BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS150H05

Length=480
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00977.1|  unnamed protein product                                249   5e-79   Coffea canephora [robusta coffee]
ref|XP_010108239.1|  Phosphoenolpyruvate carboxylase, housekeepin...    266   5e-79   
ref|XP_009604678.1|  PREDICTED: phosphoenolpyruvate carboxylase         263   7e-79   Nicotiana tomentosiformis
ref|XP_009783765.1|  PREDICTED: phosphoenolpyruvate carboxylase         262   1e-78   Nicotiana sylvestris
ref|XP_011098224.1|  PREDICTED: phosphoenolpyruvate carboxylase         260   6e-78   Sesamum indicum [beniseed]
ref|XP_009340037.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    260   6e-78   Pyrus x bretschneideri [bai li]
ref|XP_008463734.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    260   6e-78   Cucumis melo [Oriental melon]
ref|XP_008386247.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    260   7e-78   Malus domestica [apple tree]
sp|P27154.1|CAPP_TOBAC  RecName: Full=Phosphoenolpyruvate carboxy...    259   8e-78   Nicotiana tabacum [American tobacco]
ref|XP_006360045.1|  PREDICTED: phosphoenolpyruvate carboxylase-l...    258   2e-77   Solanum tuberosum [potatoes]
ref|XP_002316861.1|  phosphoenolpyruvate carboxylase family protein     258   2e-77   
ref|XP_006370158.1|  phosphoenolpyruvate carboxylase family protein     258   3e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010675388.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       258   3e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO63366.1|  hypothetical protein CISIN_1g002112mg                   255   4e-77   Citrus sinensis [apfelsine]
emb|CBI20195.3|  unnamed protein product                                257   4e-77   Vitis vinifera
gb|EYU45020.1|  hypothetical protein MIMGU_mgv1a000847mg                258   5e-77   Erythranthe guttata [common monkey flower]
ref|XP_002285441.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    257   6e-77   Vitis vinifera
ref|XP_004303182.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       257   6e-77   Fragaria vesca subsp. vesca
ref|XP_011029569.1|  PREDICTED: phosphoenolpyruvate carboxylase         257   7e-77   Populus euphratica
sp|Q9FV65.1|CAPPC_FLATR  RecName: Full=Phosphoenolpyruvate carbox...    257   8e-77   Flaveria trinervia
ref|XP_002530381.1|  Phosphoenolpyruvate carboxylase, putative          257   8e-77   Ricinus communis
gb|ABR29876.1|  phosphoenolpyruvate carboxylase                         257   9e-77   Ricinus communis
ref|NP_001267517.1|  phosphoenolpyruvate carboxylase, housekeepin...    256   1e-76   Cucumis sativus [cucumbers]
gb|AFN70425.1|  phosphoenolpyruvate carboxylase                         256   1e-76   Manihot esculenta subsp. flabellifolia
ref|XP_009766373.1|  PREDICTED: phosphoenolpyruvate carboxylase         256   1e-76   Nicotiana sylvestris
ref|XP_010060690.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    256   2e-76   Eucalyptus grandis [rose gum]
gb|KDO63365.1|  hypothetical protein CISIN_1g002112mg                   255   2e-76   Citrus sinensis [apfelsine]
ref|XP_011005507.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    256   2e-76   Populus euphratica
ref|XP_009598007.1|  PREDICTED: phosphoenolpyruvate carboxylase         256   3e-76   Nicotiana tomentosiformis
ref|XP_009334045.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    255   3e-76   Pyrus x bretschneideri [bai li]
ref|XP_007214986.1|  hypothetical protein PRUPE_ppa002020mg             252   3e-76   
gb|KDO63363.1|  hypothetical protein CISIN_1g002112mg                   255   4e-76   Citrus sinensis [apfelsine]
ref|XP_011082759.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    255   4e-76   Sesamum indicum [beniseed]
ref|XP_006469015.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    255   4e-76   
ref|XP_006446789.1|  hypothetical protein CICLE_v10014164mg             255   4e-76   Citrus clementina [clementine]
ref|XP_004248242.1|  PREDICTED: phosphoenolpyruvate carboxylase         255   4e-76   Solanum lycopersicum
gb|ACC66283.1|  phosphoenolpyruvate carboxylase                         254   5e-76   Suaeda glauca
ref|XP_007213682.1|  hypothetical protein PRUPE_ppa000910mg             253   2e-75   Prunus persica
ref|XP_008226531.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    253   2e-75   Prunus mume [ume]
ref|XP_008367955.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    253   2e-75   
ref|XP_008229092.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       253   3e-75   Prunus mume [ume]
gb|AJP17168.1|  phosphoenolpyruvate carboxylase 2                       253   3e-75   Prunus sibirica [Siberian apricot]
ref|XP_004297535.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    251   7e-75   Fragaria vesca subsp. vesca
ref|XP_009607156.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    251   1e-74   Nicotiana tomentosiformis
gb|KJB27013.1|  hypothetical protein B456_004G272100                    249   1e-74   Gossypium raimondii
ref|XP_009762944.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    251   1e-74   Nicotiana sylvestris
gb|AFN70424.1|  phosphoenolpyruvate carboxylase                         251   1e-74   Manihot esculenta [manioc]
sp|Q01647.1|CAPP1_FLAPR  RecName: Full=Phosphoenolpyruvate carbox...    251   1e-74   Flaveria pringlei
ref|XP_004294066.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       251   1e-74   Fragaria vesca subsp. vesca
gb|AAM14597.1|AF494192_1  phosphoenolpyruvate carboxylase FPUB966       251   2e-74   Flaveria pubescens
emb|CAA88829.1|  phosphoenolpyruvate carboxylase                        251   2e-74   Flaveria pringlei
gb|KJB33217.1|  hypothetical protein B456_006G001300                    250   2e-74   Gossypium raimondii
emb|CDP06006.1|  unnamed protein product                                250   2e-74   Coffea canephora [robusta coffee]
gb|KHG25331.1|  Phosphoenolpyruvate carboxylase 2                       250   3e-74   Gossypium arboreum [tree cotton]
ref|XP_002518037.1|  Phosphoenolpyruvate carboxylase, putative          250   3e-74   
