPECIES: Clp protease ClpX                    249   1e-73    
ref|WP_012007913.1|  ATP-dependent Clp protease ATP-binding protein     249   1e-73    
ref|WP_025906631.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_032519126.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025958425.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025893396.1|  Clp protease ClpX                                  249   1e-73    
gb|AGW80480.1|  Clp protease ATP binding subunit                        249   1e-73    
ref|WP_025935959.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025965623.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025944115.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025925386.1|  MULTISPECIES: Clp protease ClpX                    249   1e-73    
ref|WP_025942442.1|  MULTISPECIES: Clp protease ClpX                    249   1e-73    
ref|WP_025972244.1|  Clp protease ClpX                                  249   1e-73    
ref|YP_277337.1|  Clp protease ATP binding subunit                      249   1e-73    
ref|WP_025935195.1|  MULTISPECIES: Clp protease ClpX                    249   1e-73    
ref|WP_025932059.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025924610.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025962478.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025894690.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_025922419.1|  MULTISPECIES: Clp protease ClpX                    249   1e-73    
ref|WP_038544339.1|  Clp protease ClpX                                  249   1e-73    
ref|WP_013192942.1|  ATP-dependent Clp protease ATP-binding protein     248   1e-73    
ref|WP_029638478.1|  Clp protease ClpX [                                248   2e-73    
ref|YP_001293474.1|  Clp protease ATP binding subunit                   248   2e-73    
ref|WP_032516684.1|  Clp protease ClpX                                  248   2e-73    
ref|WP_025968127.1|  Clp protease ClpX                                  248   2e-73    
ref|WP_039740335.1|  Clp protease ClpX                                  248   2e-73    
gb|KGG05896.1|  ATP-dependent Clp protease                              248   2e-73    
ref|WP_011863146.1|  ATP-dependent Clp protease ATP-binding protein     248   2e-73    
ref|WP_025955884.1|  Clp protease ClpX                                  248   2e-73    
ref|WP_006170858.1|  ATP-dependent Clp protease ATP-binding protein     248   2e-73    
ref|WP_036896901.1|  Clp protease ClpX                                  248   2e-73    
ref|WP_025781797.1|  Clp protease ClpX                                  248   2e-73    
ref|WP_006198453.1|  ATP-dependent Clp protease ATP-binding protein     248   2e-73    
ref|WP_015216290.1|  ATPase AAA-2 domain protein                        248   2e-73    
ref|WP_015206692.1|  ATPase with chaperone activity, ATP-binding ...    248   2e-73    
ref|WP_015200797.1|  ATPase                                             248   2e-73    
ref|WP_032524589.1|  Clp protease ClpX                                  248   3e-73    
ref|WP_016952177.1|  ATP-dependent Clp protease ATP-binding protein     248   3e-73    
gb|AIM41268.1|  chloroplast ATP-dependent Clp protease chaperone ...    248   3e-73    
ref|WP_036906575.1|  Clp protease ClpX                                  248   4e-73    
gb|ADJ57429.1|  clp protease ATP binding subunit                        247   5e-73    
ref|WP_011824074.1|  ATP-dependent Clp protease ATP-binding protein     247   5e-73    
ref|WP_011294749.1|  ATP-dependent Clp protease ATP-binding protein     247   5e-73    
ref|NP_050661.1|  Clp protease ATP binding subunit                      247   5e-73    
ref|YP_008965643.1|  ATP-dependent Clp protease ATP-binding subun...    247   6e-73    
ref|WP_011376649.1|  ATP-dependent Clp protease ATP-binding protein     247   7e-73    
ref|WP_011935205.1|  ATP-dependent Clp protease ATP-binding protein     247   8e-73    
ref|WP_032527486.1|  Clp protease ClpX                                  246   9e-73    
ref|WP_038653496.1|  Clp protease ClpX                                  246   1e-72    
ref|WP_012412218.1|  ATP-dependent Clp protease ATP-binding protein     245   2e-72    
ref|WP_025914744.1|  Clp protease ClpX                                  246   2e-72    
ref|WP_011132721.1|  ATP-dependent Clp protease ATP-binding protein     246   2e-72    
gb|ABR23161.1|  ATP-dependent Clp protease regulatory subunit ClpC      246   2e-72    
ref|WP_025926674.1|  Clp protease ClpX                                  245   2e-72    
ref|XP_002875732.1|  hypothetical protein ARALYDRAFT_484935             234   3e-72    
ref|WP_028090149.1|  Clp protease ClpX                                  244   6e-72    
ref|WP_028082153.1|  Clp protease ClpX                                  244   7e-72    
ref|WP_027404746.1|  Clp protease ClpX                                  244   8e-72    
ref|WP_041458572.1|  Clp protease ClpX                                  243   9e-72    
ref|WP_039200429.1|  Clp protease ClpX                                  243   1e-71    
gb|AFW96628.1|  ATP-dependent Clp family protein                        244   1e-71    
ref|YP_008145463.1|  Clp protease ATP binding subunit                   243   1e-71    
ref|NP_045112.1|  Clp protease ATP binding subunit                      243   2e-71    
ref|YP_005088687.1|  Clp protease ATP binding subunit                   242   3e-71    
ref|WP_016875482.1|  ATP-dependent Clp protease ATP-binding protein     241   1e-70    
gb|EKE04399.1|  hypothetical protein ACD_20C00084G0019                  241   1e-70    
gb|AIA61144.1|  Clp protease ATP binding subunit (chloroplast)          239   4e-70    
ref|WP_019487288.1|  ATP-dependent Clp protease ATP-binding protein     238   7e-70    
ref|WP_039961643.1|  Clp protease ClpX, partial [                       238   8e-70    
ref|YP_007476253.1|  Clp protease ATP binding subunit                   238   1e-69    
ref|WP_026735213.1|  Clp protease ClpX                                  237   2e-69    
ref|WP_015178164.1|  ATPase AAA-2 domain protein                        236   4e-69    
ref|WP_026723037.1|  Clp protease ClpX                                  236   7e-69    
ref|WP_006631728.1|  ATP-dependent Clp protease ATP-binding protein     235   8e-69    
ref|WP_022246485.1|  aTP-dependent Clp protease ATP-binding subun...    235   9e-69    
ref|WP_016866146.1|  ATP-dependent Clp protease ATP-binding protein     234   2e-68    
ref|NP_849021.1|  Clp protease ATP binding subunit                      234   2e-68    
ref|WP_044292615.1|  Clp protease ClpX                                  234   3e-68    
ref|WP_035148903.1|  Clp protease ClpX                                  234   3e-68    
ref|WP_017321287.1|  ATP-dependent Clp protease ATP-binding protein     234   3e-68    
gb|AFY59127.1|  ATPase with chaperone activity, ATP-binding subunit     234   4e-68    
ref|WP_016861614.1|  ATP-dependent Clp protease ATP-binding protein     233   9e-68    
ref|WP_017310273.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    232   1e-67    
ref|WP_009453815.1|  MULTISPECIES: ATP-dependent Clp protease ATP...    232   2e-67    
ref|WP_021945551.1|  aTP-dependent Clp protease ATP-binding subun...    231   3e-67    
ref|WP_022482201.1|  aTP-dependent Clp protease ATP-binding subun...    231   3e-67    
gb|AJH65844.1|  ATP-dependent Clp protease                              231   5e-67    
ref|WP_027845315.1|  Clp protease ClpX                                  230   6e-67    
ref|WP_022442206.1|  aTP-dependent Clp protease ATP-binding subun...    230   6e-67    
ref|WP_022457401.1|  aTP-dependent Clp protease ATP-binding subun...    230   7e-67    
ref|WP_017744020.1|  ATP-dependent Clp protease ATP-binding protein     230   8e-67    
gb|KIE09004.1|  Clp protease ClpX                                       230   8e-67    
ref|WP_021865017.1|  aTP-dependent Clp protease ATP-binding subun...    229   1e-66    
ref|WP_015180848.1|  chaperone ATPase                                   229   1e-66    
ref|WP_021918297.1|  aTP-dependent Clp protease ATP-binding subun...    229   2e-66    
ref|WP_041961191.1|  hypothetical protein                               219   3e-66    
ref|WP_011612826.1|  ATP-dependent Clp protease ATP-binding protein     228   4e-66    
ref|WP_022491472.1|  aTP-dependent Clp protease ATP-binding subun...    228   6e-66    
ref|WP_027249957.1|  Clp protease ClpX                                  228   6e-66    
ref|WP_027255145.1|  Clp protease ClpX                                  227   7e-66    
ref|WP_026788043.1|  Clp protease ClpX                                  227   7e-66    
ref|WP_026795288.1|  MULTISPECIES: Clp protease ClpX                    227   7e-66    
gb|KEI67511.1|  ClpC                                                    227   8e-66    
ref|WP_042154632.1|  Clp protease ClpX                                  227   1e-65    
ref|WP_022023066.1|  aTP-dependent Clp protease regulatory subunit      226   1e-65    
ref|WP_006196989.1|  ATP-dependent Clp protease ATP-binding protein     226   2e-65    
ref|WP_019489373.1|  ATP-dependent Clp protease ATP-binding protein     226   2e-65    
ref|WP_015199655.1|  ATPase                                             226   2e-65    
ref|WP_022485745.1|  aTP-dependent Clp protease regulatory subunit      226   2e-65    
ref|WP_026796680.1|  Clp protease ClpX                                  226   2e-65    
ref|WP_015137763.1|  chaperone ATPase                                   226   3e-65    
ref|YP_009051035.1|  Clp protease ATP binding subunit                   225   6e-65    
ref|YP_003359282.1|  Clp protease ATP binding subunit                   224   7e-65    
gb|KIJ85031.1|  Clp protease ClpX                                       224   1e-64    
ref|WP_017716489.1|  ATP-dependent Clp protease ATP-binding protein     223   2e-64    
ref|YP_002049416.1|  endopeptidase Clp ATP-binding chain C              224   2e-64    
ref|WP_009785004.1|  ATP-dependent Clp protease ATP-binding protein     223   3e-64    
ref|WP_023064483.1|  sigma-54 interaction domain protein                223   3e-64    
ref|WP_041038849.1|  Clp protease ClpX                                  223   3e-64    
ref|WP_012446636.1|  ATP-dependent Clp protease ATP-binding protein     223   4e-64    
ref|WP_016953419.1|  ATP-dependent Clp protease ATP-binding protein     222   5e-64    
ref|WP_015181544.1|  chaperone ATPase                                   222   8e-64    
ref|WP_027415299.1|  Clp protease ClpX                                  221   1e-63    
gb|ABC02412.1|  ClpC                                                    211   1e-63    



>gb|EYU24516.1| hypothetical protein MIMGU_mgv1a0010411mg, partial [Erythranthe 
guttata]
Length=400

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGA+PSNIRTQVIRMVGESAEAVG
Sbjct  179  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGAEPSNIRTQVIRMVGESAEAVG  238

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  239  AGVGGGSSGTKMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGRRTKNNPCLIG  298

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  299  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  358

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  359  KQSDEIILFIDEVHTLIGA  377



>ref|XP_004171086.1| PREDICTED: chaperone protein ClpC, chloroplastic-like, partial 
[Cucumis sativus]
Length=475

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  241

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  242  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  362  KQSDEIILFIDEVHTLIGA  380



>emb|CBI15747.3| unnamed protein product [Vitis vinifera]
Length=746

 Score =   322 bits (825),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  229  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  288

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGT+G KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  289  AGVGGGTTGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  348

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  349  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  408

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  409  KQSDEIILFIDEVHTLIGA  427



>ref|XP_011083076.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent Clp protease ATP-binding 
subunit clpA homolog CD4B, chloroplastic [Sesamum 
indicum]
Length=928

 Score =   325 bits (834),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 197/199 (99%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESAEAVG
Sbjct  186  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESAEAVG  245

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  246  AGVGGGTSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  305

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  306  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  365

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  366  KQSDEIILFIDEVHTLIGA  384



>gb|KCW48520.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=528

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLEN+GADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENMGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTK+AEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKMAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI++GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRISSGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>gb|KGN63436.1| hypothetical protein Csa_1G000600 [Cucumis sativus]
Length=862

 Score =   322 bits (826),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  121  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  180

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  181  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  240

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  241  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  300

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  301  KQSDEIILFIDEVHTLIGA  319



>ref|XP_011073186.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Sesamum indicum]
Length=924

 Score =   323 bits (828),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 195/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESAEAVG
Sbjct  183  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESAEAVG  242

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ+QIERVTQILGRRTKNNPCLIG
Sbjct  243  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQEQIERVTQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  363  KQSDEIILFIDEVHTLIGA  381



>ref|XP_004252280.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum lycopersicum]
Length=923

 Score =   323 bits (828),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 196/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESNEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ASVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_006346636.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Solanum tuberosum]
Length=923

 Score =   323 bits (828),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 196/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESNEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ASVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_009769540.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana sylvestris]
Length=923

 Score =   323 bits (827),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 196/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESNEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ASVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_009615664.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Nicotiana tomentosiformis]
Length=923

 Score =   323 bits (827),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 196/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESNEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ASVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_009403788.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRMVGE+ EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMVGETTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>sp|P31542.1|CLPAB_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4B, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34161.1| ATP-dependent protease (CD4B) [Solanum lycopersicum]
Length=923

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 196/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESNEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ASVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_008464372.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Cucumis melo]
Length=923

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  241

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  242  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  362  KQSDEIILFIDEVHTLIGA  380



>ref|XP_009798134.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nicotiana sylvestris]
Length=923

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 195/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESNEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ASVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQLQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>gb|EEC77204.1| hypothetical protein OsI_15716 [Oryza sativa Indica Group]
Length=785

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  177  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  236

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  237  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  296

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  297  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  356

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IILFIDEVHTLIGA
Sbjct  357  KQNDDIILFIDEVHTLIGA  375



>emb|CDO98310.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESAEAV 
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESAEAVA  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A +GGG+S  KMPTLEEYGTNLTK+AEEGKLDPVVGRQ+QIERVTQILGRRTKNNPCLIG
Sbjct  241  AGLGGGSSSNKMPTLEEYGTNLTKMAEEGKLDPVVGRQEQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_009592686.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 195/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  193  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESNEAVG  252

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  253  ASVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQLQIERVTQILGRRTKNNPCLIG  312

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  313  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  372

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  373  KQSDEIILFIDEVHTLIGA  391



>ref|XP_009592687.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=927

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 195/199 (98%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  185  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESNEAVG  244

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  245  ASVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQLQIERVTQILGRRTKNNPCLIG  304

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  305  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  364

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  365  KQSDEIILFIDEVHTLIGA  383



>ref|XP_010663794.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
 ref|XP_010663795.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Vitis vinifera]
Length=923

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGT+G KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  AGVGGGTTGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_003523172.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
1 [Glycine max]
 ref|XP_003523173.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
2 [Glycine max]
Length=922

 Score =   322 bits (824),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGESA++V 
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESADSVT  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ATVGSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_007137864.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
 gb|ESW09858.1| hypothetical protein PHAVU_009G162100g [Phaseolus vulgaris]
Length=922

 Score =   322 bits (824),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGESA++V 
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESADSVT  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ATVGSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_004501745.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501746.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501747.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X3 [Cicer arietinum]
Length=923

 Score =   321 bits (823),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGESA++V 
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESADSVT  241

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  242  ATVGSGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  362  KQSDEIILFIDEVHTLIGA  380



>ref|XP_009387981.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387982.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=922

 Score =   321 bits (823),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIVNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_010942381.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ+QIERVTQILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQEQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_003526929.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006581844.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN09721.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=922

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGESA++V 
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESADSVT  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ATVGSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>gb|AAL10478.1| AT3g48870/T21J18_140 [Arabidopsis thaliana]
Length=558

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  204  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  263

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  264  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  323

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  324  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  383

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  384  RQSDEIILFIDEVHTLIGA  402



>ref|XP_003575034.2| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Brachypodium 
distachyon]
Length=921

 Score =   321 bits (822),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRITNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IILFIDEVHTLIGA
Sbjct  360  KQSDDIILFIDEVHTLIGA  378



>gb|EPS57458.1| hypothetical protein M569_17359, partial [Genlisea aurea]
Length=342