tpg|DAA61010.1|  TPA: phosphoenolpyruvate carboxylase4                  233   3e-74   
gb|AAB80714.1|  phosphoenolpyruvate carboxylase 1                       249   5e-74   Gossypium hirsutum [American cotton]
gb|KHG25857.1|  Phosphoenolpyruvate carboxylase 2                       249   7e-74   Gossypium arboreum [tree cotton]
ref|XP_006582125.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    246   7e-74   Glycine max [soybeans]
gb|KJB27012.1|  hypothetical protein B456_004G272100                    249   8e-74   Gossypium raimondii
emb|CAA62469.1|  phosphoenolpyruvate carboxylase                        248   1e-73   Solanum tuberosum [potatoes]
gb|AAM14596.1|AF494191_1  phosphoenolpyruvate carboxylase FB966         248   1e-73   Flaveria brownii
ref|XP_007021728.1|  Phosphoenolpyruvate carboxylase 3 isoform 1        248   1e-73   
ref|XP_011012152.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    247   2e-73   Populus euphratica
emb|CAC28225.1|  phosphoenolpyruvate carboxylase                        247   2e-73   Sesbania rostrata
ref|XP_003527207.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    247   4e-73   Glycine max [soybeans]
sp|Q9FV66.1|CAPPB_FLATR  RecName: Full=Phosphoenolpyruvate carbox...    247   4e-73   Flaveria trinervia
ref|XP_008342775.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    247   4e-73   
ref|NP_001274942.1|  phosphoenolpyruvate carboxylase                    246   4e-73   Solanum tuberosum [potatoes]
ref|XP_010104390.1|  Phosphoenolpyruvate carboxylase 2                  246   4e-73   Morus notabilis
gb|KHN48472.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    246   4e-73   Glycine soja [wild soybean]
ref|XP_006358941.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    246   4e-73   
ref|XP_008368627.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    246   5e-73   
ref|NP_001237602.1|  phosphoenolpyruvate carboxylase, housekeepin...    246   5e-73   Glycine max [soybeans]
ref|XP_006306678.1|  hypothetical protein CARUB_v10008196mg             246   5e-73   
gb|KHG02548.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    246   6e-73   Gossypium arboreum [tree cotton]
ref|XP_006852422.1|  hypothetical protein AMTR_s00021p00059810          246   8e-73   Amborella trichopoda
gb|KJB13196.1|  hypothetical protein B456_002G061400                    245   1e-72   Gossypium raimondii
gb|KJB48959.1|  hypothetical protein B456_008G095300                    245   1e-72   Gossypium raimondii
emb|CAA45504.1|  phosphoenolpyruvate carboxylase                        245   1e-72   Flaveria trinervia
gb|AJD81367.1|  phosphoenolpyruvate carboxylase isoform 1               245   1e-72   Egeria densa
gb|KHG11000.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    245   1e-72   Gossypium arboreum [tree cotton]
gb|KDP36288.1|  hypothetical protein JCGZ_09795                         245   1e-72   Jatropha curcas
gb|KEH19560.1|  phosphoenolpyruvate carboxylase                         244   2e-72   Medicago truncatula
ref|XP_002302820.2|  hypothetical protein POPTR_0002s22720g             244   2e-72   
gb|EYU26325.1|  hypothetical protein MIMGU_mgv1a000844mg                244   3e-72   Erythranthe guttata [common monkey flower]
gb|KEH19559.1|  phosphoenolpyruvate carboxylase                         244   3e-72   Medicago truncatula
ref|XP_009354255.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       244   3e-72   Pyrus x bretschneideri [bai li]
ref|XP_010911773.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       225   3e-72   
ref|XP_004251893.1|  PREDICTED: phosphoenolpyruvate carboxylase         244   3e-72   Solanum lycopersicum
ref|XP_006407030.1|  hypothetical protein EUTSA_v10019997mg             244   3e-72   Eutrema salsugineum [saltwater cress]
ref|XP_009146304.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       244   3e-72   Brassica rapa
gb|ACO48251.1|  phosphoenolpyruvate carboxylase                         244   4e-72   Arachis hypogaea [goober]
ref|XP_007048690.1|  Phosphoenolpyruvate carboxylase 3 isoform 1        244   5e-72   
gb|EPS69468.1|  hypothetical protein M569_05291                         244   5e-72   Genlisea aurea
ref|XP_002894435.1|  ATPPC1                                             243   6e-72   
ref|XP_009357178.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    243   6e-72   Pyrus x bretschneideri [bai li]
ref|XP_010479886.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       243   6e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010500970.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    243   8e-72   Camelina sativa [gold-of-pleasure]
ref|NP_001237394.1|  phosphoenolpyruvate carboxylase                    243   9e-72   Glycine max [soybeans]
gb|ABU41519.1|  phosphoenolpyruvate carboxylase                         243   1e-71   Jatropha curcas
ref|XP_010279120.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    243   1e-71   Nelumbo nucifera [Indian lotus]
gb|KFK38845.1|  phosphoenolpyruvate carboxylase                         243   1e-71   Arabis alpina [alpine rockcress]
ref|NP_001275821.1|  phosphoenolpyruvate carboxylase                    242   1e-71   Citrus sinensis [apfelsine]
pdb|3ZGB|A  Chain A, Greater Efficiency Of Photosynthetic Carbon ...    242   1e-71   Flaveria pringlei
gb|KHN36697.1|  Phosphoenolpyruvate carboxylase 2                       242   2e-71   Glycine soja [wild soybean]
ref|XP_002882904.1|  ATPPC3                                             242   2e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_003543306.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    242   2e-71   Glycine max [soybeans]
ref|XP_006306679.1|  hypothetical protein CARUB_v10008196mg             242   2e-71   Capsella rubella
ref|XP_007133202.1|  hypothetical protein PHAVU_011G160200g             242   2e-71   Phaseolus vulgaris [French bean]
ref|XP_007149391.1|  hypothetical protein PHAVU_005G066400g             242   2e-71   Phaseolus vulgaris [French bean]
ref|XP_006442514.1|  hypothetical protein CICLE_v10018719mg             242   2e-71   Citrus clementina [clementine]
gb|AAU07997.1|  phosphoenolpyruvate carboxylase 2                       242   2e-71   Lupinus albus
ref|XP_006487452.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    242   2e-71   Citrus sinensis [apfelsine]
emb|CBI21984.3|  unnamed protein product                                242   2e-71   Vitis vinifera
sp|Q9AU12.1|CAPP_PHAVU  RecName: Full=Phosphoenolpyruvate carboxy...    242   2e-71   Phaseolus vulgaris [French bean]
ref|XP_009406237.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    242   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002280569.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    242   2e-71   Vitis vinifera
ref|XP_006392801.1|  hypothetical protein EUTSA_v10011967mg             241   2e-71   
ref|XP_003597124.1|  Phosphoenolpyruvate carboxylase                    242   2e-71   Medicago truncatula
gb|KJB82054.1|  hypothetical protein B456_013G173500                    239   2e-71   Gossypium raimondii
dbj|BAJ34480.1|  unnamed protein product                                241   3e-71   Eutrema halophilum
ref|XP_010052683.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       241   3e-71   Eucalyptus grandis [rose gum]
ref|NP_001241357.1|  phosphoenolpyruvate carboxylase                    241   3e-71   Glycine max [soybeans]
dbj|BAH19953.1|  AT1G53310                                              241   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175738.1|  phosphoenolpyruvate carboxylase 1                     241   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296907.1|  hypothetical protein CARUB_v10012899mg             241   3e-71   Capsella rubella
sp|P30694.2|CAPPA_FLATR  RecName: Full=C4 phosphoenolpyruvate car...    241   3e-71   Flaveria trinervia
prf||1801241A  phosphoenolpyruvate carboxylase                          241   3e-71
gb|ABR17346.1|  unknown                                                 241   3e-71   Picea sitchensis
ref|XP_004516076.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    241   3e-71   Cicer arietinum [garbanzo]
emb|CAA81072.1|  phosphoenolpyruvate carboxylase                        241   4e-71   Flaveria trinervia
gb|KDP32538.1|  hypothetical protein JCGZ_14741                         241   4e-71   Jatropha curcas
ref|XP_007132856.1|  hypothetical protein PHAVU_011G130400g             241   4e-71   Phaseolus vulgaris [French bean]
pdb|3ZGE|A  Chain A, Greater Efficiency Of Photosynthetic Carbon ...    241   4e-71   Flaveria trinervia
pdb|4BXH|B  Chain B, Resolving The Activation Site Of Positive Re...    241   5e-71   Flaveria trinervia
ref|XP_010552117.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       241   5e-71   Tarenaya hassleriana [spider flower]
gb|KHN36882.1|  Phosphoenolpyruvate carboxylase                         241   6e-71   Glycine soja [wild soybean]
ref|XP_006593478.1|  PREDICTED: phosphoenolpyruvate carboxylase i...    241   6e-71   
ref|NP_001236741.1|  phosphoenolpyruvate carboxylase                    240   7e-71   
gb|AAO42888.1|  At3g14940                                               240   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188112.1|  phosphoenolpyruvate carboxylase 3                     240   8e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010542308.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    240   8e-71   Tarenaya hassleriana [spider flower]
gb|AJD81371.1|  phosphoenolpyruvate carboxylase isoform 5               240   9e-71   Egeria densa
gb|AAO15570.1|AF459644_1  phosphoenolpyruvate carboxylase               240   1e-70   Lupinus albus
gb|ABR29878.1|  phosphoenolpyruvate carboxylase                         239   1e-70   Ricinus communis
gb|ABV80356.1|  phosphoenolpyruvate carboxylase                         239   1e-70   Gossypium hirsutum [American cotton]
gb|KJB82053.1|  hypothetical protein B456_013G173500                    239   1e-70   Gossypium raimondii
emb|CAB65170.1|  phosphoenolpyruvate carboxylase 1                      239   2e-70   Solanum lycopersicum var. cerasiforme [cherry tomato]
gb|EEC83482.1|  hypothetical protein OsI_28999                          236   2e-70   Oryza sativa Indica Group [Indian rice]
gb|AJD81369.1|  phosphoenolpyruvate carboxylase isoform 3               239   2e-70   Egeria densa
ref|XP_008813762.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    239   2e-70   Phoenix dactylifera
sp|P51063.1|CAPP_PICAB  RecName: Full=Phosphoenolpyruvate carboxy...    239   2e-70   Picea abies
ref|XP_007149740.1|  hypothetical protein PHAVU_005G095300g             239   2e-70   Phaseolus vulgaris [French bean]
ref|XP_010920051.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    238   3e-70   
ref|XP_008793018.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    238   3e-70   Phoenix dactylifera
emb|CAJ84247.1|  phosphoenolpyruvate carboxylase                        238   4e-70   Lupinus luteus
gb|AJD81368.1|  phosphoenolpyruvate carboxylase isoform 2               238   4e-70   Egeria densa
ref|XP_009135413.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       238   6e-70   Brassica rapa
ref|NP_001267665.1|  phosphoenolpyruvate carboxylase 2-like             237   8e-70   Cucumis sativus [cucumbers]
ref|XP_003527347.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    237   1e-69   Glycine max [soybeans]
ref|XP_009395707.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       236   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008812088.1|  PREDICTED: SCAR-like protein 2                     240   2e-69   
ref|XP_010465426.1|  PREDICTED: phosphoenolpyruvate carboxylase 3...    236   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010502354.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       236   2e-69   
ref|XP_004487157.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    236   2e-69   Cicer arietinum [garbanzo]
ref|XP_010915515.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    236   2e-69   Elaeis guineensis
ref|NP_001061646.1|  Os08g0366000                                       236   2e-69   
ref|XP_008455304.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       236   3e-69   
ref|XP_004505496.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    236   3e-69   Cicer arietinum [garbanzo]