 Score =   305 bits (780),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 186/191 (97%), Positives = 187/191 (98%), Gaps = 0/191 (0%)
 Frame = +3

Query  27   GHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavgaavgggts  206
            GHNYIGSEHLLLGLLREGEGVAARVLENLGADP NIR QVIRMVGESAEAVGA VGGG+S
Sbjct  1    GHNYIGSEHLLLGLLREGEGVAARVLENLGADPGNIRNQVIRMVGESAEAVGAGVGGGSS  60

Query  207  gQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA  386
            G KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA
Sbjct  61   GNKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA  120

Query  387  IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIIL  566
            IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIIL
Sbjct  121  IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIIL  180

Query  567  FIDEVHTLIGA  599
            FIDEVHTLIGA
Sbjct  181  FIDEVHTLIGA  191



>ref|XP_003575035.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brachypodium 
distachyon]
Length=921

 Score =   320 bits (821),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRITNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IILFIDEVHTLIGA
Sbjct  360  KQSDDIILFIDEVHTLIGA  378



>ref|XP_003630582.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
[Medicago truncatula]
 gb|AET05058.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=926

 Score =   320 bits (821),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGE A++VG
Sbjct  185  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGEGADSVG  244

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  245  ATVGSGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  304

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  305  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  364

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  365  KQSDEIILFIDEVHTLIGA  383



>ref|XP_008457503.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Cucumis melo]
Length=924

 Score =   320 bits (821),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGES EAVG
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPANIRTQVIRMVGESTEAVG  241

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  242  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  362  KQSDEIILFIDEVHTLIGA  380



>ref|XP_004152900.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162592.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
 gb|KGN65697.1| hypothetical protein Csa_1G502360 [Cucumis sativus]
Length=924

 Score =   320 bits (820),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGES EAVG
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPANIRTQVIRMVGESTEAVG  241

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  242  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  362  KQSDEIILFIDEVHTLIGA  380



>ref|XP_004503801.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X1 [Cicer arietinum]
 ref|XP_004503802.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 
X2 [Cicer arietinum]
Length=926

 Score =   320 bits (820),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGE A+ VG
Sbjct  185  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGEGADNVG  244

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  245  ATVGSGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  304

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  305  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  364

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  365  KQSDEIILFIDEVHTLIGA  383



>ref|XP_008791045.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Phoenix dactylifera]
Length=920

 Score =   320 bits (820),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM+EI
Sbjct  301  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMDEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_010249192.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Nelumbo nucifera]
Length=916

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGAD SNIRTQVIRMVGES EAVG
Sbjct  178  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADQSNIRTQVIRMVGESTEAVG  237

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  238  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  297

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  298  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  357

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  358  KQSDEIILFIDEVHTLIGA  376



>emb|CAE05148.2| OSJNBa0039C07.4 [Oryza sativa Japonica Group]
Length=888

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  147  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  206

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  207  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  266

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  267  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  326

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IILFIDEVHTLIGA
Sbjct  327  KQNDDIILFIDEVHTLIGA  345



>ref|XP_009393873.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=922

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_006652229.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Oryza 
brachyantha]
Length=888

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  147  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  206

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  207  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  266

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  267  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  326

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IILFIDEVHTLIGA
Sbjct  327  KQNDDIILFIDEVHTLIGA  345



>ref|XP_010929657.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Elaeis guineensis]
Length=920

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ+QIERVTQILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQEQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM+EI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMDEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>sp|Q7F9I1.2|CLPC1_ORYSJ RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; Flags: Precursor 
[Oryza sativa Japonica Group]
Length=918

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  177  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  236

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  237  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  296

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  297  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  356

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IILFIDEVHTLIGA
Sbjct  357  KQNDDIILFIDEVHTLIGA  375



>ref|XP_006341485.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=925

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES+EAVG
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESSEAVG  241

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  242  ASVGGGTSGLKMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IILFIDEVHTLIGA
Sbjct  362  KQSDDIILFIDEVHTLIGA  380



>ref|XP_010678345.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=923

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGT+G KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  AGVGGGTTGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIATGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>sp|P31541.1|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog CD4A, chloroplastic; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum]
Length=926

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGES+EAVG
Sbjct  183  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESSEAVG  242

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  243  ASVGGGTSGLKMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  363  KQSDEIILFIDEVHTLIGA  381



>ref|XP_004235839.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic [Solanum lycopersicum]
Length=926

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 194/199 (97%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGES+EAVG
Sbjct  183  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESSEAVG  242

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  243  ASVGGGTSGLKMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  363  KQSDEIILFIDEVHTLIGA  381



>gb|KEH35794.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=927

 Score =   318 bits (816),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGE A+ VG
Sbjct  186  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGEGADNVG  245

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  246  ATVGSGSSNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  305

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGK+VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  306  EPGVGKTAIAEGLAQRIANGDVPETIEGKQVITLDMGLLVAGTKYRGEFEERLKKLMEEI  365

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  366  KQSDEIILFIDEVHTLIGA  384



>ref|XP_009404743.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009404744.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=921

 Score =   318 bits (815),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLL EGEGVAARVLE+LGADPSNIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLHEGEGVAARVLESLGADPSNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A V GG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ+QIERVTQILGRRTKNNPCLIG
Sbjct  240  AGVVGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQEQIERVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM+EI
Sbjct  300  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMDEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IILFIDEVHTLIGA
Sbjct  360  KQSDDIILFIDEVHTLIGA  378



>gb|KJB19711.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=753

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE  E   
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGEGNEVSV  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G +  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERV QILGRRTKNNPCLIG
Sbjct  241  VTGGSGVNT-KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_009368798.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   318 bits (814),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  240  AGVGGGTSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIATGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_008374277.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=936

 Score =   318 bits (814),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  240  AGVGGGTSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIATGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_004975454.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=921

 Score =   317 bits (813),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+++IILFIDEVHTLIGA
Sbjct  360  KQNEDIILFIDEVHTLIGA  378



>gb|KEH35688.1| ATP-dependent Clp protease ATP-binding subunit [Medicago truncatula]
Length=922

 Score =   317 bits (813),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGESA+ V 
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESADNVT  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+S  K PTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ATVGSGSSNNKTPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IILFIDEVHTLIGA
Sbjct  361  KQSDDIILFIDEVHTLIGA  379



>ref|XP_008663153.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Zea mays]
 gb|AFW58112.1| hypothetical protein ZEAMMB73_120778 [Zea mays]
Length=921

 Score =   317 bits (813),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+++IILFIDEVHTLIGA
Sbjct  360  KQNEDIILFIDEVHTLIGA  378



>ref|XP_008239551.1| PREDICTED: chaperone protein ClpC, chloroplastic [Prunus mume]
Length=922

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIATGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>gb|EAZ30583.1| hypothetical protein OsJ_14634 [Oryza sativa Japonica Group]
Length=1033

 Score =   319 bits (818),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  292  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  351

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG
Sbjct  352  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  411

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  412  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  471

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IILFIDEVHTLIGA
Sbjct  472  KQNDDIILFIDEVHTLIGA  490



>ref|XP_007210385.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
 gb|EMJ11584.1| hypothetical protein PRUPE_ppa001062mg [Prunus persica]
Length=921

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIATGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>gb|AAD02267.1| ClpC protease [Spinacia oleracea]
Length=891

 Score =   317 bits (811),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGT+G KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  240  AGVGGGTTGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVPETIEGKKVITL MGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIATGDVPETIEGKKVITLHMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_002447724.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
 gb|EES12052.1| hypothetical protein SORBIDRAFT_06g014590 [Sorghum bicolor]
Length=921

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGR+DQIERVTQILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRRDQIERVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+++IILFIDEVHTLIGA
Sbjct  360  KQNEDIILFIDEVHTLIGA  378



>ref|XP_004975455.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Setaria 
italica]
Length=918

 Score =   317 bits (812),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADP+NIRTQVIRMVGES EAVG
Sbjct  177  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPNNIRTQVIRMVGESTEAVG  236

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ+QIERVTQILGRRTKNNPCLIG
Sbjct  237  AGVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQNQIERVTQILGRRTKNNPCLIG  296

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  297  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  356

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+++IILFIDEVHTLIGA
Sbjct  357  KQNEDIILFIDEVHTLIGA  375



>ref|XP_006485108.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006485109.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Citrus sinensis]
Length=923

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 191/199 (96%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_008392716.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Malus domestica]
Length=921

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  240  AGVGGGTSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_004297496.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic [Fragaria vesca subsp. vesca]
Length=922

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G GTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  241  VGAGQGTSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_009337515.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009337516.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Pyrus x bretschneideri]
Length=921

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGGTSG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  240  AGVGGGTSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>gb|EEE52971.1| hypothetical protein OsJ_35634 [Oryza sativa Japonica Group]
Length=832

 Score =   314 bits (805),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRM+GE+ EAVG
Sbjct  91   SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMIGETTEAVG  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  151  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  211  EPGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  271  KQSDEIILFIDEVHTLIGA  289



>ref|XP_010036860.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 ref|XP_010036861.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic isoform X1 [Eucalyptus grandis]
 gb|KCW48521.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   316 bits (809),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLEN+GADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENMGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTK+AEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKMAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI++GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRISSGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_010036862.1| PREDICTED: chaperone protein ClpC, chloroplastic isoform X2 [Eucalyptus 
grandis]
 gb|KCW48519.1| hypothetical protein EUGRSUZ_K02198 [Eucalyptus grandis]
Length=922

 Score =   315 bits (808),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLEN+GADPSNIRTQVIRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENMGADPSNIRTQVIRMVGESTEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTK+AEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  241  AGVGGGSSGNKMPTLEEYGTNLTKMAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI++GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRISSGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>sp|P35100.1|CLPC_PEA RecName: Full=Chaperone protein ClpC, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog; 
AltName: Full=Casein lytic proteinase C; Flags: Precursor 
[Pisum sativum]
 gb|AAA33680.1| nuclear encoded precursor to chloroplast protein [Pisum sativum]
Length=922

 Score =   315 bits (808),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            S EEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGESA++V 
Sbjct  181  SQEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESADSVT  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G+S  K PTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ATVGSGSSNNKTPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IILFIDEVHTLIGA
Sbjct  361  KQSDDIILFIDEVHTLIGA  379



>dbj|BAJ99801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=920

 Score =   315 bits (807),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQV+RM+GE+ EAVG
Sbjct  179  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVVRMIGETTEAVG  238

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGR+ QIERV QILGRRTKNNPCLIG
Sbjct  239  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGREPQIERVVQILGRRTKNNPCLIG  298

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  299  EPGVGKTAIAEGLAQRISNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  358

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  359  KQSDEIILFIDEVHTLIGA  377



>ref|XP_004960741.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004960742.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like isoform 
X2 [Setaria italica]
Length=921

 Score =   315 bits (807),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRM+GE+ EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMIGETTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|NP_001066442.1| Os12g0230100 [Oryza sativa Japonica Group]
 sp|Q2QVG9.2|CLPC2_ORYSJ RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=Casein lytic proteinase C2; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA96309.2| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG21929.1| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29461.1| Os12g0230100 [Oryza sativa Japonica Group]
Length=919

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRM+GE+ EAVG
Sbjct  178  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMIGETTEAVG  237

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  238  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  297

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  298  EPGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  357

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  358  KQSDEIILFIDEVHTLIGA  376



>ref|XP_006663917.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Oryza 
brachyantha]
Length=919

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRM+GE+ EAVG
Sbjct  178  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMIGETTEAVG  237

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  238  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  297

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  298  EPGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  357

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  358  KQSDEIILFIDEVHTLIGA  376



>ref|NP_001169540.1| uncharacterized protein LOC100383416 [Zea mays]
 gb|ACN34070.1| unknown [Zea mays]
 gb|AFW56690.1| cytokinin inducible protease1 [Zea mays]
Length=921

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRM+GE+ EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMIGETTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_010238595.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brachypodium 
distachyon]
Length=920

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQV+RM+GE+ EAVG
Sbjct  179  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVVRMIGETTEAVG  238

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  239  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  298

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI++GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  299  EPGVGKTAIAEGLAQRISSGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  358

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  359  KQSDEIILFIDEVHTLIGA  377



>ref|XP_006290258.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23156.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=750

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  229  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  288

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  289  SVGGGSSSNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  348

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  349  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  408

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  409  RQSDDIILFIDEVHTLIGA  427



>gb|KJB07945.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
 gb|KJB07946.1| hypothetical protein B456_001G054700 [Gossypium raimondii]
Length=920

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE  E   
Sbjct  179  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGEGNEVSV  238

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G   +  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERV QILGRRTKNNPCLIG
Sbjct  239  VTGGSTGNT-KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVVQILGRRTKNNPCLIG  297

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  298  EPGVGKTAIAEGLAQRIATGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  357

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  358  KQSDEIILFIDEVHTLIGA  376



>gb|KJB19710.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=922

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE  E   
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGEGNEVSV  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G +  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERV QILGRRTKNNPCLIG
Sbjct  241  VTGGSGVNT-KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_007159971.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
 gb|ESW31965.1| hypothetical protein PHAVU_002G282500g [Phaseolus vulgaris]
Length=923

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 186/200 (93%), Positives = 192/200 (96%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIR+QVIRMVGE A++VG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPNNIRSQVIRMVGEGADSVG  240

Query  183  aavgg-gtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
            A VG   ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLI
Sbjct  241  ATVGPGSSNNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLI  300

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  301  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  360

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEIILFIDEVHTLIGA
Sbjct  361  IKQSDEIILFIDEVHTLIGA  380



>emb|CDX84888.1| BnaA03g13420D [Brassica napus]
Length=827

 Score =   312 bits (800),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  91   SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG  S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  151  NVGGGSGS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  209

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  210  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  269

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  270  KQSDEIILFIDEVHTLIGA  288



>ref|XP_010472984.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=814

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  69   SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  128

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  129  NVGGGSSN-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  187

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  188  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  247

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  248  RQSDEIILFIDEVHTLIGA  266



>ref|XP_010250553.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
 ref|XP_010250554.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X2 [Nelumbo nucifera]
Length=916

 Score =   313 bits (803),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLL EGEGVAARVLENLGAD +NIRTQVIRMVGES EAVG
Sbjct  179  SLEEARQLGHNYIGSEHLLLGLLHEGEGVAARVLENLGADSNNIRTQVIRMVGESTEAVG  238

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGK+DPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  239  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKVDPVVGRQQQIERVTQILGRRTKNNPCLIG  298

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  299  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  358

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  359  KQSDEIILFIDEVHTLIGA  377



>ref|XP_003525431.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
 gb|KHN17465.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 186/200 (93%), Positives = 191/200 (96%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP+NIR QVIRMVGE A++VG
Sbjct  177  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPNNIRAQVIRMVGEGADSVG  236

Query  183  aavgg-gtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
            A VG   ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLI
Sbjct  237  ATVGPGSSNNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLI  296

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  297  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  356

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEIILFIDEVHTLIGA
Sbjct  357  IKQSDEIILFIDEVHTLIGA  376



>gb|KDO51290.1| hypothetical protein CISIN_1g003094mg [Citrus sinensis]
Length=848

 Score =   312 bits (799),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 188/197 (95%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = +3

Query  9    EEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavgaa  188
            EEAR+LGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES EAVGA 
Sbjct  108  EEARRLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTEAVGAG  167

Query  189  vgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEP  368
            VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIGEP
Sbjct  168  VGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEP  227

Query  369  GVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ  548
            GVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ
Sbjct  228  GVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ  287

Query  549  SDEIILFIDEVHTLIGA  599
            SDEIILFIDEVHTLIGA
Sbjct  288  SDEIILFIDEVHTLIGA  304



>gb|ABK95905.1| unknown [Populus trichocarpa]
Length=835

 Score =   311 bits (798),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 188/200 (94%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES E + 
Sbjct  91   SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTENLA  150

Query  183  aavggg-tsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
             +  G  +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLI
Sbjct  151  GSTVGPGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVIQILGRRTKNNPCLI  210

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  211  GEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  270

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEI+LFIDEVHTLIGA
Sbjct  271  IKQSDEIMLFIDEVHTLIGA  290



>ref|XP_006374569.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
 gb|ERP52366.1| hypothetical protein POPTR_0015s11640g [Populus trichocarpa]
Length=835