ref|XP_006659319.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    236   3e-69   Oryza brachyantha
emb|CDY45929.1|  BnaC06g09980D                                          235   3e-69   Brassica napus [oilseed rape]
gb|ACO48250.1|  phosphoenolpyruvate carboxylase                         235   4e-69   Arachis hypogaea [goober]
emb|CDY25721.1|  BnaC03g69540D                                          235   5e-69   Brassica napus [oilseed rape]
ref|XP_009106983.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       235   6e-69   Brassica rapa
emb|CAA11415.1|  phosphoenolpyruvate carboxylase                        235   6e-69   Brassica juncea [brown mustard]
ref|XP_009795584.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    235   7e-69   Nicotiana sylvestris
ref|XP_010925637.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    235   7e-69   
emb|CAA11414.1|  phosphoenolpyrovate carboxylase                        234   8e-69   Brassica juncea [brown mustard]
ref|XP_009416509.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    234   8e-69   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC83482.1|  phosphoenolpyruvate carboxylase                        234   9e-69   Phalaenopsis amabilis
emb|CDP15935.1|  unnamed protein product                                234   1e-68   Coffea canephora [robusta coffee]
emb|CAC83481.1|  phosphoenolpyruvate carboxylase                        234   1e-68   Phalaenopsis equestris
gb|ACN32213.1|  phosphoenolpyruvate carboxylase                         234   1e-68   Arachis hypogaea [goober]
ref|XP_002444204.1|  hypothetical protein SORBIDRAFT_07g014960          234   1e-68   Sorghum bicolor [broomcorn]
ref|XP_006348868.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    234   1e-68   Solanum tuberosum [potatoes]
gb|ABY87944.1|  phosphoenolpyruvate carboxylase                         233   2e-68   Arachis hypogaea [goober]
dbj|BAC41248.1|  phosphoenolpyruvate carboxylase                        233   2e-68   Glycine max [soybeans]
dbj|BAC20365.1|  phosphoenolpyruvate carboxylase                        233   2e-68   Lotus japonicus
sp|P16097.1|CAPP2_MESCR  RecName: Full=Phosphoenolpyruvate carbox...    233   3e-68   Mesembryanthemum crystallinum
ref|XP_011100202.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    233   3e-68   Sesamum indicum [beniseed]
emb|CAJ86550.1|  phosphoenolpyrovate carboxylase                        233   3e-68   Lupinus luteus
ref|XP_010924612.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       233   3e-68   
gb|AAO25631.1|  phosphoenolpyruvate carboxylase                         233   4e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_010524060.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       233   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_009603289.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    233   4e-68   Nicotiana tomentosiformis
ref|XP_010277028.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    233   4e-68   Nelumbo nucifera [Indian lotus]
gb|AAU07999.1|  phosphoenolpyruvate carboxylase 4                       232   6e-68   Lupinus albus
ref|XP_006293629.1|  hypothetical protein CARUB_v10022582mg             232   8e-68   Capsella rubella
tpg|DAA61011.1|  TPA: phosphoenolpyruvate carboxylase4                  232   8e-68   
ref|XP_003607582.1|  Phosphoenolpyruvate carboxylase                    232   9e-68   Medicago truncatula
sp|P29194.1|CAPP2_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    232   9e-68   Sorghum bicolor [broomcorn]
ref|XP_009380945.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    231   9e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_850373.4|  phosphoenolpyruvate carboxylase 2                     231   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002462179.1|  hypothetical protein SORBIDRAFT_02g021090          231   1e-67   Sorghum bicolor [broomcorn]
gb|AAP43628.1|  phosphoenolpyruvate carboxylase                         231   1e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAD31452.1|AF135371_1  phosphoenol pyruvate carboxylase              231   1e-67   Lotus corniculatus
gb|AAD22994.1|  phosphoenolpyruvate carboxylase                         231   1e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CAD58726.1|  phosphoenolpyruvate carboxylase                        231   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881863.1|  phosphoenolpyruvate carboxylase                    231   1e-67   Arabidopsis lyrata subsp. lyrata
gb|AAK58636.1|AF271162_1  phosphoenolpyruvate carboxylase isoform 2     231   1e-67   Hydrilla verticillata
ref|XP_004243288.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    231   1e-67   Solanum lycopersicum
dbj|BAC20364.1|  phosphoenolpyruvate carboxylase                        231   1e-67   Lotus japonicus
gb|AAK58637.1|AF271163_1  phosphoenolpyruvate carboxylase isoform 3     231   2e-67   Hydrilla verticillata
ref|XP_004489030.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    231   2e-67   
gb|AAK58635.2|AF271161_1  phosphoenolpyruvate carboxylase isoform 1     231   2e-67   Hydrilla verticillata
gb|AAD45696.1|AF159051_1  phosphoenolpyruvate carboxylase               231   2e-67   Picea abies
ref|XP_004970018.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    230   2e-67   Setaria italica
ref|XP_010413019.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    230   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010508551.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       230   3e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010527380.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    229   5e-67   Tarenaya hassleriana [spider flower]
gb|AAU07998.1|  phosphoenolpyruvate carboxylase 3                       229   6e-67   Lupinus albus
sp|P29193.1|CAPP1_SACHY  RecName: Full=Phosphoenolpyruvate carbox...    229   7e-67   Saccharum sp.
ref|XP_008655339.1|  PREDICTED: uncharacterized protein LOC100384...    229   7e-67   
gb|EYU41129.1|  hypothetical protein MIMGU_mgv1a000842mg                229   8e-67   Erythranthe guttata [common monkey flower]
ref|NP_001105438.1|  phosphoenolpyruvate carboxylase 2                  229   9e-67   Zea mays [maize]
ref|XP_004956559.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    229   9e-67   Setaria italica
gb|EPS65212.1|  hypothetical protein M569_09565                         216   1e-66   Genlisea aurea
emb|CAB59571.1|  phosphoenolpyruvate carboxylase                        218   1e-66   Vanilla planifolia [cultivated vanilla]
ref|XP_003596385.1|  Phosphoenolpyruvate-carboxylase                    228   1e-66   Medicago truncatula
sp|Q02735.1|CAPP_MEDSA  RecName: Full=Phosphoenolpyruvate carboxy...    228   2e-66   Medicago sativa [alfalfa]
gb|KFK37112.1|  hypothetical protein AALP_AA4G214300                    228   2e-66   Arabis alpina [alpine rockcress]
ref|XP_008781416.1|  PREDICTED: LOW QUALITY PROTEIN: SCAR-like pr...    231   3e-66   
gb|EMT08272.1|  Phosphoenolpyruvate carboxylase 2                       226   7e-66   
dbj|BAJ97144.1|  predicted protein                                      226   7e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85327.1|  predicted protein                                      226   8e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA07610.1|  phospoenolpyruvate carboxylase                         226   8e-66   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ33978.1|  unnamed protein product                                224   9e-66   Eutrema halophilum
gb|AEG78834.1|  phosphoenolpyruvate carboxylase                         225   1e-65   Dendrobium officinale
ref|XP_003577980.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       226   1e-65   Brachypodium distachyon [annual false brome]
dbj|BAF80187.1|  phosphoenolpyruvate carboxylase                        225   2e-65   Aloe arborescens
ref|XP_006348299.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    224   3e-65   
gb|AHF21553.1|  phosphoenolpyruvate carboxylase                         224   6e-65   Hylocereus undatus [dragon fruit]
sp|P51062.1|CAPP_PEA  RecName: Full=Phosphoenolpyruvate carboxyla...    223   8e-65   Pisum sativum [garden pea]
emb|CAA09588.1|  phosphoenolpyruvate-carboxylase                        222   2e-64   Vicia faba [broad bean]
emb|CAA09807.1|  ppc2                                                   222   2e-64   Solanum tuberosum [potatoes]
dbj|BAC19851.1|  phosphoenolpyruvate carboxylase                        222   3e-64   Eleocharis vivipara
ref|XP_009404506.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    221   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA60627.1|  phosphoenolpyruvate-carboxylase                        221   5e-64   Vanilla planifolia [cultivated vanilla]
ref|XP_006660531.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    220   1e-63   
ref|XP_009142853.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       220   1e-63   Brassica rapa
ref|XP_006644735.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    220   1e-63   Oryza brachyantha
emb|CDY51508.1|  BnaC04g02430D                                          220   2e-63   Brassica napus [oilseed rape]
emb|CDY55389.1|  BnaA05g34260D                                          219   2e-63   Brassica napus [oilseed rape]
gb|EMT32045.1|  Phosphoenolpyruvate carboxylase 1                       209   3e-63   
gb|EEE55407.1|  hypothetical protein OsJ_03516                          219   3e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08566.1|  hypothetical protein OsI_30839                          219   3e-63   Oryza sativa Indica Group [Indian rice]
dbj|BAD36412.1|  putative phosphoenolpyruvate carboxylase               219   3e-63   Oryza sativa Japonica Group [Japonica rice]
gb|ABG01962.1|  phosphoenolpyruvate carboxylase                         218   5e-63   Sesuvium portulacastrum [sea-purslane]
ref|XP_009142075.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       218   6e-63   Brassica rapa
emb|CDY14847.1|  BnaC04g48440D                                          218   6e-63   Brassica napus [oilseed rape]
emb|CDY47982.1|  BnaA04g24600D                                          218   7e-63   Brassica napus [oilseed rape]
gb|ADO15315.1|  C4 photosynthetic phosphoenolpyruvate                   217   1e-62   Amaranthus hypochondriacus [prince's feather]
ref|XP_006411525.1|  hypothetical protein EUTSA_v10016192mg             215   2e-62   
ref|XP_010324389.1|  PREDICTED: phosphoenolpyruvate carboxylase         216   3e-62   
sp|Q43299.1|CAPP_AMAHP  RecName: Full=Phosphoenolpyruvate carboxy...    216   3e-62   Amaranthus hypochondriacus [prince's feather]
emb|CAB65171.1|  phosphoenolpyruvate carboxylase 2                      216   3e-62   Solanum lycopersicum var. cerasiforme [cherry tomato]
gb|EMS60171.1|  Phosphoenolpyruvate carboxylase 2                       216   3e-62   Triticum urartu
gb|ABR24265.1|  PhtY                                                    216   3e-62   Microbacterium sp. CQ0110Y
emb|CAC86034.1|  phosphoenolpyruvate carboxylase 2                      216   3e-62   Solanum lycopersicum
ref|XP_002458521.1|  hypothetical protein SORBIDRAFT_03g035090          216   4e-62   
gb|AIR93775.1|  phosphoenolpyruvate carboxylase                         216   5e-62   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_010232351.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    216   5e-62   
dbj|BAD27731.1|  phosphoenolpyruvate carboxylase-like                   209   6e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006411524.1|  hypothetical protein EUTSA_v10016192mg             215   8e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010689827.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       213   6e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|AAY28730.1|  phosphoenolpyruvate carboxylase                         211   2e-60   Alternanthera ficoidea [sanguinarea]
gb|AAY28731.1|  phosphoenolpyruvate carboxylase                         209   7e-60   Alternanthera sessilis
ref|NP_001046417.1|  Os02g0244700                                       209   8e-60   
gb|EEC72817.1|  hypothetical protein OsI_06526                          209   8e-60   
gb|AAG00180.1|AF271995_1  phosphoenolpyruvate carboxylase               209   8e-60   