 Score =   311 bits (797),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 188/200 (94%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES E + 
Sbjct  91   SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTENLA  150

Query  183  aavggg-tsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
             +  G  +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLI
Sbjct  151  GSTVGPGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVIQILGRRTKNNPCLI  210

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  211  GEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  270

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEI+LFIDEVHTLIGA
Sbjct  271  IKQSDEIMLFIDEVHTLIGA  290



>ref|XP_011042955.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   313 bits (802),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 188/200 (94%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES E + 
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTENLA  241

Query  183  aavggg-tsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
             +  G  +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLI
Sbjct  242  GSTVGPGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLI  301

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  302  GEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  361

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEIILFIDEVHTLIGA
Sbjct  362  IKQSDEIILFIDEVHTLIGA  381



>ref|XP_006376920.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 ref|XP_006376921.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|ERP54717.1| hypothetical protein POPTR_0012s10770g [Populus trichocarpa]
 gb|ERP54718.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=926

 Score =   313 bits (802),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 188/200 (94%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES E + 
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTENLA  241

Query  183  aavggg-tsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
             +  G  +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLI
Sbjct  242  GSTVGPGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLI  301

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  302  GEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  361

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEIILFIDEVHTLIGA
Sbjct  362  IKQSDEIILFIDEVHTLIGA  381



>ref|XP_010250552.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like isoform X1 [Nelumbo nucifera]
Length=945

 Score =   313 bits (802),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLL EGEGVAARVLENLGAD +NIRTQVIRMVGES EAVG
Sbjct  208  SLEEARQLGHNYIGSEHLLLGLLHEGEGVAARVLENLGADSNNIRTQVIRMVGESTEAVG  267

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGK+DPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  268  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKVDPVVGRQQQIERVTQILGRRTKNNPCLIG  327

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  328  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  387

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  388  KQSDEIILFIDEVHTLIGA  406



>ref|XP_002977161.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
 gb|EFJ21770.1| hypothetical protein SELMODRAFT_176012 [Selaginella moellendorffii]
Length=901

 Score =   312 bits (800),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP NIRTQVIRMVGES EAVG
Sbjct  157  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPGNIRTQVIRMVGESTEAVG  216

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGG+S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  217  ASVGGGSSSNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  276

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVPETIEGKKV+TLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  277  EPGVGKTAIAEGLAQRIATGDVPETIEGKKVVTLDMGLLVAGTKYRGEFEERLKKLMEEI  336

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IIL IDEVHTLIGA
Sbjct  337  KQSDDIILVIDEVHTLIGA  355



>ref|XP_002965312.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
 gb|EFJ34150.1| hypothetical protein SELMODRAFT_439163 [Selaginella moellendorffii]
Length=937

 Score =   313 bits (802),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADP NIRTQVIRMVGES EAVG
Sbjct  193  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPGNIRTQVIRMVGESTEAVG  252

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGG+S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  253  ASVGGGSSSNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  312

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GDVPETIEGKKV+TLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  313  EPGVGKTAIAEGLAQRIATGDVPETIEGKKVVTLDMGLLVAGTKYRGEFEERLKKLMEEI  372

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IIL IDEVHTLIGA
Sbjct  373  KQSDDIILVIDEVHTLIGA  391



>ref|NP_001190035.1| Clp ATPase [Arabidopsis thaliana]
 gb|AEE78467.1| Clp ATPase [Arabidopsis thaliana]
Length=921

 Score =   313 bits (801),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  173  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  232

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  233  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  292

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  293  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  352

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  353  RQSDEIILFIDEVHTLIGA  371



>ref|XP_010555578.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010555579.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=927

 Score =   313 bits (801),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG  S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSNS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  363  KQSDEIILFIDEVHTLIGA  381



>ref|XP_009132682.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Brassica rapa]
Length=929

 Score =   313 bits (801),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG  S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSGS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  363  KQSDEIILFIDEVHTLIGA  381



>gb|KDP22549.1| hypothetical protein JCGZ_26380 [Jatropha curcas]
Length=924

 Score =   313 bits (801),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES E + 
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTENIP  241

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G    KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  242  APVGPGGGSNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVIQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIE KKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIASGDVPETIERKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  362  KQSDEIILFIDEVHTLIGA  380



>ref|XP_002511102.1| ATP-dependent clp protease, putative [Ricinus communis]
 gb|EEF51704.1| ATP-dependent clp protease, putative [Ricinus communis]
Length=924

 Score =   312 bits (800),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES E + 
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTENIP  241

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VG G    KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  242  APVGPGGGSNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVIQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIE KKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIASGDVPETIERKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  362  KQSDEIILFIDEVHTLIGA  380



>emb|CDY45800.1| BnaC03g16230D [Brassica napus]
Length=921

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  185  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  244

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG  S  KMPTLEEYGTNLTK+AEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  245  NVGGGSGS-NKMPTLEEYGTNLTKMAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  303

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  304  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  363

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  364  KQSDEIILFIDEVHTLIGA  382



>ref|NP_568746.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
 sp|Q9FI56.1|CLPC1_ARATH RecName: Full=Chaperone protein ClpC1, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
1; AltName: Full=Casein lytic proteinase C1; AltName: 
Full=Protein DE-REGULATED CAO ACCUMULATION 1; AltName: Full=Protein 
IRON-RESCUED MUTANT 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08738.1| ATP-dependent Clp protease, ATP-binding subunit [Arabidopsis 
thaliana]
 gb|AAM26692.1| AT5g50920/K3K7_7 [Arabidopsis thaliana]
 dbj|BAE99213.1| ATP-dependent Clp protease [Arabidopsis thaliana]
 gb|AED96011.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Arabidopsis 
thaliana]
Length=929

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSSS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  363  RQSDEIILFIDEVHTLIGA  381



>ref|XP_011040255.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
 ref|XP_011040256.1| PREDICTED: chaperone protein ClpC, chloroplastic [Populus euphratica]
Length=926

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 188/200 (94%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGES E + 
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESTENLA  241

Query  183  aavggg-tsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
             +  G  +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLI
Sbjct  242  GSTVGPGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVIQILGRRTKNNPCLI  301

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  302  GEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  361

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEI+LFIDEVHTLIGA
Sbjct  362  IKQSDEIMLFIDEVHTLIGA  381



>ref|XP_002865831.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42090.1| heat shock protein 93-V [Arabidopsis lyrata subsp. lyrata]
Length=929

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSSS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  363  RQSDEIILFIDEVHTLIGA  381



>ref|NP_566912.2| Clp ATPase [Arabidopsis thaliana]
 sp|Q9SXJ7.1|CLPC2_ARATH RecName: Full=Chaperone protein ClpC2, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
2; AltName: Full=AtClpC; AltName: Full=Casein lytic proteinase 
C2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAA82062.1| AtClpC [Arabidopsis thaliana]
 gb|AEE78466.1| Clp ATPase [Arabidopsis thaliana]
Length=952

 Score =   312 bits (800),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  204  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  263

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  264  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  323

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  324  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  383

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  384  RQSDEIILFIDEVHTLIGA  402



>ref|XP_006402040.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
 gb|ESQ43493.1| hypothetical protein EUTSA_v10012603mg [Eutrema salsugineum]
Length=929

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSSS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  363  RQSDEIILFIDEVHTLIGA  381



>ref|XP_006279971.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
 gb|EOA12869.1| hypothetical protein CARUB_v10025837mg [Capsella rubella]
Length=929

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSSN-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  363  RQSDEIILFIDEVHTLIGA  381



>ref|XP_010442575.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSSN-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  363  RQSDEIILFIDEVHTLIGA  381



>ref|XP_010482409.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Camelina sativa]
Length=929

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSSN-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  363  RQSDEIILFIDEVHTLIGA  381



>ref|XP_010442573.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=929

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  184  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  244  NVGGGSSN-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  363  RQSDEIILFIDEVHTLIGA  381



>ref|XP_010536587.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=929

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  185  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  244

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  245  NVGGGSSG-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVVQILGRRTKNNPCLIG  303

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI++GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  304  EPGVGKTAIAEGLAQRISSGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  363

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  364  KQSDEIILFIDEVHTLIGA  382



>ref|XP_010536586.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=936

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  192  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  251

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  252  NVGGGSSG-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVVQILGRRTKNNPCLIG  310

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI++GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  311  EPGVGKTAIAEGLAQRISSGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  370

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  371  KQSDEIILFIDEVHTLIGA  389



>ref|XP_002877635.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53894.1| AtClpC [Arabidopsis lyrata subsp. lyrata]
Length=953

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  204  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  263

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  264  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  323

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  324  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  383

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  384  RQSDEIILFIDEVHTLIGA  402



>ref|XP_006367832.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Solanum tuberosum]
Length=921

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYI SEHLLLGLLR+GEGVAARVLENLGADPSNIRTQVIRMVGES++   
Sbjct  184  SLEEARQLGHNYIHSEHLLLGLLRQGEGVAARVLENLGADPSNIRTQVIRMVGESSDGAT  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G      KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  244  VGGGTSGL--KMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IILFIDEVHTLIGA
Sbjct  362  KQSDDIILFIDEVHTLIGA  380



>gb|EEC69045.1| hypothetical protein OsI_37876 [Oryza sativa Indica Group]
Length=1412

 Score =   316 bits (809),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRM+GE+ EAVG
Sbjct  671  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMIGETTEAVG  730

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  731  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  790

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  791  EPGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  850

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  851  KQSDEIILFIDEVHTLIGA  869



>ref|XP_010426385.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
 ref|XP_010426386.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Camelina sativa]
Length=927

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  179  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  238

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  239  SVGGGSSSNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  298

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  299  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  358

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  359  RQSDDIILFIDEVHTLIGA  377



>emb|CAN78847.1| hypothetical protein VITISV_010724 [Vitis vinifera]
Length=890

 Score =   310 bits (794),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 178/199 (89%), Gaps = 7/199 (4%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQ  + VG       
Sbjct  155  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQASKAVGAGVGGGT  214

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                      KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  215  TG-------NKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKNNPCLIG  267

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  268  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  327

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  328  KQSDEIILFIDEVHTLIGA  346



>ref|XP_010503529.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010503530.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  240  SVGGGSSSNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  360  RQSDDIILFIDEVHTLIGA  378



>ref|XP_001779162.1| predicted protein [Physcomitrella patens]
 gb|EDQ56008.1| predicted protein [Physcomitrella patens]
Length=922

 Score =   310 bits (795),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ EAVG
Sbjct  191  SLEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEAVG  250

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G+   KMPTLEEYGTNLTKLAEEGKLDPVVGR  QIERVTQILGRRTKNNPCLIG
Sbjct  251  VGGGSGSGSNKMPTLEEYGTNLTKLAEEGKLDPVVGRVAQIERVTQILGRRTKNNPCLIG  310

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTA+AEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  311  EPGVGKTAVAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  370

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IIL IDEVHTLIGA
Sbjct  371  KQADDIILVIDEVHTLIGA  389



>ref|XP_003532383.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine 
max]
Length=919

 Score =   310 bits (795),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 190/200 (95%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENL ADP+NIR QVIRMVGE A++VG
Sbjct  177  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLAADPNNIRAQVIRMVGEGADSVG  236

Query  183  aavgg-gtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
            A VG   ++  KMPTLEEYGTNLTKLAEEGKLDPV+GRQ QIERVTQILGRRTKNNPCLI
Sbjct  237  ATVGPGSSNNNKMPTLEEYGTNLTKLAEEGKLDPVMGRQPQIERVTQILGRRTKNNPCLI  296

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  297  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  356

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEIILFIDEVHTLIGA
Sbjct  357  IKQSDEIILFIDEVHTLIGA  376



>gb|KHN16879.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=919

 Score =   310 bits (795),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 184/200 (92%), Positives = 190/200 (95%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENL ADP+NIR QVIRMVGE A++VG
Sbjct  177  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLAADPNNIRAQVIRMVGEGADSVG  236

Query  183  aavgg-gtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
            A VG   ++  KMPTLEEYGTNLTKLAEEGKLDPV+GRQ QIERVTQILGRRTKNNPCLI
Sbjct  237  ATVGPGSSNNNKMPTLEEYGTNLTKLAEEGKLDPVMGRQPQIERVTQILGRRTKNNPCLI  296

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  297  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  356

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQSDEIILFIDEVHTLIGA
Sbjct  357  IKQSDEIILFIDEVHTLIGA  376



>emb|CAB87915.1| AtClpC [Arabidopsis thaliana]
Length=952

 Score =   311 bits (796),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  204  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  263

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIER+ QIL RRTKNNPCLIG
Sbjct  264  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERMVQILARRTKNNPCLIG  323

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  324  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  383

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  384  RQSDEIILFIDEVHTLIGA  402



>ref|XP_001766010.1| predicted protein [Physcomitrella patens]
 gb|EDQ69069.1| predicted protein [Physcomitrella patens]
Length=836

 Score =   308 bits (790),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ EAVG
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENTEAVG  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G+SG KMPTLEEYGTNLTKLAEEGKLDPVVGR  QIERVTQILGRRTKNNPCLIG
Sbjct  151  VGAGSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRVAQIERVTQILGRRTKNNPCLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTA+AEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  211  EPGVGKTAVAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IIL IDEVHTLIGA
Sbjct  271  KQADDIILVIDEVHTLIGA  289



>ref|XP_008811697.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Phoenix dactylifera]
Length=916

 Score =   310 bits (794),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGLLREGEGVAARVLE+ GADPSNIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGTEHLLLGLLREGEGVAARVLESFGADPSNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGG +SG KMPTLEEYGTNLTKLA+EG+LDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  240  AGVGGASSGSKMPTLEEYGTNLTKLAQEGRLDPVVGRQQQIERVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK+LMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKRLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            K++D+IILFIDEVHTLIGA
Sbjct  360  KKNDDIILFIDEVHTLIGA  378



>ref|XP_009411804.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
 ref|XP_009411805.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=921

 Score =   310 bits (794),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGAD SNIRTQVIRMVGES EAVG
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADTSNIRTQVIRMVGESTEAVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTL+EYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  240  AGVGGGSSGNKMPTLDEYGTNLTKLAEEGKLDPVVGRQQQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI  GDVPETIEGKKVITLDMGLLVAGTKYRGEFEER+KKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIVTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERIKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_006290259.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
 gb|EOA23157.1| hypothetical protein CARUB_v10016640mg [Capsella rubella]
Length=977

 Score =   311 bits (796),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  229  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  288

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  289  SVGGGSSSNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  348

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  349  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  408

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  409  RQSDDIILFIDEVHTLIGA  427



>ref|XP_001756645.1| predicted protein [Physcomitrella patens]
 gb|EDQ78599.1| predicted protein [Physcomitrella patens]
Length=933

 Score =   310 bits (794),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ EAVG
Sbjct  188  SLEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENTEAVG  247

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G+SG KMPTLEEYGTNLTKLAEEGKLDPVVGR  QIERVTQILGRRTKNNPCLIG
Sbjct  248  VGGGSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRVAQIERVTQILGRRTKNNPCLIG  307

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTA+AEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  308  EPGVGKTAVAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  367

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IIL IDEVHTLIGA
Sbjct  368  KQADDIILVIDEVHTLIGA  386



>ref|XP_007038115.1| CLPC [Theobroma cacao]
 gb|EOY22616.1| CLPC [Theobroma cacao]
Length=922

 Score =   310 bits (793),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE  E   
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGEGNEVSV  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G   +  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  241  VPGGSTGNT-KMPTLEEYGTNLTKLAEEGKLDPVVGRQVQIERVVQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  360  KQSDEIILFIDEVHTLIGA  378



>ref|XP_010519480.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010519481.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Tarenaya 
hassleriana]
Length=926

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCL+G
Sbjct  240  SVGGGASN-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLVG  298

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA GD+PETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  299  EPGVGKTAIAEGLAQRIAGGDIPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  358

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  359  RQSDDIILFIDEVHTLIGA  377



>ref|XP_010515218.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
 ref|XP_010515219.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Camelina 
sativa]
Length=928

 Score =   308 bits (790),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNI+TQVIRMVGE+ E   
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIQTQVIRMVGENNEVTA  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  240  SVGGGSSSNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  360  RQSDDIILFIDEVHTLIGA  378



>ref|XP_001766888.1| predicted protein [Physcomitrella patens]
 gb|EDQ68290.1| predicted protein [Physcomitrella patens]
Length=836

 Score =   306 bits (785),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ EAVG
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENTEAVG  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G+SG KMPTLEEYGTNLTKLAEEGKLDPVVGR  QIERVTQILGRRTKNNPCLIG
Sbjct  151  VRSGSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRISQIERVTQILGRRTKNNPCLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTA+AEGLAQRIA+GDVPETIEGK V+TLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  211  EPGVGKTAVAEGLAQRIASGDVPETIEGKNVVTLDMGLLVAGTKYRGEFEERLKKLMEEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IIL IDEVHTLIGA
Sbjct  271  KQADDIILVIDEVHTLIGA  289



>gb|AAC04687.1| ClpC [Arabidopsis thaliana]
Length=928

 Score =   308 bits (790),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLE  RQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  183  SLEATRQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  242

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG +S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  243  NVGGGSSS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSDEIILFIDEVHTLIGA
Sbjct  362  RQSDEIILFIDEVHTLIGA  380



>gb|EYU21822.1| hypothetical protein MIMGU_mgv1a000973mg [Erythranthe guttata]
Length=925

 Score =   308 bits (789),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            +LEEARQLGHNYIGSEH+LLGLLREGEGVAARVLENLGADP+NIRTQVIRMVGES EAV 
Sbjct  183  ALEEARQLGHNYIGSEHVLLGLLREGEGVAARVLENLGADPNNIRTQVIRMVGESVEAVT  242

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G ++G KMPTLEEYGTNLTKLAEEGKLDPVVGR  QIERVTQILGRRTKNNPCLIG
Sbjct  243  VKGDGNSNG-KMPTLEEYGTNLTKLAEEGKLDPVVGRAAQIERVTQILGRRTKNNPCLIG  301

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  302  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  361

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSD+IILFIDEVHTLIGA
Sbjct  362  KQSDDIILFIDEVHTLIGA  380



>emb|CDY05878.1| BnaC08g20550D [Brassica napus]
Length=932

 Score =   308 bits (789),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGAD SNIRTQVIRMVGE+ E   
Sbjct  183  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADASNIRTQVIRMVGENNEVTA  242

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  243  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  302

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  303  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  362

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  363  RQSDDIILFIDEVHTLIGA  381



>emb|CDY64710.1| BnaA06g38690D [Brassica napus]
Length=822

 Score =   306 bits (783),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLG D SNIRTQVIRMVGE+ E   
Sbjct  91   SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGVDASNIRTQVIRMVGENNEVTA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  151  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  211  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  271  RQSDDIILFIDEVHTLIGA  289



>ref|XP_010550758.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
 ref|XP_010550759.1| PREDICTED: chaperone protein ClpC1, chloroplastic [Tarenaya hassleriana]
Length=926

 Score =   307 bits (786),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLL EGEGVAARVLENLGADP NIRTQVIRMVGE+ E   
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLCEGEGVAARVLENLGADPGNIRTQVIRMVGENNEVTA  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG ++  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  240  SVGGGTSN-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQRQIERVVQILARRTKNNPCLIG  298

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  299  EPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  358

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  359  RQSDDIILFIDEVHTLIGA  377



>ref|XP_009149790.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpC2, chloroplastic 
[Brassica rapa]
Length=930

 Score =   306 bits (785),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLG D SNIRTQVIRMVGE+ E   
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGVDASNIRTQVIRMVGENNEVTA  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  241  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  361  RQSDDIILFIDEVHTLIGA  379



>emb|CDX68504.1| BnaC01g25820D [Brassica napus]
Length=928

 Score =   306 bits (783),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLG D SNIRTQVIRMVGE+ E   
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGVDASNIRTQVIRMVGENNEVTA  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  241  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  361  RQSDDIILFIDEVHTLIGA  379



>ref|XP_009151567.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
 ref|XP_009151572.1| PREDICTED: chaperone protein ClpC2, chloroplastic [Brassica rapa]
Length=928

 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLG D SNIRTQV+RMVGE+ E   
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGVDASNIRTQVVRMVGENNEVTA  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  240  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  360  RQSDDIILFIDEVHTLIGA  378



>ref|XP_008777394.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4B, chloroplastic, partial [Phoenix dactylifera]
Length=731

 Score =   301 bits (771),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +3

Query  30   HNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavgaavgggtsg  209
            HNYIGSEHLLLGLLREGEGVAARVLE+LGADPSNIRTQVIRMVGES EAVGA VGGG+SG
Sbjct  1    HNYIGSEHLLLGLLREGEGVAARVLESLGADPSNIRTQVIRMVGESTEAVGAGVGGGSSG  60

Query  210  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI  389
             K PTLEEYGTNLTKLAEEGKLDPVVGRQ+QIERVTQILGRRTKNNPCLIGEPGVGKTAI
Sbjct  61   HKTPTLEEYGTNLTKLAEEGKLDPVVGRQEQIERVTQILGRRTKNNPCLIGEPGVGKTAI  120

Query  390  AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF  569
            AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEI+LF
Sbjct  121  AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIMLF  180

Query  570  IDEVHTLIGA  599
            IDEVHTLIGA
Sbjct  181  IDEVHTLIGA  190



>ref|XP_006404210.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
 gb|ESQ45663.1| hypothetical protein EUTSA_v10010105mg [Eutrema salsugineum]
Length=929

 Score =   305 bits (782),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENLG D SNIRTQVIRMVGE+ E   
Sbjct  180  SLEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLGVDSSNIRTQVIRMVGENNEVTA  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  240  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  360  RQSDDIILFIDEVHTLIGA  378



>emb|CDX83052.1| BnaA01g20520D [Brassica napus]
Length=927

 Score =   305 bits (782),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLG D SNIRTQV+RMVGE+ E   
Sbjct  180  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGVDASNIRTQVVRMVGENNEVTA  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +  GG +   KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QIL RRTKNNPCLIG
Sbjct  240  SVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILARRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVPETIEGK VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  300  EPGVGKTAIAEGLAQRIASGDVPETIEGKTVITLDMGLLVAGTKYRGEFEERLKKLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            +QSD+IILFIDEVHTLIGA
Sbjct  360  RQSDDIILFIDEVHTLIGA  378



>gb|KJB19712.1| hypothetical protein B456_003G116200 [Gossypium raimondii]
Length=919

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 183/199 (92%), Gaps = 4/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE  E   
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGEGNEVSV  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G +  KMPTLEEYGTNLTKL   GKLDPVVGRQDQIERV QILGRRTKNNPCLIG
Sbjct  241  VTGGSGVNT-KMPTLEEYGTNLTKL---GKLDPVVGRQDQIERVVQILGRRTKNNPCLIG  296

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  297  EPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  356

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  357  KQSDEIILFIDEVHTLIGA  375



>ref|XP_002322299.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
 gb|EEF06426.1| ATP-dependent clp protease ATP-binding subunit clpA family protein 
[Populus trichocarpa]
Length=932

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 184/206 (89%), Gaps = 7/206 (3%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQ-------VIRMvg  161
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQ       + +   
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQASNASFELCQPNF  241

Query  162  esaeavgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTK  341
             +    G+ VG G+S  KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTK
Sbjct  242  LTENLAGSTVGPGSSNNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVIQILGRRTK  301

Query  342  NNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERL  521
            NNPCLIGEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERL
Sbjct  302  NNPCLIGEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERL  361

Query  522  KKLMEEIKQSDEIILFIDEVHTLIGA  599
            KKLMEEIKQSDEI+LFIDEVHTLIGA
Sbjct  362  KKLMEEIKQSDEIMLFIDEVHTLIGA  387



>ref|XP_010446016.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=546

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 182/227 (80%), Gaps = 28/227 (12%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            +LEEARQLGHNYI SEHLLLGLLREGE VA RVLE LGADPSNIRTQVI MVGE+ E   
Sbjct  91   TLEEARQLGHNYIASEHLLLGLLREGESVAVRVLEKLGADPSNIRTQVIHMVGENNEVTA  150

Query  183  aavgggt----------------------------sgQKMPTLEEYGTNLTKLAEEGKLD  278
               GG +                            S  KMPTLEEYGTNLTKLAEEGKLD
Sbjct  151  NVGGGSSADPSNIRTQVIRMVGENNEVTANVGGGSSNNKMPTLEEYGTNLTKLAEEGKLD  210

Query  279  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI  458
            PVVGRQ QIERV QILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVI
Sbjct  211  PVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPETIEGKKVI  270

Query  459  TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGA  599
            TLDMGLLVAGTKYRGEFEERLKKLMEEI+QSDEIILFIDEVHTLIGA
Sbjct  271  TLDMGLLVAGTKYRGEFEERLKKLMEEIRQSDEIILFIDEVHTLIGA  317



>ref|XP_010921845.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA 
homolog CD4A, chloroplastic-like [Elaeis guineensis]
Length=914

 Score =   299 bits (765),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNY+G+EHLLLGLLREGEGVAARVLE+ GADPSNIRTQVIRMVGES E VG
Sbjct  180  SLEEARQLGHNYVGTEHLLLGLLREGEGVAARVLESFGADPSNIRTQVIRMVGESTEDVG  239

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A +GG +SG KMP LEEYGTNLTKLAEEG+LDPV+GRQ QI+RVTQILGRRTKNNPCLIG
Sbjct  240  AVIGGASSGSKMPMLEEYGTNLTKLAEEGRLDPVIGRQQQIKRVTQILGRRTKNNPCLIG  299

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQ IANG VPETIEGKKVITLDMGLLVAGTKYRGEFEERLK+LMEEI
Sbjct  300  EPGVGKTAIAEGLAQHIANGGVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKRLMEEI  359

Query  543  KQSDEIILFIDEVHTLIGA  599
            K++++IILFIDEVHTLIGA
Sbjct  360  KKNNDIILFIDEVHTLIGA  378



>sp|P46523.1|CLPA_BRANA RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog, chloroplastic; Flags: Precursor, partial [Brassica 
napus]
 emb|CAA53077.1| clpA [Brassica napus]
Length=874

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE+ E   
Sbjct  131  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEVTA  190

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG  +  KMPTLEEYGTNLTKLAEEGKLDPVVGR  QIERV QILGRRTKNNPCLIG
Sbjct  191  NVGGGSGT-NKMPTLEEYGTNLTKLAEEGKLDPVVGRHPQIERVVQILGRRTKNNPCLIG  249

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+G V ET EGKKVITLDMGLL AGTKYRGEFEER+KKLMEEI
Sbjct  250  EPGVGKTAIAEGLAQRIASGVVRETSEGKKVITLDMGLLAAGTKYRGEFEERVKKLMEEI  309

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  310  KQSDEIILFIDEVHTLIGA  328



>gb|ADN33858.1| ATP-dependent clp protease [Cucumis melo subsp. melo]
Length=929

 Score =   298 bits (762),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 189/205 (92%), Gaps = 6/205 (3%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGA------DPSNIRTQVIRMvge  164
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLG          N+  QVIRMVGE
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGKLFIFNLMFYNLSEQVIRMVGE  241

Query  165  saeavgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKN  344
            S EAVGA VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKN
Sbjct  242  STEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKN  301

Query  345  NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK  524
            NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK
Sbjct  302  NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK  361

Query  525  KLMEEIKQSDEIILFIDEVHTLIGA  599
            KLMEEIKQSDEIILFIDEVHTLIGA
Sbjct  362  KLMEEIKQSDEIILFIDEVHTLIGA  386



>ref|XP_004138021.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis 
sativus]
Length=929

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 188/205 (92%), Gaps = 6/205 (3%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGA------DPSNIRTQVIRMvge  164
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLG           +  QVIRMVGE
Sbjct  182  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGKLFIFNLMFYKLSKQVIRMVGE  241

Query  165  saeavgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKN  344
            S EAVGA VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKN
Sbjct  242  STEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVTQILGRRTKN  301

Query  345  NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK  524
            NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK
Sbjct  302  NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK  361

Query  525  KLMEEIKQSDEIILFIDEVHTLIGA  599
            KLMEEIKQSDEIILFIDEVHTLIGA
Sbjct  362  KLMEEIKQSDEIILFIDEVHTLIGA  386



>ref|XP_005648968.1| hypothetical protein COCSUDRAFT_28166 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24424.1| hypothetical protein COCSUDRAFT_28166 [Coccomyxa subellipsoidea 
C-169]
Length=849

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EH+LLGLLREGEGVAARVLE LGAD S IRTQVIRMVGES + V 
Sbjct  94   SLEEARQLGHNYIGTEHILLGLLREGEGVAARVLETLGADASKIRTQVIRMVGESQDTVT  153

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G+S  KMPTLEEYGTNLT  A EGKLDPVVGR+ +IERVTQILGRRTKNNPCLIG
Sbjct  154  VGGGSGSSSNKMPTLEEYGTNLTTQATEGKLDPVVGRKKEIERVTQILGRRTKNNPCLIG  213

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTA+AEGLAQ+IANGDVPETIEGK+VITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  214  EPGVGKTAVAEGLAQKIANGDVPETIEGKQVITLDMGLLVAGTKYRGEFEERLKKLMEEI  273

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQ+D+IIL IDEVHTLIGA
Sbjct  274  KQNDDIILMIDEVHTLIGA  292



>gb|KHG07735.1| Chaperone ClpC, chloroplastic [Gossypium arboreum]
Length=893

 Score =   288 bits (738),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 178/199 (89%), Gaps = 6/199 (3%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGE  E   
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGEGNEVSV  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G +  KMPTLEEYGTNLTKLAEE +       QDQIERV QILGRRTKNNPCLIG
Sbjct  241  VTGGSGGNT-KMPTLEEYGTNLTKLAEEAR-----NLQDQIERVVQILGRRTKNNPCLIG  294

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  295  EPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  354

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  355  KQSDEIILFIDEVHTLIGA  373



>ref|XP_005844402.1| hypothetical protein CHLNCDRAFT_32555 [Chlorella variabilis]
 gb|EFN52300.1| hypothetical protein CHLNCDRAFT_32555 [Chlorella variabilis]
Length=844

 Score =   285 bits (729),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 176/200 (88%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMv-gesaeav  179
            SLEEAR LGHNYIG+EH+LLGLLREGEGVA+RVLE LGADP  IRTQVIRMV        
Sbjct  97   SLEEARALGHNYIGTEHILLGLLREGEGVASRVLETLGADPQKIRTQVIRMVGESQEPVG  156

Query  180  gaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
                GG +   KMPTLEEYGTNLT+ AEEGKLDPVVGR+ +IERVTQILGRRTKNNPCLI
Sbjct  157  STVGGGSSGSNKMPTLEEYGTNLTQQAEEGKLDPVVGRKKEIERVTQILGRRTKNNPCLI  216

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTA+AEGLAQ+IA GDVPETIEGK+V+TLDMGLLVAGTKYRGEFEERLKKLMEE
Sbjct  217  GEPGVGKTAVAEGLAQKIATGDVPETIEGKQVVTLDMGLLVAGTKYRGEFEERLKKLMEE  276

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQ+D+IIL IDEVHTLIGA
Sbjct  277  IKQNDDIILMIDEVHTLIGA  296



>gb|KHN31263.1| Chaperone protein ClpC, chloroplastic [Glycine soja]
Length=907

 Score =   283 bits (725),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 172/199 (86%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARV+  +G    ++   V            
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARVIRMVGESADSVTATV------------  228

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               G G+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  229  ---GSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  285

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  286  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  345

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  346  KQSDEIILFIDEVHTLIGA  364



>ref|XP_010099042.1| Chaperone protein ClpC [Morus notabilis]
 gb|EXB76502.1| Chaperone protein ClpC [Morus notabilis]
Length=571

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 179/199 (90%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARV               IRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARV---------------IRMVGESTEAVG  225

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIG
Sbjct  226  AGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQQQIERVVQILGRRTKNNPCLIG  285

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI++GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  286  EPGVGKTAIAEGLAQRISSGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  345

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  346  KQSDEIILFIDEVHTLIGA  364



>gb|AIM41270.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=908

 Score =   283 bits (723),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 182/199 (91%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARV               IRMVGES EAVG
Sbjct  181  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARV---------------IRMVGESNEAVG  225

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGG+SGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  226  ASVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  285