ref|XP_006647114.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    209   9e-60   
ref|NP_001267742.1|  phosphoenolpyruvate carboxylase 1                  209   9e-60   
ref|NP_001105503.1|  phosphoenolpyruvate carboxylase                    209   1e-59   
ref|XP_008676434.1|  PREDICTED: uncharacterized protein LOC100191...    209   1e-59   
emb|CAA62747.1|  phosphoenolpyruvate carboxylase                        208   1e-59   
gb|AAX98688.3|  C4 phosphoenolpyruvate carboxylase                      208   2e-59   
gb|ABA33611.1|  phosphoenolpyruvate carboxylase                         194   2e-59   
dbj|BAJ87123.1|  predicted protein                                      208   2e-59   
gb|AAP06951.1|  phosphoenolpyruvate carboxylase                         207   3e-59   
emb|CBM56258.1|  C3 phosphoenolpyruvate carboxylase                     207   4e-59   
ref|XP_002451855.1|  hypothetical protein SORBIDRAFT_04g008720          207   5e-59   
sp|P29195.1|CAPP1_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    207   5e-59   
ref|XP_003571949.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       207   8e-59   
gb|ABG20459.1|  phosphoenolpyruvate carboxylase                         205   3e-58   
dbj|BAJ94338.1|  predicted protein                                      205   3e-58   
emb|CAA60626.1|  phosphoenolpyruvate-carboxylase                        204   9e-58   
gb|AAM95946.1|  phosphoenolpyruvate carboxylase                         203   1e-57   
ref|XP_003563811.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    203   2e-57   
ref|XP_010553399.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    202   3e-57   
gb|AAG42288.1|  phosphoenolpyruvate carboxylase                         201   8e-57   
ref|NP_001267758.1|  phosphoenolpyruvate carboxylase 1-like             199   3e-56   
emb|CAM83969.2|  phosphoenolpyruvate carboxylase                        198   3e-56   
dbj|BAI78342.1|  phosphoenolpyruvate carboxylase                        200   3e-56   
sp|P10490.1|CAPP1_MESCR  RecName: Full=Phosphoenolpyruvate carbox...    199   5e-56   
gb|EMS57465.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    197   3e-55   
gb|AAY28729.1|  phosphoenolpyruvate carboxylase                         197   3e-55   
ref|XP_008664266.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    184   8e-55   
emb|CAA33663.1|  P-pyruvate carboxylase                                 193   7e-54   
ref|NP_001105418.1|  phosphoenolpyruvate carboxylase 1                  193   7e-54   
gb|ACJ38542.1|  phosphoenolpyruvate carboxylase                         193   7e-54   
ref|NP_001154820.1|  uncharacterized protein LOC100191762               193   7e-54   
emb|CAD60555.1|  phosphoenolpyruvate carboxylase                        193   8e-54   
gb|ADW27477.1|  phosphoenolpyruvate carboxylase                         193   9e-54   
emb|CBT21623.1|  C4 phosphoenolpyruvate carboxylase                     191   4e-53   
dbj|BAA03094.1|  phosphoenolpyruvate carboxylase                        189   3e-52   
ref|XP_001760595.1|  predicted protein                                  188   4e-52   
ref|XP_008664106.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    176   2e-51   
ref|XP_008670284.1|  PREDICTED: MLO-like protein 4                      178   2e-50   
emb|CCA60995.1|  phosphoenolpyruvate carboxylase                        182   4e-50   
gb|EMT25785.1|  Phosphoenolpyruvate carboxylase 1                       181   6e-50   
emb|CAA96509.1|  phosphoenolpyruvate carboxylase                        166   1e-49   
ref|XP_001757859.1|  predicted protein                                  181   2e-49   
emb|CAC08829.1|  putative C4 phosphoenolpyruvate carboxylase            179   1e-48   
gb|ADV92634.1|  phosphoenolpyruvate carboxylase                         178   1e-48   
sp|P15804.2|CAPP3_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    177   2e-48   
ref|XP_002438521.1|  hypothetical protein SORBIDRAFT_10g021330          177   2e-48   
gb|AAN15222.1|  putative C4 phosphoenolpyruvate carboxylase             177   3e-48   
ref|XP_002990195.1|  hypothetical protein SELMODRAFT_447920             177   3e-48   
ref|XP_001782799.1|  predicted protein                                  177   4e-48   
ref|XP_001766239.1|  predicted protein                                  176   8e-48   
emb|CAC85930.1|  putative phosphoenolpyruvate carboxylase               174   5e-47   
ref|XP_002992495.1|  hypothetical protein SELMODRAFT_269944             173   1e-46   
gb|EMS68413.1|  Phosphoenolpyruvate carboxylase 1                       166   6e-45   
gb|ABY56044.1|  phosphoenolpyruvate carboxylase                         167   2e-44   
dbj|BAK09197.1|  phosphoenolpyruvate carboxylase                        165   1e-43   
dbj|BAK09198.1|  phosphoenolpyruvate carboxylase                        164   1e-43   
emb|CDX75798.1|  BnaC03g38810D                                          162   1e-43   
emb|CDX97618.1|  BnaA05g24610D                                          163   2e-43   
dbj|BAK09195.1|  phosphoenolpyruvate carboxylase                        164   2e-43   
ref|NP_001042358.1|  Os01g0208700                                       164   2e-43   
gb|EAY72974.1|  hypothetical protein OsI_00846                          164   2e-43   
dbj|BAK09196.1|  phosphoenolpyruvate carboxylase                        164   2e-43   
emb|CDX82457.1|  BnaA03g33640D                                          162   2e-43   
ref|XP_006643893.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    163   3e-43   
emb|CDX98516.1|  BnaC05g38590D                                          163   4e-43   
ref|XP_001774499.1|  predicted protein                                  160   3e-42   
emb|CDY32330.1|  BnaC01g36490D                                          148   4e-41   
gb|EEE56642.1|  hypothetical protein OsJ_06051                          155   3e-40   
emb|CAA27270.1|  PEPCase                                                154   5e-40   
ref|XP_002513286.1|  2-alkenal reductase, putative                      147   8e-40   
ref|XP_001773964.1|  predicted protein                                  152   3e-39   