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  286  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  345

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  346  KQSDEIILFIDEVHTLIGA  364



>gb|KIZ07494.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=938

 Score =   283 bits (724),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EH+LLGLLREGEGVAARVLE LGADPS IRTQVIRMVGES EAVG
Sbjct  169  SLEEARQLGHNYIGTEHILLGLLREGEGVAARVLETLGADPSKIRTQVIRMVGESQEAVG  228

Query  183  aavgggts-gQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
            A VG  +    KMPTLEEYGTNLT+ AEEGKLDP VGR+ +I+RV QILGRRTKNNPCLI
Sbjct  229  AGVGTASGGTNKMPTLEEYGTNLTRQAEEGKLDPCVGRKKEIQRVIQILGRRTKNNPCLI  288

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTA+AEGLAQ IA+GDVPETIEGK+V+TLDMGLLVAGTKYRGEFEERLKKLM+E
Sbjct  289  GEPGVGKTAVAEGLAQLIASGDVPETIEGKQVVTLDMGLLVAGTKYRGEFEERLKKLMDE  348

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQ+D+IIL IDEVHTLIGA
Sbjct  349  IKQNDDIILMIDEVHTLIGA  368



>ref|XP_011401568.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4A, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM28534.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4A, chloroplastic [Auxenochlorella protothecoides]
Length=918

 Score =   282 bits (722),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 174/200 (87%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMv-gesaeav  179
            SLEEARQLGHNYIG+EH+LLGLLREGEGVA+RVLE LGADP  IRTQV+RMV        
Sbjct  173  SLEEARQLGHNYIGTEHILLGLLREGEGVASRVLETLGADPQKIRTQVVRMVGESQEPVG  232

Query  180  gaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
                GG T   KMPTLEEYGTNLT  AEEGKLDP VGR  +IERVTQILGRRTKNNPCLI
Sbjct  233  TTVGGGSTGSNKMPTLEEYGTNLTAQAEEGKLDPCVGRVREIERVTQILGRRTKNNPCLI  292

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTA+AEGLAQRIA GDVPETIEGK+V+TLD+GLLVAGTKYRGEFEERLKKLMEE
Sbjct  293  GEPGVGKTAVAEGLAQRIAAGDVPETIEGKQVVTLDLGLLVAGTKYRGEFEERLKKLMEE  352

Query  540  IKQSDEIILFIDEVHTLIGA  599
            IKQ+D+IIL IDEVHTLIGA
Sbjct  353  IKQNDDIILMIDEVHTLIGA  372



>gb|AIM41269.1| chloroplast ATP-dependent Clp protease chaperone protein [Nicotiana 
benthamiana]
Length=923

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 182/199 (91%), Gaps = 15/199 (8%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIGSEHLLLGLLREGEGVAARV               IRMVGES EAVG
Sbjct  196  SLEEARQLGHNYIGSEHLLLGLLREGEGVAARV---------------IRMVGESNEAVG  240

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            A+VGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIG
Sbjct  241  ASVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNPCLIG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI
Sbjct  301  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            KQSDEIILFIDEVHTLIGA
Sbjct  361  KQSDEIILFIDEVHTLIGA  379



>ref|XP_002952540.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
 gb|EFJ46387.1| hypothetical protein VOLCADRAFT_75431 [Volvox carteri f. nagariensis]
Length=915

 Score =   281 bits (719),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 180/201 (90%), Gaps = 2/201 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EH+LLGLLREGEGVAARVLE LGADP+ IRTQVIRMVGES E VG
Sbjct  165  SLEEARQLGHNYIGTEHILLGLLREGEGVAARVLETLGADPAKIRTQVIRMVGESQEPVG  224

Query  183  aav--gggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCL  356
            A V         K PTL+EYGTNLT+ A EGKLDPVVGR+ QIERV QILGRRTKNNPCL
Sbjct  225  AGVGGSQAQGSNKTPTLQEYGTNLTQQAAEGKLDPVVGRKKQIERVIQILGRRTKNNPCL  284

Query  357  IGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME  536
            IGEPGVGKTA+AEGLAQ+IA GDVPETIEGK+VITLDMGLLVAGTKYRGEFEERLKKLM+
Sbjct  285  IGEPGVGKTAVAEGLAQKIATGDVPETIEGKQVITLDMGLLVAGTKYRGEFEERLKKLMD  344

Query  537  EIKQSDEIILFIDEVHTLIGA  599
            EIKQ+D+IIL IDEVHTLIGA
Sbjct  345  EIKQNDDIILMIDEVHTLIGA  365



>gb|EMS54417.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=376

 Score =   265 bits (677),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 186/250 (74%), Gaps = 53/250 (21%)
 Frame = +3

Query  9    EEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQ---------------  143
            EEAR+LGHN++G+E +LLGL+ EG G+AA+VL+++G +  + R +               
Sbjct  102  EEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVE  161

Query  144  --------------------------------------VIRMvgesaeavgaavgggtsg  209
                                                  VIRMVGES EAVGA VGGG+SG
Sbjct  162  IPFTPRAKRVLELSLEEARQLDNLRSCCSLCPNLHGAHVIRMVGESTEAVGAGVGGGSSG  221

Query  210  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI  389
            QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI
Sbjct  222  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI  281

Query  390  AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF  569
            AEGLAQRI NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD+IILF
Sbjct  282  AEGLAQRITNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDDIILF  341

Query  570  IDEVHTLIGA  599
            IDEVHTLIGA
Sbjct  342  IDEVHTLIGA  351



>gb|EMT29644.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=730

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 164/182 (90%), Gaps = 11/182 (6%)
 Frame = +3

Query  87   VAARVLENLGADPSNIRTQVIRMvgesaeavgaavgggtsgQKMPTLEEYGTNLTKLAEE  266
            VAARVLE+LGADPSNIRTQV+RM+GE+ EAVGA VGGG+SG KMPTLEEYGTNLTKLAEE
Sbjct  6    VAARVLESLGADPSNIRTQVVRMIGETTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEE  65

Query  267  GKL-----------DPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI  413
             +            DPVVGR+ QIERV QILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI
Sbjct  66   FRPLIVKSNNICREDPVVGREPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI  125

Query  414  ANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLI  593
            ++GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLI
Sbjct  126  SSGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLI  185

Query  594  GA  599
            GA
Sbjct  186  GA  187



>gb|EMT20629.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=773

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 179/201 (89%), Gaps = 2/201 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesa--ea  176
            S EE+RQLGHNYIG+EHLLLGL+RE +G AA VL+N  AD  +IR +VI+M+ + +  + 
Sbjct  145  STEESRQLGHNYIGTEHLLLGLIREDDGAAAIVLKNFQADLGDIRNEVIKMITDMSEDQT  204

Query  177  vgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCL  356
            VGA VGGG+SG KMPTLEEYGTNLTKLA+EGKLDPVVGR  QIERV QILGRRTKNNPCL
Sbjct  205  VGAGVGGGSSGAKMPTLEEYGTNLTKLAQEGKLDPVVGRNKQIERVLQILGRRTKNNPCL  264

Query  357  IGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME  536
            IGEPGVGKTAIAEGLAQRIA GDVPET+EGK VITLDMGLLVAGTKYRGEFEERLKKLME
Sbjct  265  IGEPGVGKTAIAEGLAQRIATGDVPETVEGKTVITLDMGLLVAGTKYRGEFEERLKKLME  324

Query  537  EIKQSDEIILFIDEVHTLIGA  599
            EIKQS +IILF+DEVHTL+GA
Sbjct  325  EIKQSGDIILFLDEVHTLVGA  345



>gb|EMT20100.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4A 
protein, chloroplastic [Aegilops tauschii]
Length=546

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 186/250 (74%), Gaps = 53/250 (21%)
 Frame = +3

Query  9    EEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQ---------------  143
            EEAR+LGHN++G+E +LLGL+ EG G+AA+VL+++G +  + R +               
Sbjct  102  EEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVE  161

Query  144  --------------------------------------VIRMvgesaeavgaavgggtsg  209
                                                  VIRMVGES EAVGA VGGG+SG
Sbjct  162  IPFTPRAKRVLELSLEEARQLDNLRSCCSLCPNLHGAHVIRMVGESTEAVGAGVGGGSSG  221

Query  210  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI  389
            QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI
Sbjct  222  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI  281

Query  390  AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF  569
            AEGLAQRI NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD+IILF
Sbjct  282  AEGLAQRITNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDDIILF  341

Query  570  IDEVHTLIGA  599
            IDEVHTLIGA
Sbjct  342  IDEVHTLIGA  351



>ref|XP_003576089.1| PREDICTED: chaperone protein ClpC2, chloroplastic-like [Brachypodium 
distachyon]
Length=943

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 178/201 (89%), Gaps = 2/201 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesa--ea  176
            S EE+RQLGHNYIGSEHLLLGL+RE +G A  +L+   ADP+NIR +V+RM+ E +  + 
Sbjct  190  SAEESRQLGHNYIGSEHLLLGLVREDDGAALIILKKFQADPNNIRNEVMRMISEISEGQT  249

Query  177  vgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCL  356
            VG  VGGG++G KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCL
Sbjct  250  VGTGVGGGSTGSKMPTLEEYGTNLTKLAEEGKLDPVVGRQKQIERVLQILGRRTKNNPCL  309

Query  357  IGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME  536
            IGEPGVGKTA+AEGLAQRI  GDVPET+EGK VITLDMGLLVAGTKYRGEFEERLKKLM+
Sbjct  310  IGEPGVGKTAVAEGLAQRIVTGDVPETVEGKTVITLDMGLLVAGTKYRGEFEERLKKLMD  369

Query  537  EIKQSDEIILFIDEVHTLIGA  599
            EIKQ+ EIILF+DEVHTL+GA
Sbjct  370  EIKQNGEIILFLDEVHTLVGA  390



>ref|XP_006436942.1| hypothetical protein CICLE_v100308631mg, partial [Citrus clementina]
 gb|ESR50182.1| hypothetical protein CICLE_v100308631mg, partial [Citrus clementina]
Length=172

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/129 (97%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  213  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA  392
            KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIGEPGVGKTAIA
Sbjct  21   KMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIA  80

Query  393  EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI  572
            EGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI
Sbjct  81   EGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI  140

Query  573  DEVHTLIGA  599
            DEVHTLIGA
Sbjct  141  DEVHTLIGA  149



>ref|XP_007509860.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18975.1| predicted protein [Bathycoccus prasinos]
Length=944

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 177/202 (88%), Gaps = 3/202 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRM---vgesae  173
            +LEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENL ADP+ IR+QVIRM     E+  
Sbjct  196  ALEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLDADPAKIRSQVIRMVGESQEAVG  255

Query  174  avgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPC  353
            A   A GG  SG K PTLEE+G++LTK AEE KLDP VGR ++I RVTQILGRRTKNNPC
Sbjct  256  AGAGATGGAASGSKTPTLEEFGSDLTKQAEEAKLDPCVGRTNEIRRVTQILGRRTKNNPC  315

Query  354  LIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM  533
            L+GEPGVGK+AIAEGLAQ+IA+G VPET+EGK+++TLDMGLLVAGTKYRGEFEERLKKLM
Sbjct  316  LVGEPGVGKSAIAEGLAQQIASGTVPETLEGKRMMTLDMGLLVAGTKYRGEFEERLKKLM  375

Query  534  EEIKQSDEIILFIDEVHTLIGA  599
            +E+KQ D IILFIDEVHTLIGA
Sbjct  376  DEVKQDDAIILFIDEVHTLIGA  397



>gb|EMS45024.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4A, chloroplastic [Triticum urartu]
Length=719

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 179/201 (89%), Gaps = 2/201 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesa--ea  176
            S EE+RQLGHNYIG+EHLLLGL+RE +G AA VL+N  AD  +IR +VI+M+ + +  + 
Sbjct  91   STEESRQLGHNYIGTEHLLLGLIREDDGAAAIVLKNFQADLGDIRNEVIKMITDMSEDQT  150

Query  177  vgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCL  356
            VGA+VGGG+SG KMPTLEEYGTNLTKLA+EG LDPVVGR  QIERV QILGRRTKNNPCL
Sbjct  151  VGASVGGGSSGAKMPTLEEYGTNLTKLAQEGMLDPVVGRNKQIERVLQILGRRTKNNPCL  210

Query  357  IGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME  536
            IGEPGVGKTAIAEGLAQRIA GDVPET+EGK VITLDMGLLVAGTKYRGEFEERLKKLME
Sbjct  211  IGEPGVGKTAIAEGLAQRIATGDVPETVEGKTVITLDMGLLVAGTKYRGEFEERLKKLME  270

Query  537  EIKQSDEIILFIDEVHTLIGA  599
            EIKQ+ +IILF+DEVHTL+GA
Sbjct  271  EIKQNGDIILFLDEVHTLVGA  291



>dbj|BAK06755.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=886

 Score =   269 bits (687),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 161/201 (80%), Positives = 180/201 (90%), Gaps = 2/201 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesa--ea  176
            S EE+RQLGHNYIG+EHLLLGL+RE +G AA VL+N  AD  +IR +VI+M+ E +  + 
Sbjct  142  SNEESRQLGHNYIGTEHLLLGLIREDDGAAAIVLKNFQADLGDIRNEVIKMITEMSEDQT  201

Query  177  vgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCL  356
            VGA VGGG+SG KMPTLEEYGTNLTKLA+EGKLDPVVGR+ QIERV QILGRRTKNNPCL
Sbjct  202  VGAGVGGGSSGAKMPTLEEYGTNLTKLAQEGKLDPVVGRKKQIERVLQILGRRTKNNPCL  261

Query  357  IGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME  536
            IGEPGVGKTAIAEGLAQRIA GDVPET+EGK VITLDMGLLVAGTKYRGEFEERLKKLME
Sbjct  262  IGEPGVGKTAIAEGLAQRIATGDVPETVEGKTVITLDMGLLVAGTKYRGEFEERLKKLME  321

Query  537  EIKQSDEIILFIDEVHTLIGA  599
            EIKQ+ +IILF+DEVHTL+GA
Sbjct  322  EIKQNGDIILFLDEVHTLVGA  342



>gb|KIY94281.1| ATP-dependent Clp protease ATP-binding subunit ClpC [Monoraphidium 
neglectum]
Length=300

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 173/197 (88%), Gaps = 9/197 (5%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQ--------VIRMv  158
            SLEEARQLGHNYIG+EH+LLGLLREGEGVAARVLE LGADPS IRTQ        VIRMV
Sbjct  91   SLEEARQLGHNYIGTEHILLGLLREGEGVAARVLETLGADPSKIRTQARWAARACVIRMV  150

Query  159  gesaeavgaavgggts-gQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRR  335
            GES EAVGA VG  +    K PTLEEYGTNLT+ AEEGKLDP VGR+ +I+RV QILGRR
Sbjct  151  GESQEAVGAGVGTTSGGTNKTPTLEEYGTNLTRQAEEGKLDPCVGRKKEIQRVIQILGRR  210

Query  336  TKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEE  515
            TKNNPCLIGEPGVGKTA+AEGLAQ IA+GDVPETIEGK+V+TLDMGLLVAGTKYRGEFEE
Sbjct  211  TKNNPCLIGEPGVGKTAVAEGLAQLIASGDVPETIEGKQVVTLDMGLLVAGTKYRGEFEE  270

Query  516  RLKKLMEEIKQSDEIIL  566
            RLKKLM+EIKQ+D+IIL
Sbjct  271  RLKKLMDEIKQNDDIIL  287



>ref|NP_001067671.1| Os11g0267400 [Oryza sativa Japonica Group]
 sp|Q53LY0.1|CLPC3_ORYSJ RecName: Full=Chaperone protein ClpC3, chloroplastic; AltName: 
Full=ATP-dependent Clp protease ATP-binding subunit ClpC homolog 
3; AltName: Full=Casein lytic proteinase C3; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAX96285.1| Clp amino terminal domain, putative [Oryza sativa Japonica Group]
 gb|ABA92591.1| ATP-dependent Clp protease ATP-binding subunit clpA CD4B,chloroplast 
precursor, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28034.1| Os11g0267400 [Oryza sativa Japonica Group]
Length=932