emb|CCB84879.1|  phosphoenolpyruvate carboxylase                        144   1e-36   
ref|XP_009342319.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    144   1e-36   
ref|XP_004968594.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    145   1e-36   
emb|CAM83972.2|  phosphoenolpyruvate carboxylase                        143   5e-36   
ref|XP_002985372.1|  hypothetical protein SELMODRAFT_122213             140   4e-35   
ref|XP_002979664.1|  hypothetical protein SELMODRAFT_111216             137   5e-34   
ref|XP_008362419.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       134   6e-33   
gb|EMS50355.1|  Phosphoenolpyruvate carboxylase 1                       125   9e-33   
ref|NP_001044301.1|  Os01g0758300                                       133   1e-32   
emb|CDM82240.1|  unnamed protein product                                132   3e-32   
dbj|BAJ96977.1|  predicted protein                                      129   4e-31   
emb|CAA30158.1|  unnamed protein product                                115   1e-29   
ref|XP_003565329.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    124   3e-29   
dbj|BAA25129.1|  phosphoenolpyruvate carboxylase                        103   9e-26   
emb|CAA96504.1|  phosphoenolpyruvate carboxylase                        102   3e-25   
gb|ACJ22779.1|  phosphoenolpyruvate carboxylase                         100   1e-24   
gb|AJD81370.1|  phosphoenolpyruvate carboxylase isoform 4             98.6    2e-20   
gb|EAZ06755.1|  hypothetical protein OsI_29000                        90.1    3e-20   
emb|CAA30159.1|  unnamed protein product                              85.9    9e-19   
ref|NP_683646.1|  phosphoenolpyruvate carboxylase-related protein     84.7    2e-18   
emb|CAA45347.1|  phosphoenolpyruvate carboxylase                      84.7    2e-18   
ref|XP_008377074.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...  85.5    3e-18   
gb|AAD13911.1|S60262_1  phosphoenolpyruvate carboxylase               83.6    7e-18   
gb|EAY75884.1|  hypothetical protein OsI_03803                        90.1    1e-17   
dbj|BAA23422.1|  phosphoenolpyruvate carboxylase                      81.3    5e-17   
gb|EMT14603.1|  Phosphoenolpyruvate carboxylase 1                     83.6    3e-15   
gb|EMS62961.1|  SCAR-like protein 2                                   75.5    2e-12   
ref|XP_007021730.1|  Phosphoenolpyruvate carboxylase 3 isoform 3      73.2    8e-12   
ref|XP_008813763.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...  71.6    2e-11   
emb|CDM84220.1|  unnamed protein product                              69.7    1e-10   
gb|AAD13912.1|S60264_1  phosphoenolpyruvate carboxylase               60.5    2e-09   
gb|KDO44636.1|  hypothetical protein CISIN_1g002089mg                 65.1    3e-09   
gb|ADZ05827.1|  phosphoenolpyruvate carboxylase                       65.1    3e-09   
emb|CAA96507.1|  phosphoenolpyruvate carboxylase                      55.1    1e-07   
gb|ABX79637.1|  phosphoenolpyruvate carboxylase                       49.7    1e-05   
gb|AFW81519.1|  putative clathrin heavy chain family protein          48.5    1e-05   
gb|EHM03224.1|  phosphoenolpyruvate carboxykinase                     53.9    2e-05   
ref|XP_001420862.1|  predicted protein                                53.5    2e-05   
emb|CCA60994.1|  phosphoenolpyruvate carboxylase                      52.8    3e-05   
dbj|BAJ85848.1|  predicted protein                                    52.8    4e-05   
dbj|BAJ90026.1|  predicted protein                                    52.8    4e-05   
gb|AAS88368.1|  phosphoenolpyruvate carboxylase                       48.1    4e-05   
ref|XP_002949515.1|  hypothetical protein VOLCADRAFT_59445            52.8    4e-05   
emb|CCU61859.1|  Phosphoenolpyruvate carboxylase                      52.4    4e-05   
gb|ADH01790.1|  phosphoenolpyruvate carboxylase                       48.1    4e-05   
ref|WP_040851641.1|  phosphoenolpyruvate carboxylase                  52.4    4e-05   
gb|AAS88349.1|  phosphoenolpyruvate carboxylase                       47.8    5e-05   
dbj|BAD88208.1|  unknown protein                                      48.1    6e-05   
ref|WP_040289772.1|  phosphoenolpyruvate carboxylase                  52.0    7e-05   
ref|XP_005652003.1|  PEPCase 1                                        52.0    7e-05   
gb|ADH01796.1|  phosphoenolpyruvate carboxylase                       47.0    1e-04   
gb|AAS88356.1|  phosphoenolpyruvate carboxylase                       47.0    1e-04   
gb|AAS88361.1|  phosphoenolpyruvate carboxylase                       47.0    1e-04   
gb|AAS88348.1|  phosphoenolpyruvate carboxylase                       47.0    1e-04   
gb|ABX79622.1|  phosphoenolpyruvate carboxylase                       46.2    2e-04   
sp|P81831.2|CAPP1_CHLRE  RecName: Full=Phosphoenolpyruvate carbox...  50.4    2e-04   
emb|CEF99981.1|  Phosphoenolpyruvate carboxylase                      50.1    2e-04   
ref|XP_003082445.1|  phosphoenolpyruvate carboxylase 2; LaPEPC2 (...  50.1    3e-04   
gb|AAS88364.1|  phosphoenolpyruvate carboxylase                       45.8    3e-04   
ref|WP_038311255.1|  hypothetical protein                             47.8    3e-04   
gb|AAS88372.1|  phosphoenolpyruvate carboxylase                       45.8    3e-04   
ref|WP_013294431.1|  phosphoenolpyruvate carboxylase                  49.3    4e-04   
ref|WP_041514014.1|  phosphoenolpyruvate carboxylase                  49.3    4e-04   
ref|WP_036211378.1|  phosphoenolpyruvate carboxylase                  49.3    4e-04   
ref|WP_027866050.1|  phosphoenolpyruvate carboxylase                  49.3    5e-04   
ref|WP_013167230.1|  phosphoenolpyruvate carboxylase                  48.9    6e-04   
ref|XP_003055786.1|  predicted protein                                48.9    6e-04   
gb|AAS88351.1|  phosphoenolpyruvate carboxylase                       45.1    6e-04   
gb|AFW81520.1|  putative clathrin heavy chain family protein          48.5    7e-04   
ref|WP_026172243.1|  hypothetical protein                             47.8    8e-04   
gb|ABX79612.1|  phosphoenolpyruvate carboxylase                       44.7    8e-04   