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 172/202 (85%), Gaps = 4/202 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            S EEA QLGHNY+GSEHLLLGLLRE    A  VL+N  ADPSNIR++VIRM+ +++E   
Sbjct  188  SQEEAHQLGHNYVGSEHLLLGLLREHG-AALVVLKNFQADPSNIRSEVIRMISDTSEDHQ  246

Query  183  aavggg---tsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPC  353
                     +S  K+PTL EYGTNLTKLAEEGKLDPVVGRQ+Q++RV QILGRRTKNNPC
Sbjct  247  PVSAAVGGGSSTTKIPTLLEYGTNLTKLAEEGKLDPVVGRQNQVDRVVQILGRRTKNNPC  306

Query  354  LIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM  533
            LIGEPGVGKTAIAEGLAQRIA G+VPETI+GK VITLDMGLLVAGTKYRGEFEERLKKLM
Sbjct  307  LIGEPGVGKTAIAEGLAQRIAAGNVPETIDGKTVITLDMGLLVAGTKYRGEFEERLKKLM  366

Query  534  EEIKQSDEIILFIDEVHTLIGA  599
            +E+KQ+ EIILF+DEVHTL+GA
Sbjct  367  DEVKQNGEIILFLDEVHTLVGA  388



>ref|XP_002505550.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66808.1| predicted protein [Micromonas sp. RCC299]
Length=886

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 174/201 (87%), Gaps = 2/201 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMv--gesaea  176
            +LEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENL ADPS IR+QVIRMV   + A  
Sbjct  138  ALEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLDADPSKIRSQVIRMVGESQEAVG  197

Query  177  vgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCL  356
                 GG   G K PTLEE+G++LTK AEE KLDP +GR ++I RVTQILGRRTKNNPCL
Sbjct  198  AAPGAGGAAGGSKTPTLEEFGSDLTKQAEEAKLDPCIGRSNEIIRVTQILGRRTKNNPCL  257

Query  357  IGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME  536
            IGEPGVGK+AIAEGLAQ+IA  DVPET+EGK+++TLDMGLLVAGTKYRGEFEERLKKLM+
Sbjct  258  IGEPGVGKSAIAEGLAQKIAANDVPETLEGKRMMTLDMGLLVAGTKYRGEFEERLKKLMD  317

Query  537  EIKQSDEIILFIDEVHTLIGA  599
            E+K  ++IILFIDEVHTLIGA
Sbjct  318  EVKADEDIILFIDEVHTLIGA  338



>ref|XP_003063658.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52031.1| predicted protein [Micromonas pusilla CCMP1545]
Length=839

 Score =   266 bits (679),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 173/201 (86%), Gaps = 2/201 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMv--gesaea  176
            +LEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENL ADPS IR+QVIRMV   + A  
Sbjct  91   ALEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLDADPSKIRSQVIRMVGESQEAVG  150

Query  177  vgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCL  356
                 GG   G K PTLEE+G++LTK AEE KLDP +GR  ++ RVTQILGRRTKNNPCL
Sbjct  151  AAPGAGGAAGGSKTPTLEEFGSDLTKQAEEAKLDPCIGRVTEMTRVTQILGRRTKNNPCL  210

Query  357  IGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME  536
            IGEPGVGK++IAEGLAQ+IA  DVPET+EGK+++TLDMGLLVAGTKYRGEFEERLKKLM+
Sbjct  211  IGEPGVGKSSIAEGLAQKIAANDVPETLEGKRMMTLDMGLLVAGTKYRGEFEERLKKLMD  270

Query  537  EIKQSDEIILFIDEVHTLIGA  599
            E+K  D+IILFIDEVHTLIGA
Sbjct  271  EVKADDDIILFIDEVHTLIGA  291



>gb|EMS46268.1| ATP-dependent Clp protease ATP-binding subunit clpA-like protein 
CD4B, chloroplastic [Triticum urartu]
Length=887

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 185/242 (76%), Gaps = 45/242 (19%)
 Frame = +3

Query  9    EEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQV--------------  146
            EEAR+LGHN++G+E +LLGL+ EG G+AA+VL+++G    + R +V              
Sbjct  103  EEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEVEKIIGRGSGFVAVE  162

Query  147  -------------------------------IRMvgesaeavgaavgggtsgQKMPTLEE  233
                                           IRMVGES EAVGA VGGG+SGQKMPTLEE
Sbjct  163  IPFTPRAKRVLELSLEEARQLESTLSMDSGVIRMVGESTEAVGAGVGGGSSGQKMPTLEE  222

Query  234  YGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI  413
            YGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI
Sbjct  223  YGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI  282

Query  414  ANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLI  593
             NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ+D+IILFIDEVHTLI
Sbjct  283  CNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQNDDIILFIDEVHTLI  342

Query  594  GA  599
            GA
Sbjct  343  GA  344



>gb|EDZ93048.1| Clp domain protein [Arthrospira maxima CS-328]
Length=402

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 171/199 (86%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSSGRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA  D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIAQNDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +    +IL IDEVHTLIGA
Sbjct  268  RSCGNVILVIDEVHTLIGA  286



>ref|XP_010472973.1| PREDICTED: chaperone protein ClpC1, chloroplastic-like [Camelina 
sativa]
Length=445

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +3

Query  27   GHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavgaavgggts  206
            GHNYI SEHLLL LLREGEG+  RVLE LGADPSNIRTQVIRMVGE+ E      G  ++
Sbjct  22   GHNYIASEHLLLELLREGEGIVVRVLEKLGADPSNIRTQVIRMVGENNEVTANVGGESSN  81

Query  207  gQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA  386
              KM TLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIGEPGV KTA
Sbjct  82   -NKMQTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVRKTA  140

Query  387  IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIIL  566
            I EGL  RIA+GDVPET +GKKVI LDMGLLVAGTK  GEF+ERLKKL+EE++QSDEIIL
Sbjct  141  IVEGLLHRIASGDVPETTKGKKVIKLDMGLLVAGTKDSGEFKERLKKLVEEVRQSDEIIL  200

Query  567  FIDEVHTLIG  596
            FI+E+HTLIG
Sbjct  201  FINELHTLIG  210



>ref|XP_003082910.1| Chaperone HSP104 and related ATP-dependent Clp proteases (ISS), 
partial [Ostreococcus tauri]
Length=781

 Score =   262 bits (669),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 3/202 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRM---vgesae  173
            +LEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENL ADP+ IR+QVIRM     E+  
Sbjct  32   ALEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLDADPAKIRSQVIRMVGETQEAVG  91

Query  174  avgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPC  353
            A      G  +G K PTLEE+G++LTK AEEGKLDP +GR ++I RVTQILGRRTKNNPC
Sbjct  92   AGAGCGQGAQAGSKTPTLEEFGSDLTKKAEEGKLDPCIGRVNEIIRVTQILGRRTKNNPC  151

Query  354  LIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM  533
            LIGEPGVGK+AIAEGLAQ+IA  DVP+T++ K+++TLDMGLLVAGTKYRGEFEERLKKLM
Sbjct  152  LIGEPGVGKSAIAEGLAQKIATNDVPDTLDSKRMMTLDMGLLVAGTKYRGEFEERLKKLM  211

Query  534  EEIKQSDEIILFIDEVHTLIGA  599
            +E+K  + IILFIDEVHTLIGA
Sbjct  212  DEVKNDENIILFIDEVHTLIGA  233



>gb|EMT29575.1| ATP-dependent Clp protease ATP-binding subunit clpA-like CD4B 
protein, chloroplastic [Aegilops tauschii]
Length=1027

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 185/242 (76%), Gaps = 45/242 (19%)
 Frame = +3

Query  9    EEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQV--------------  146
            EEAR+LGHN++G+E +LLGL+ EG G+AA+VL+++G    + R +V              
Sbjct  243  EEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGISLKDARVEVEKIIGRGSGFVAVE  302

Query  147  -------------------------------IRMvgesaeavgaavgggtsgQKMPTLEE  233
                                           IRMVGES EAVGA VGGG+SGQKMPTLEE
Sbjct  303  IPFTPRAKRVLELSLEEARQLESTLSMDSGVIRMVGESTEAVGAGVGGGSSGQKMPTLEE  362

Query  234  YGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI  413
            YGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI
Sbjct  363  YGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI  422

Query  414  ANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLI  593
             NGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ+D+IILFIDEVHTLI
Sbjct  423  CNGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQNDDIILFIDEVHTLI  482

Query  594  GA  599
            GA
Sbjct  483  GA  484



>ref|WP_012305779.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7002]
 gb|ACA98155.1| endopeptidase Clp, ATP-binding chain C, protease regulatory subunit 
[Synechococcus sp. PCC 7002]
Length=821

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 176/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                  +   K PTL+E+G+NLT+LA++GKLDPVVGRQ++IERV QILGRRTKNNP LIG
Sbjct  151  GGGSSRS--NKTPTLDEFGSNLTQLAKDGKLDPVVGRQNEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRISNGDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|XP_001422509.1| chaperone, Hsp100 family, ClpC-type [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00826.1| chaperone, Hsp100 family, ClpC-type [Ostreococcus lucimarinus 
CCE9901]
Length=840

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 173/202 (86%), Gaps = 3/202 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRM---vgesae  173
            +LEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENL ADP+ IR+QVIRM     E+  
Sbjct  91   ALEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLDADPAKIRSQVIRMVGETQEAVG  150

Query  174  avgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPC  353
            A      G  SG K PTLEE+G++LTK AEEGKLDP +GR ++I RVTQILGRRTKNNPC
Sbjct  151  AGAGGGQGAQSGSKTPTLEEFGSDLTKKAEEGKLDPCIGRANEIVRVTQILGRRTKNNPC  210

Query  354  LIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM  533
            LIGEPGVGK+AIAEGLAQ+IA  DVP+T++ K+++TLDMGLLVAGTKYRGEFEERLKKLM
Sbjct  211  LIGEPGVGKSAIAEGLAQKIAANDVPDTLDSKRMMTLDMGLLVAGTKYRGEFEERLKKLM  270

Query  534  EEIKQSDEIILFIDEVHTLIGA  599
            +E+K  + IILFIDEVHTLIGA
Sbjct  271  DEVKSDENIILFIDEVHTLIGA  292



>emb|CEG02027.1| Clp, N-terminal [Ostreococcus tauri]
Length=917

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 3/202 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRM---vgesae  173
            +LEEARQLGHNYIG+EHLLLGLLREGEGVAARVLENL ADP+ IR+QVIRM     E+  
Sbjct  168  ALEEARQLGHNYIGTEHLLLGLLREGEGVAARVLENLDADPAKIRSQVIRMVGETQEAVG  227

Query  174  avgaavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPC  353
            A      G  +G K PTLEE+G++LTK AEEGKLDP +GR ++I RVTQILGRRTKNNPC
Sbjct  228  AGAGGGQGAQAGSKTPTLEEFGSDLTKKAEEGKLDPCIGRVNEIIRVTQILGRRTKNNPC  287

Query  354  LIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM  533
            LIGEPGVGK+AIAEGLAQ+IA  DVP+T++ K+++TLDMGLLVAGTKYRGEFEERLKKLM
Sbjct  288  LIGEPGVGKSAIAEGLAQKIATNDVPDTLDSKRMMTLDMGLLVAGTKYRGEFEERLKKLM  347

Query  534  EEIKQSDEIILFIDEVHTLIGA  599
            +E+K  + IILFIDEVHTLIGA
Sbjct  348  DEVKNDENIILFIDEVHTLIGA  369



>ref|WP_039899756.1| Clp protease ClpX, partial [Microcystis sp. T1-4]
Length=718

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSSQGRT--KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_036000319.1| Clp protease ClpX [Leptolyngbya sp. JSC-1]
Length=825

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSQGRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRISNGDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQAGNVILVIDEVHTLIGA  286



>ref|WP_023074118.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
 gb|ESA35054.1| atp-dependent clp protease atp-binding protein [Leptolyngbya 
sp. Heron Island J]
Length=822

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 174/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVST  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSQGRT---KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANGDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAANVILVIDEVHTLIGA  286



>ref|WP_022603946.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae]
 gb|ERN42931.1| ATPase with chaperone activity, ATP-binding subunit [Rubidibacter 
lacunae KORDI 51-2]
Length=826

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVST  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +   G T   K PTL+E+G+NLT +A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SENRGRT---KTPTLDEFGSNLTHMAGEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANGDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  ++L IDEVHTLIGA
Sbjct  268  RQAGNVVLVIDEVHTLIGA  286



>gb|KEH26264.1| AAA family ATPase [Medicago truncatula]
Length=358

 Score =   249 bits (636),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/129 (95%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +3

Query  213  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA  392
            KMPTLEEYGTNL KLAEEGKLDPVVGRQ QIERVTQILGR TKNNPCLIGEPGVGKTAIA
Sbjct  132  KMPTLEEYGTNLIKLAEEGKLDPVVGRQPQIERVTQILGRLTKNNPCLIGEPGVGKTAIA  191

Query  393  EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI  572
            EGLAQRIANGDVPETIEGK+VITLDMGLLVAG+KYRGEFEERL KLMEEIKQSDEIILFI
Sbjct  192  EGLAQRIANGDVPETIEGKQVITLDMGLLVAGSKYRGEFEERLNKLMEEIKQSDEIILFI  251

Query  573  DEVHTLIGA  599
            DEVHTLIGA
Sbjct  252  DEVHTLIGA  260



>ref|WP_026097796.1| Clp protease ClpX [Geitlerinema sp. PCC 7105]
Length=822

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 176/199 (88%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GPGGGRT---KTPTLDEFGSNLTQMAVEGKLDPVVGRQTEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGD+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANGDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQASNVILVIDEVHTLIGA  286



>ref|WP_012162462.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
marina]
 gb|ABW26964.1| ATP-dependent protease, ATP-binding subunit ClpC [Acaryochloris 
marina MBIC11017]
Length=822

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLAKVRTQVIRMLGETAEVSA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G NLT LA EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGQGRT---KTPTLDEFGANLTNLASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGD+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANGDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQASNVILVIDEVHTLIGA  286



>ref|WP_030006722.1| Clp protease ClpX [Synechococcus sp. NKBG042902]
Length=818

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                  +   K PTL+E+G+NLT+LA++ KLDPVVGRQ++IERV QILGRRTKNNP LIG
Sbjct  151  GGGSSRS--NKTPTLDEFGSNLTQLAKDSKLDPVVGRQNEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+NGDVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRISNGDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_010467511.1| ATP-dependent Clp protease ATP-binding protein [Acaryochloris 
sp. CCMEE 5410]
Length=822

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLAKVRTQVIRMLGETAEVSA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G NLT LA EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGQGRT---KTPTLDEFGANLTNLASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGD+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANGDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQASNVILVIDEVHTLIGA  286



>ref|WP_006518530.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
 gb|EKU97345.1| ATPase with chaperone activity, ATP-binding subunit [Leptolyngbya 
sp. PCC 7375]
Length=822

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVST  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSQGRT---KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGD+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANGDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAANVILVIDEVHTLIGA  286



>ref|WP_015191669.1| ATPase AAA-2 domain protein [Stanieria cyanosphaera]
 gb|AFZ33996.1| ATPase AAA-2 domain protein [Stanieria cyanosphaera PCC 7437]
Length=822

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G    K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSGTQGR--NKTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_006530480.1| ATPase with chaperone activity, ATP-binding subunit [Gloeocapsa 
sp. PCC 73106]
 gb|ELR96625.1| ATPase with chaperone activity, ATP-binding subunit [Gloeocapsa 
sp. PCC 73106]
Length=820

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G    K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSTNQGR--NKTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  ++L IDEVHTLIGA
Sbjct  269  RQAGNVVLVIDEVHTLIGA  287



>ref|WP_008179937.1| ATP-dependent Clp protease ATP-binding protein [Moorea producens]
 gb|EGJ34643.1| ATPase with chaperone activity, ATP-binding subunit [Moorea producens 
3L]
Length=822

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A  G T   K PTL+E+G+NLT++A EGKLDPVVGR+ +IERV QILGRRTKNNP LIG
Sbjct  151  GASQGRT---KTPTLDEFGSNLTQMASEGKLDPVVGREKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANNDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQASNVILVIDEVHTLIGA  286



>ref|WP_024545676.1| Clp protease ClpX [Synechococcus sp. NKBG15041c]
Length=821

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                  +   K PTL+E+G+NLT+LA++GKLDPVVGRQ++IERV QILGRRTKNNP LIG
Sbjct  151  GGGSSRS--NKTPTLDEFGSNLTQLAKDGKLDPVVGRQNEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GD+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRISTGDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_004160623.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa]
 emb|CCI13172.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9806]
Length=821

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSSQGRT--KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|XP_006844532.1| hypothetical protein AMTR_s00016p00164160 [Amborella trichopoda]
 gb|ERN06207.1| hypothetical protein AMTR_s00016p00164160 [Amborella trichopoda]
Length=785

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/129 (99%), Positives = 128/129 (99%), Gaps = 0/129 (0%)
 Frame = +3

Query  213  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA  392
            KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNPCLIGEPGVGKTAIA
Sbjct  113  KMPTLEEYGTNLTKLAEEGKLDPVVGRQMQIERVTQILGRRTKNNPCLIGEPGVGKTAIA  172

Query  393  EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI  572
            EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI
Sbjct  173  EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI  232

Query  573  DEVHTLIGA  599
            DEVHTLIGA
Sbjct  233  DEVHTLIGA  241



>ref|WP_011056163.1| ATP-dependent Clp protease ATP-binding protein [Thermosynechococcus 
elongatus]
 ref|NP_681098.1| ATP-dependent Clp protease regulatory subunit [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC07860.1| ATP-dependent Clp protease regulatory subunit [Thermosynechococcus 
elongatus BP-1]
Length=824

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 174/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A  G T   K PTL+E+G NLT+LA EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GASQGRT---KTPTLDEFGVNLTQLAIEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQAGNVILVIDEVHTLIGA  286



>ref|WP_002732350.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CAO87778.1| clpC [Microcystis aeruginosa PCC 7806]
 emb|CCH96065.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9717]
 emb|CCI26165.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9808]
 emb|CCI35401.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9701]
 gb|ELP55843.1| clp amino terminal domain protein [Microcystis aeruginosa TAIHU98]
 gb|ELS46866.1| clp amino terminal domain protein [Microcystis aeruginosa DIANCHI905]
 dbj|GAL91758.1| ATP-dependent Clp protease, ATP-binding subunit ClpC [Microcystis 
aeruginosa NIES-44]
Length=821

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSSQGRT--KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  ++L IDEVHTLIGA
Sbjct  269  RQAGNVVLVIDEVHTLIGA  287



>ref|WP_002777520.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI07823.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 7941]
 gb|EPF22760.1| Negative regulator of genetic competence ClpC/MecB [Microcystis 
aeruginosa SPC777]
Length=821

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSSQGRT--KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  ++L IDEVHTLIGA
Sbjct  269  RQAGNVVLVIDEVHTLIGA  287



>ref|WP_004158851.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCH94083.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9432]
Length=821

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSSQGRT--KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  ++L IDEVHTLIGA
Sbjct  269  RQAGNVVLVIDEVHTLIGA  287



>ref|WP_002796578.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 dbj|BAG05777.1| ATP-dependent Clp protease ATPase subunit [Microcystis aeruginosa 
NIES-843]
 emb|CCI23740.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9809]
Length=821

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSSQGRT--KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  ++L IDEVHTLIGA
Sbjct  269  RQAGNVVLVIDEVHTLIGA  287



>ref|WP_019498394.1| ATP-dependent Clp protease ATP-binding protein [Pseudanabaena 
sp. PCC 6802]
Length=828

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 174/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTT  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGQGRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGDVP+ ++ K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANGDVPDILQDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  ++L IDEVHTLIGA
Sbjct  268  RSASNVVLVIDEVHTLIGA  286



>ref|WP_012599251.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 7424]
 gb|ACK70308.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 7424]
Length=821

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 173/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                 G    K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGPTTGR--NKTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_015147858.1| chaperone ATPase [Oscillatoria acuminata]
 gb|AFY81211.1| ATPase with chaperone activity, ATP-binding subunit [Oscillatoria 
acuminata PCC 6304]
Length=822

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 172/199 (86%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTS  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A    T   K PTL+E+G NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GASNART---KTPTLDEFGANLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANNDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSARNVILVIDEVHTLIGA  286



>ref|WP_015145231.1| chaperone ATPase [Pleurocapsa minor]
 gb|AFY78932.1| ATPase with chaperone activity, ATP-binding subunit [Pleurocapsa 
sp. PCC 7327]
Length=821

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLAKVRTQVIRMLGETAEVST  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                 G +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  TPGAQGRT--KTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_002765002.1| ATP-dependent Clp protease ATP-binding protein [Microcystis aeruginosa]
 emb|CCI03294.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9443]
 emb|CCI17774.1| ATP-dependent Clp protease ATP-binding subunit clpA homolog [Microcystis 
aeruginosa PCC 9807]
Length=821

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +   G +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSSQGRT--KTPTLDEFGSNLTQMAGEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_024123912.1| ATP-dependent Clp protease ATPase subunit ClpC [Thermosynechococcus 
sp. NK55a]
 gb|AHB87491.1| ATP-dependent Clp protease ATPase subunit ClpC [Thermosynechococcus 
sp. NK55a]
Length=824

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 174/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A  G T   K PTL+E+G NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GASQGRT---KTPTLDEFGANLTQMAIEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQAGNVILVIDEVHTLIGA  286



>ref|WP_017289117.1| ATP-dependent Clp protease ATP-binding protein [Leptolyngbya 
boryana]
Length=822

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTS  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSQGRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANDDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>ref|WP_010873410.1| ATP-dependent Clp protease ATP-binding protein [Synechocystis 
sp. PCC 6803]
 ref|NP_442112.1| ATP-dependent Clp protease regulatory subunit [Synechocystis 
sp. PCC 6803]
 dbj|BAA10182.1| ATP-dependent Clp protease regulatory subunit [Synechocystis 
sp. PCC 6803]
 dbj|BAK50965.1| ATP-dependent Clp protease regulatory subunit [Synechocystis 
sp. PCC 6803]
 dbj|BAL29963.1| ATP-dependent Clp protease regulatory subunit [Synechocystis 
sp. PCC 6803 substr. GT-I]
 dbj|BAL33132.1| ATP-dependent Clp protease regulatory subunit [Synechocystis 
sp. PCC 6803 substr. PCC-N]
 dbj|BAL36301.1| ATP-dependent Clp protease regulatory subunit [Synechocystis 
sp. PCC 6803 substr. PCC-P]
 dbj|BAM54475.1| ATP-dependent Clp protease regulatory subunit [Synechocystis 
sp. PCC 6803]
 gb|AGF52475.1| ATP-dependent Clp protease regulatory subunit [Synechocystis 
sp. PCC 6803]
Length=821

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                GG +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGSGGRT--KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  IIL IDEVHTLIGA
Sbjct  269  RQAGNIILVIDEVHTLIGA  287



>ref|WP_015170572.1| ATPase [Geitlerinema sp. PCC 7407]
 gb|AFY65004.1| ATPase AAA-2 domain protein [Geitlerinema sp. PCC 7407]
Length=822

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVST  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSQGRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANADVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>ref|WP_028949334.1| Clp protease ClpX [Synechocystis sp. PCC 6714]
 gb|AIE73110.1| ATP-dependent Clp protease, ATP-binding subunit ClpC / Negative 
regulator of genetic competence clcC/mecB [Synechocystis 
sp. PCC 6714]
Length=821

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                GG +  K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGSGGRT--KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  IIL IDEVHTLIGA
Sbjct  269  RQAGNIILVIDEVHTLIGA  287



>ref|WP_009555478.1| ATPase with chaperone activity, ATP-binding subunit [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ70911.1| ATPase with chaperone activity, ATP-binding subunit [Oscillatoriales 
cyanobacterium JSC-12]
Length=822

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTS  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT+LA EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSQGRT---KTPTLDEFGSNLTQLAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANDDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>ref|WP_006512495.1| ATPase with chaperone activity, ATP-binding subunit [Xenococcus 
sp. PCC 7305]
 gb|ELS00342.1| ATPase with chaperone activity, ATP-binding subunit [Xenococcus 
sp. PCC 7305]
Length=822

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQ+IRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQIIRMLGETAEVAT  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                 G    K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGSSGR--NKTPTLDEFGSNLTQMASEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANQDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_036485541.1| Clp protease ClpX [Myxosarcina sp. GI1]
Length=822

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             + G G    K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSGQGR--NKTPTLDEFGSNLTQMAGEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_012630051.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 7425]
 gb|ACL47009.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 7425]
Length=825

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +  G T   K PTL+E+G+NLT++A +GKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSQGRT---KTPTLDEFGSNLTQMAADGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIANGD+P+ ++ K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANGDIPDILQEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>ref|WP_040939432.1| Clp protease ClpX [Prochloron didemni]
Length=822

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE+A+ V 
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLTKVRTQVIRMLGETADVVP  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                   +  K PTL+E+G+NLT LA+EGKLDPVVGR  +IERV QILGRRTKNNP LIG
Sbjct  151  GGGSDRRT--KTPTLDEFGSNLTNLAKEGKLDPVVGRIKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +EGK+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANEDVPDILEGKRVVTLDIGLLVAGTKYRGEFEERLKKVMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_040943370.1| Clp protease ClpX [Prochloron didemni]
Length=822

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE+A+ V 
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLTKVRTQVIRMLGETADVVP  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                   +  K PTL+E+G+NLT LA+EGKLDPVVGR  +IERV QILGRRTKNNP LIG
Sbjct  151  GGGSDRRT--KTPTLDEFGSNLTNLAKEGKLDPVVGRIKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +EGK+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANEDVPDILEGKRVVTLDIGLLVAGTKYRGEFEERLKKVMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_015225278.1| ATPase [Halothece sp. PCC 7418]
 gb|AFZ43401.1| ATPase AAA-2 domain protein [Halothece sp. PCC 7418]
Length=823

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSS  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +  G T   K PTL+E+G+NLT+LA + KLDPVVGRQ++IERV QILGRRTKNNP LIG
Sbjct  151  GSSQGRT---KTPTLDEFGSNLTQLATDSKLDPVVGRQNEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+N DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRISNEDVPDILENKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQAGNVILVIDEVHTLIGA  286



>ref|WP_015126250.1| chaperone ATPase [Synechococcus sp. PCC 6312]
 gb|AFY62713.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 6312]
Length=824

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +  G T   K PTL+E+G+NLT++A +GKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSSGRT---KTPTLDEFGSNLTQMAIDGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ ++ K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANNDIPDILQEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQASNVILVIDEVHTLIGA  286



>ref|WP_040054326.1| Clp protease ClpX [Candidatus Atelocyanobacterium thalassa]
 gb|KFF41866.1| ATPase with chaperone activity, ATP-binding subunit [Candidatus 
Atelocyanobacterium thalassa isolate SIO64986]
Length=825

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIR +GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRQLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
              V  G +  K PTL+E+G+NLT+LA +G+LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGVAPGRT--KTPTLDEFGSNLTQLATDGQLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+MEEI
Sbjct  209  EPGVGKTAIAEGLAQRIANQDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMEEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q++ IIL IDEVHTLIGA
Sbjct  269  RQTENIILVIDEVHTLIGA  287



>gb|AJA71272.1| HSP100 (chloroplast) [Pyropia haitanensis]
Length=821

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL GL+REGEGVAARVLENL  D S+IR +VI+M+GE+AEA  
Sbjct  91   SLEEARQLGHNYIGTEHLLSGLVREGEGVAARVLENLAVDVSSIRAEVIQMLGENAEANV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +      +  K PTLEE+G+NLT++A EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SGSNTTQARSKTPTLEEFGSNLTQMAMEGGLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D +IL IDEVHTLIGA
Sbjct  271  KSADNVILVIDEVHTLIGA  289



>ref|YP_007947862.1| Clp protease ATP binding subunit (chloroplast) [Pyropia haitanensis]
 gb|AGG37111.1| Clp protease ATP binding subunit (chloroplast) [Pyropia haitanensis]
Length=821

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL+GL+REGEGVAARVLENL  D S+IR +VI+M+GE+AEA  
Sbjct  91   SLEEARQLGHNYIGTEHLLMGLVREGEGVAARVLENLAVDVSSIRAEVIQMLGENAEANV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +      +  K PTLEE+G+NLT++A EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SGSNTTQARSKTPTLEEFGSNLTQMAMEGGLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D +IL IDEVHTLIGA
Sbjct  271  KSADNVILVIDEVHTLIGA  289



>ref|WP_015132374.1| ATPase [Leptolyngbya sp. PCC 7376]
 gb|AFY36587.1| ATPase AAA-2 domain protein [Leptolyngbya sp. PCC 7376]
Length=820

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             + G  +   K PTL+E+G+NLT+LA++ KLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSGGSRS--NKTPTLDEFGSNLTQLAKDSKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI+ GDVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+E+
Sbjct  209  EPGVGKTAIAEGLAQRISTGDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEV  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|YP_537014.1| Clp protease ATP binding subunit [Pyropia yezoensis]
 sp|Q1XDF4.1|CLPC_PYRYE RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog (chloroplast) [Pyropia yezoensis]
 dbj|BAE92457.1| Clp protease ATP binding subunit [Pyropia yezoensis]
 gb|AGH27660.1| Clp protease ATP binding subunit (chloroplast) [Pyropia yezoensis]
Length=821

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL+GL+REGEGVAARVLENL  D S+IR +VI+M+GE+AEA  
Sbjct  91   SLEEARQLGHNYIGTEHLLMGLVREGEGVAARVLENLAVDVSSIRAEVIQMLGENAEANV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +      +  K PTLEE+G+NLT++A EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SGSNTTQARSKTPTLEEFGSNLTQMAMEGGLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D +IL IDEVHTLIGA
Sbjct  271  KSADNVILVIDEVHTLIGA  289



>ref|WP_039726508.1| MULTISPECIES: Clp protease ClpX [Oscillatoriophycideae]
 gb|KIF14711.1| Clp protease ClpX [Aphanocapsa montana BDHKU210001]
 gb|KIF39633.1| Clp protease ClpX [Lyngbya confervoides BDU141951]
Length=822

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSS  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSQGRT---KTPTLDEFGSNLTQMAGEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI NGD+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRITNGDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>ref|WP_019504000.1| ATP-dependent Clp protease ATP-binding protein [Pleurocapsa sp. 
PCC 7319]
Length=823

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 175/199 (88%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             + GG     K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSGGGQGR-NKTPTLDEFGSNLTQMAGEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  209

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  210  EPGVGKTAIAEGLAQRIANKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  269

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  270  RQAGNVILVIDEVHTLIGA  288



>ref|WP_017717294.1| ATP-dependent Clp protease ATP-binding protein [Oscillatoria 
sp. PCC 10802]
Length=823

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 174/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTP  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A GG T   K PTL+E+G NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GATGGRT---KTPTLDEFGANLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANNDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>ref|WP_015166859.1| chaperone ATPase [Synechococcus sp. PCC 7502]
 gb|AFY72200.1| ATPase with chaperone activity, ATP-binding subunit [Synechococcus 
sp. PCC 7502]
Length=828

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 175/199 (88%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG T   K PTL+E+G+NLT+LA EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGGGRT---KTPTLDEFGSNLTQLAMEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI +GD+P+ ++ K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRITSGDIPDILQDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + S+ +IL IDEVHTLIGA
Sbjct  268  RSSNNVILVIDEVHTLIGA  286



>gb|AIA21360.1| Clp protease ATP binding subunit [Pyropia kanakaensis]
Length=821

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL+GL+REGEGVAARVLENL  D S+IR +VI+M+GE+AEA  
Sbjct  91   SLEEARQLGHNYIGTEHLLMGLVREGEGVAARVLENLAVDVSSIRAEVIQMLGENAEANV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +      +  K PTLEE+G+NLT++A EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SGSNATQARSKTPTLEEFGSNLTQMAIEGGLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D +IL IDEVHTLIGA
Sbjct  271  KSADNVILVIDEVHTLIGA  289



>ref|WP_010317861.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. CB0205]
Length=850

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE+AE  G
Sbjct  92   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLAKVRTQVIRMLGETAEVAG  151

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GGG    K PTL+E+G+NLT+ A +GKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  152  GGGGGGKGSTKTPTLDEFGSNLTQQASDGKLDPVVGRQHEIERVIQILGRRTKNNPVLIG  211

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI +GDVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+MEEI
Sbjct  212  EPGVGKTAIAEGLAQRINSGDVPDILEDKRVLTLDIGLLVAGTKYRGEFEERLKKIMEEI  271

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  272  RGAGNVILVIDEVHTLIGA  290



>ref|YP_009027615.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AGQ17145.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AHB35109.1| Clp protease ATP binding subunit (chloroplast) [Pyropia perforata]
 gb|AHB35318.1| Clp protease ATP binding subunit (chloroplast) [Pyropia perforata]
 gb|AIA19480.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AIA19689.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AIA19898.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AIA20107.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AIA20316.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AIA20525.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AIA20734.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AIA20943.1| Clp protease ATP binding subunit [Pyropia perforata]
 gb|AIA21152.1| Clp protease ATP binding subunit [Pyropia perforata]
Length=821

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL+GL+REGEGVAARVLENL  D S+IR +VI+M+GE+AEA  
Sbjct  91   SLEEARQLGHNYIGTEHLLMGLVREGEGVAARVLENLAVDVSSIRAEVIQMLGENAEASV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +      +  K PTLEE+G+NLT++A EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SGSNNTQARSKTPTLEEFGSNLTQMAIEGGLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D +IL IDEVHTLIGA
Sbjct  271  KSADNVILVIDEVHTLIGA  289



>gb|AFC40000.1| Clp protease ATP binding subunit [Porphyra umbilicalis]
Length=821

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL+GL+REGEGVAARVLENL  D S+IR +VI+M+GE+AEA  
Sbjct  91   SLEEARQLGHNYIGTEHLLMGLVREGEGVAARVLENLAVDVSSIRAEVIQMLGENAEANV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +      +  K PTLEE+G+NLT++A EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SGSNATQARSKTPTLEEFGSNLTQMAIEGGLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D +IL IDEVHTLIGA
Sbjct  271  KSADNVILVIDEVHTLIGA  289



>ref|WP_015223717.1| ATPase [Cyanobacterium stanieri]
 gb|AFZ48403.1| ATPase AAA-2 domain protein [Cyanobacterium stanieri PCC 7202]
Length=824

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 172/199 (86%), Gaps = 1/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D   +RTQVIRM+GE+  A  
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLGKVRTQVIRMLGETESAPV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A GG  S  K PTL+E+G+NLT LA EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GAGGGSRS-NKTPTLDEFGSNLTNLATEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  209

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI N DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+MEEI
Sbjct  210  EPGVGKTAIAEGLAQRIGNKDVPDLLEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMEEI  269

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  270  RQAGNVILVIDEVHTLIGA  288



>ref|WP_035989117.1| Clp protease ClpX [Leptolyngbya sp. KIOST-1]
Length=821

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A +GKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGQGRT---KTPTLDEFGSNLTQMAADGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI NGDVP+ +E ++V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIGNGDVPDILEDRRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>ref|WP_015162264.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus]
 gb|AFY96180.1| ATPase with chaperone activity, ATP-binding subunit [Chamaesiphon 
minutus PCC 6605]
Length=833

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 175/200 (88%), Gaps = 1/200 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE++E   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLTKVRTQVIRMLGETSETAT  150

Query  183  aavgggts-gQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLI  359
            A  G  +S   K PTL+E+G+NLT+LA +GKLDPVVGR  +IERV QILGRRTKNNP LI
Sbjct  151  AGTGARSSGSNKTPTLDEFGSNLTQLAHDGKLDPVVGRAKEIERVIQILGRRTKNNPVLI  210

Query  360  GEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE  539
            GEPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+E
Sbjct  211  GEPGVGKTAIAEGLAQRIANQDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDE  270

Query  540  IKQSDEIILFIDEVHTLIGA  599
            I+Q+  +IL IDEVHTLIGA
Sbjct  271  IRQAGNVILVIDEVHTLIGA  290



>ref|WP_012954277.1| ATP-dependent Clp protease ATP-binding protein [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95590.1| ATPase with chaperone activity, ATP-binding subunit [Candidatus 
Atelocyanobacterium thalassa isolate ALOHA]
Length=825

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 175/199 (88%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIR +GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRQLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
              V  G +  K PTL+E+G+NLT+LA +G+LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGVAPGRT--KTPTLDEFGSNLTQLATDGQLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA+ D+P+ +E KKV+TLD+GLLVAGTKYRGEFEERLKK+MEEI
Sbjct  209  EPGVGKTAIAEGLAQRIADQDIPDILEDKKVVTLDIGLLVAGTKYRGEFEERLKKIMEEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q++ IIL IDEVHTLIGA
Sbjct  269  RQTENIILVIDEVHTLIGA  287



>ref|WP_013324812.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 7822]
 gb|ADN16774.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 7822]
Length=821

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                 G    K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGPTTGR--NKTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA  D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIATKDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|NP_053942.1| Clp protease ATP binding subunit [Porphyra purpurea]
 sp|P51332.1|CLPC_PORPU RecName: Full=ATP-dependent Clp protease ATP-binding subunit 
clpA homolog (chloroplast) [Porphyra purpurea]
 gb|AAC08218.1| Clp protease ATP binding subunit (chloroplast) [Porphyra purpurea]
Length=821

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL+GL+REGEGVAARVLENL  D S+IR +VI+M+GE+AEA  
Sbjct  91   SLEEARQLGHNYIGTEHLLMGLVREGEGVAARVLENLAVDVSSIRAEVIQMLGENAEANV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +      +  K PTLEE+G+NLT++A EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SGSNATQARSKTPTLEEFGSNLTQMAIEGGLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D +IL IDEVHTLIGA
Sbjct  271  KSADNVILVIDEVHTLIGA  289



>ref|WP_012594749.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 8801]
 gb|ACK65476.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 8801]
Length=822

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIR +GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRQLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                 G +  K PTL+E+G+NLT LA EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGTSGRT--KTPTLDEFGSNLTNLAGEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_015783654.1| ATP-dependent Clp protease ATP-binding protein [Cyanothece sp. 
PCC 8802]
 gb|ACV00364.1| ATPase AAA-2 domain protein [Cyanothece sp. PCC 8802]
Length=822

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 172/199 (86%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIR +GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRQLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                 G +  K PTL+E+G+NLT LA EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGTSGRT--KTPTLDEFGSNLTNLAGEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_006852318.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. WH 8016]
 gb|EHA63138.1| ATPase AAA-2 domain protein [Synechococcus sp. WH 8016]
Length=860

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLAKVRTQVIRMLGETAEVGA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
               GG     K PTL+E+GTNLT+LA E KLDPVVGR  +I+RV QILGRRTKNNP LIG
Sbjct  151  GGGGGAKGSTKTPTLDEFGTNLTQLATESKLDPVVGRHKEIDRVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI  GD+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+MEEI
Sbjct  211  EPGVGKTAIAEGLAQRIQQGDIPDILEEKRVLTLDIGLLVAGTKYRGEFEERLKKIMEEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +  +IL IDEVHTLIGA
Sbjct  271  KSAGNVILVIDEVHTLIGA  289



>ref|WP_006454749.1| ATP-dependent Clp protease ATP-binding protein [Synechococcus 
sp. PCC 7335]
 gb|EDX85005.1| ATPase, AAA family [Synechococcus sp. PCC 7335]
Length=826

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE  G
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSG  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +    G +  K PTL+E+G NLT++A +GKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  STSSQGRT--KTPTLDEFGANLTQMAADGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI N D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+MEEI
Sbjct  209  EPGVGKTAIAEGLAQRIGNNDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMEEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  269  RAAANVILVIDEVHTLIGA  287



>ref|WP_015201320.1| ATPase [Crinalium epipsammum]
 gb|AFZ11176.1| ATPase AAA-2 domain protein [Crinalium epipsammum PCC 9333]
Length=826

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVGA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A   G +  K PTL+E+G+NLT++A +GKLDPVVGR  +IERV QILGRRTKNNP LIG
Sbjct  151  GASSQGRT--KTPTLDEFGSNLTQMAADGKLDPVVGRSKEIERVIQILGRRTKNNPVLIG  208

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  209  EPGVGKTAIAEGLAQRIANNDIPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  268

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  269  RQAGNVILVIDEVHTLIGA  287



>ref|WP_017300481.1| ATP-dependent Clp protease ATP-binding protein [Nodosilinea nodulosa]
Length=821

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT++A +GKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGGQGRT---KTPTLDEFGSNLTQMAADGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI NGDVP+ +E ++V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIGNGDVPDILEDRRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>ref|WP_026785489.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                  T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSSSRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA  D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIATNDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RTAGNVILVIDEVHTLIGA  286



>ref|WP_042153862.1| Clp protease ClpX [Planktothrix agardhii]
 gb|KEI66870.1| ClpC [Planktothrix agardhii NIVA-CYA 126/8]
Length=825

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                  T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSSSRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA  D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIATNDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RTAGNVILVIDEVHTLIGA  286



>ref|WP_026795885.1| MULTISPECIES: Clp protease ClpX [Planktothrix]
Length=825

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                  T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSSSRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA  D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIATNDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RTAGNVILVIDEVHTLIGA  286



>gb|KIJ80614.1| Clp protease ClpX [Scytonema tolypothrichoides VB-61278]
Length=822

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 172/199 (86%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                 G    K PTL+E+G+NLT++A +GKLDPVVGR  +IERV QILGRRTKNNP LIG
Sbjct  151  GGQPRG---NKTPTLDEFGSNLTQMAADGKLDPVVGRAKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANKDVPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQAGNVILVIDEVHTLIGA  286



>ref|WP_027250152.1| Clp protease ClpX [Planktothrix agardhii]
Length=825

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 171/199 (86%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVAA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                  T   K PTL+E+G+NLT++A EGKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GGSSSRT---KTPTLDEFGSNLTQMAAEGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIA  D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIATNDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RTAGNVILVIDEVHTLIGA  286



>ref|WP_007353377.1| MULTISPECIES: ATP-dependent Clp protease ATP-binding protein 
[Kamptonema]
 emb|CBN54150.1| ATPase AAA-2 [ [[Oscillatoria] sp. PCC 6506]
Length=823

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVTA  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             +  G T   K PTL+E+G NLT++A +GKLDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  GSSTGRT---KTPTLDEFGANLTQMAVDGKLDPVVGRQKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN D+P+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANNDIPDILEDKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            + +  +IL IDEVHTLIGA
Sbjct  268  RSAGNVILVIDEVHTLIGA  286



>gb|KDO51291.1| hypothetical protein CISIN_1g003094mg [Citrus sinensis]
 gb|KDO51292.1| hypothetical protein CISIN_1g003094mg [Citrus sinensis]
 gb|KDO51293.1| hypothetical protein CISIN_1g003094mg [Citrus sinensis]
 gb|KDO51294.1| hypothetical protein CISIN_1g003094mg [Citrus sinensis]
Length=693

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/129 (97%), Positives = 127/129 (98%), Gaps = 0/129 (0%)
 Frame = +3

Query  213  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA  392
            KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCLIGEPGVGKTAIA
Sbjct  21   KMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIA  80

Query  393  EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI  572
            EGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI
Sbjct  81   EGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI  140

Query  573  DEVHTLIGA  599
            DEVHTLIGA
Sbjct  141  DEVHTLIGA  149



>gb|AIA21566.1| Clp protease ATP binding subunit [Pyropia fucicola]
Length=821

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL+GL+REGEGVAARVLENL  D S++R +VI+M+GE+AEA  
Sbjct  91   SLEEARQLGHNYIGTEHLLMGLVREGEGVAARVLENLAVDVSSMRAEVIQMLGENAEANV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
            +      +  K PTLEE+G+NLT++A EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  SGSNTTQARSKTPTLEEFGSNLTQMAMEGGLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D +IL IDEVHTLIGA
Sbjct  271  KSADNVILVIDEVHTLIGA  289



>ref|WP_015227883.1| chaperone ATPase [Dactylococcopsis salina]
 gb|AFZ48870.1| ATPase with chaperone activity, ATP-binding subunit [Dactylococcopsis 
salina PCC 8305]
Length=823

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 173/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D S +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLSKVRTQVIRMLGETAEVSS  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                G T   K PTL+E+G+NLT+LA + KLDPVVGRQ++IERV QILGRRTKNNP LIG
Sbjct  151  GGGQGRT---KTPTLDEFGSNLTQLAADSKLDPVVGRQNEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRI N DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIGNEDVPDILENKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQAGNVILVIDEVHTLIGA  286



>ref|XP_010687844.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=920

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 170/199 (85%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEAR+LG NYIGSEHLLLGLL EGEGVAARVL+NLG D   IR QV+ M+GE  E+V 
Sbjct  184  SLEEARKLGQNYIGSEHLLLGLLSEGEGVAARVLDNLGVDTKEIRKQVLNMMGEKKESVT  243

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
                       MPT++EYGTNLTK+A+EGKLDPVVGR  QIERV QIL RRTKNNPCL+G
Sbjct  244  IGGNSS---DSMPTVQEYGTNLTKVAQEGKLDPVVGRHKQIERVIQILSRRTKNNPCLVG  300

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKT+IAEGLA +IANGDVPET+EGK+VITLDMG LV+GTKYRGEFE RL+KLMEE+
Sbjct  301  EPGVGKTSIAEGLALKIANGDVPETLEGKQVITLDMGRLVSGTKYRGEFEGRLQKLMEEV  360

Query  543  KQSDEIILFIDEVHTLIGA  599
            K+S+++ILFIDEVHTLIGA
Sbjct  361  KESNDLILFIDEVHTLIGA  379



>ref|WP_015185589.1| chaperone ATPase [Microcoleus sp. PCC 7113]
 gb|AFZ21460.1| ATPase with chaperone activity, ATP-binding subunit [Microcoleus 
sp. PCC 7113]
Length=822

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 174/199 (87%), Gaps = 3/199 (2%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLLLGL+REGEGVAARVLENLG D + +RTQVIRM+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLLGLIREGEGVAARVLENLGVDLTKVRTQVIRMLGETAEVTS  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A  G T   K PTL+E+G+NLT++A EGKLDPVVGR  +IERV QILGRRTKNNP LIG
Sbjct  151  GASQGRT---KTPTLDEFGSNLTQMAGEGKLDPVVGRAKEIERVIQILGRRTKNNPVLIG  207

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP+ +E K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI
Sbjct  208  EPGVGKTAIAEGLAQRIANNDVPDILEEKRVVTLDIGLLVAGTKYRGEFEERLKKIMDEI  267

Query  543  KQSDEIILFIDEVHTLIGA  599
            +Q+  +IL IDEVHTLIGA
Sbjct  268  RQAGNVILVIDEVHTLIGA  286



>ref|YP_007878188.1| Clp protease ATP binding subunit (chloroplast) [Calliarthron 
tuberculosum]
 gb|AGA63799.1| Clp protease ATP binding subunit (chloroplast) [Calliarthron 
tuberculosum]
Length=822

 Score =   255 bits (651),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = +3

Query  3    SLEEARQLGHNYIGSehlllgllregegVAARVLENLGADPSNIRTQVIRMvgesaeavg  182
            SLEEARQLGHNYIG+EHLL+GL+REGEGVAARVLENL  + S+IRT+VI+M+GE+AE   
Sbjct  91   SLEEARQLGHNYIGTEHLLMGLVREGEGVAARVLENLAVNVSSIRTEVIQMLGENAEVNV  150

Query  183  aavgggtsgQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIG  362
             A G   +  K PTLEE+G+NLT+LA EG LDPVVGRQ +IERV QILGRRTKNNP LIG
Sbjct  151  NANGNMQARSKTPTLEEFGSNLTELAVEGVLDPVVGRQKEIERVIQILGRRTKNNPVLIG  210

Query  363  EPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI  542
            EPGVGKTAIAEGLAQRIAN DVP  +E K VITLD+GLLVAGTKYRGEFEERLK++M+EI
Sbjct  211  EPGVGKTAIAEGLAQRIANRDVPSILEDKLVITLDVGLLVAGTKYRGEFEERLKRIMDEI  270

Query  543  KQSDEIILFIDEVHTLIGA  599
            K +D ++L IDEVHTLIGA
Sbjct  271  KSADNVVLVIDEVHTLIGA  289



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940