>emb|CDP00977.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   249 bits (637),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +3

Query  75   RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  254
            RNLEK+ASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQ LHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPAKVSDDDKLVEYDALLLDRFLDILQYLHGEDLKETVQECYEL  64

Query  255  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  434
            SAEYEGR DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKK
Sbjct  65   SAEYEGRKDPKKLEELGHVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  435  GDFVDENSAITESDI  479
            GDF DENSAITESDI
Sbjct  125  GDFADENSAITESDI  139



>ref|XP_010108239.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Morus 
notabilis]
 gb|EXC18479.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Morus 
notabilis]
Length=1376

 Score =   266 bits (679),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_009604678.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
 ref|XP_009604679.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
 ref|XP_009604680.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
Length=964

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_009783765.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
 ref|XP_009783766.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=964

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK+GDF DEN+A TESDI
Sbjct  121  LKRGDFADENNATTESDI  138



>ref|XP_011098224.1| PREDICTED: phosphoenolpyruvate carboxylase [Sesamum indicum]
Length=964

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA+RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MASRNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKL+ELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLDELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGD+ DEN+A TESDI
Sbjct  121  RKKGDYTDENNATTESDI  138



>ref|XP_009340037.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Pyrus x bretschneideri]
Length=966

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_008463734.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Cucumis melo]
Length=965

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP +VSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPARVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_008386247.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Malus domestica]
Length=965

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>sp|P27154.1|CAPP_TOBAC RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Nicotiana tabacum]
 emb|CAA41758.1| phosphoenolpyruvate carboxylase [Nicotiana tabacum]
Length=964

 Score =   259 bits (663),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R+LEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRSLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK+GDF DEN+A TESDI
Sbjct  121  LKRGDFADENNATTESDI  138



>ref|XP_006360045.1| PREDICTED: phosphoenolpyruvate carboxylase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360046.1| PREDICTED: phosphoenolpyruvate carboxylase-like isoform X2 [Solanum 
tuberosum]
Length=964

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLD FLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDSFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_002316861.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
 gb|EEE97473.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
Length=966

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = +3

Query  75   RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  254
            RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYEL  64

Query  255  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  434
            SAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKK
Sbjct  65   SAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  435  GDFVDENSAITESDI  479
            GDF DENSA TESDI
Sbjct  125  GDFADENSATTESDI  139



>ref|XP_006370158.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
 gb|ERP66727.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
Length=968

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  6    ARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYE  65

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLK
Sbjct  66   LSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  125

Query  432  KGDFVDENSAITESDI  479
            KGDF DEN+A TESDI
Sbjct  126  KGDFADENNATTESDI  141



>ref|XP_010675388.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Beta vulgaris subsp. 
vulgaris]
Length=967

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M ARN+EKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MMARNIEKMASIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKRDPKKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDENSA TESDI
Sbjct  121  KLKKGDFVDENSATTESDI  139



>gb|KDO63366.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=753

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSATTESDI  138



>emb|CBI20195.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNIEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>gb|EYU45020.1| hypothetical protein MIMGU_mgv1a000847mg [Erythranthe guttata]
Length=963

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVPGKVS+DDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPGKVSDDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN+LTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGD+ DENSA TESDI
Sbjct  121  KKKGDYTDENSATTESDI  138



>ref|XP_002285441.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
Length=963

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNIEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_004303182.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466957.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
Length=961

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ DPKKLEELGNV TSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKQDPKKLEELGNVFTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDE +A TESDI
Sbjct  121  LKKGDFVDEANATTESDI  138



>ref|XP_011029569.1| PREDICTED: phosphoenolpyruvate carboxylase [Populus euphratica]
Length=966

 Score =   257 bits (657),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
             RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  4    TRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQECYE  63

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLK
Sbjct  64   LSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  123

Query  432  KGDFVDENSAITESDI  479
            KGDF DEN+A TESDI
Sbjct  124  KGDFADENNATTESDI  139



>sp|Q9FV65.1|CAPPC_FLATR RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2; Short=ppcC [Flaveria trinervia]
 gb|AAG17619.1|AF248080_1 phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=967

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEGLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE SA TESDI
Sbjct  121  LKKGDFADEASATTESDI  138



>ref|XP_002530381.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
 gb|EEF32001.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
Length=965

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MQPRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KL+ELGN+LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNLLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>gb|ABR29876.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=965

 Score =   257 bits (656),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MQPRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KL+ELGN+LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNLLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|NP_001267517.1| phosphoenolpyruvate carboxylase, housekeeping isozyme-like [Cucumis 
sativus]
 ref|XP_004165409.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Cucumis sativus]
 gb|AFS33790.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
 gb|KGN55071.1| hypothetical protein Csa_4G627210 [Cucumis sativus]
Length=965

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP +VSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKMASIDAQLRLLVPARVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ +PKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKFNPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>gb|AFN70425.1| phosphoenolpyruvate carboxylase [Manihot esculenta subsp. flabellifolia]
Length=965

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELG VLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGKVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_009766373.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=966

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLR LVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRQLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKK-GDFVDENSAITESDI  479
            LKK GDFVDE++A TESDI
Sbjct  121  LKKTGDFVDESNATTESDI  139



>ref|XP_010060690.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Eucalyptus grandis]
 gb|KCW67501.1| hypothetical protein EUGRSUZ_F01229 [Eucalyptus grandis]
Length=965

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELGNVLTSLDPGDSIVIAKSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNVLTSLDPGDSIVIAKSFSNMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>gb|KDO63365.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=891

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSATTESDI  138



>ref|XP_011005507.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
 ref|XP_011005508.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
 ref|XP_011005509.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
Length=968

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQ+CYE
Sbjct  6    ARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQDCYE  65

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEG+HDPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLK
Sbjct  66   LSAEYEGKHDPKKLEELGRVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRNKLK  125

Query  432  KGDFVDENSAITESDI  479
            KGDF DEN+A TESDI
Sbjct  126  KGDFADENNATTESDI  141



>ref|XP_009598007.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
Length=966

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAQLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNV TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVFTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKK-GDFVDENSAITESDI  479
            LKK GDFVDE++A TESDI
Sbjct  121  LKKTGDFVDESNATTESDI  139



>ref|XP_009334045.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Pyrus x bretschneideri]
Length=965

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKL ELGNVLTSLDPGDSIV+AKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLSELGNVLTSLDPGDSIVVAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_007214986.1| hypothetical protein PRUPE_ppa002020mg [Prunus persica]
 gb|EMJ16185.1| hypothetical protein PRUPE_ppa002020mg [Prunus persica]
Length=728

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE SA TESDI
Sbjct  121  LKKGDFADEASATTESDI  138



>gb|KDO63363.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
 gb|KDO63364.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=965

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSATTESDI  138



>ref|XP_011082759.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Sesamum indicum]
Length=964

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIV+AK+FSHML+LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVLAKAFSHMLSLANLAEEVQIAHRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGD+ DENSA TESDI
Sbjct  121  KKKGDYTDENSATTESDI  138



>ref|XP_006469015.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006469016.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X2 
[Citrus sinensis]
Length=965

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSATTESDI  138



>ref|XP_006446789.1| hypothetical protein CICLE_v10014164mg [Citrus clementina]
 gb|ESR60029.1| hypothetical protein CICLE_v10014164mg [Citrus clementina]
Length=965

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ D +KLEELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSATTESDI  138



>ref|XP_004248242.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
Length=964

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RNLEK+ASIDAQLR LVPGKVSEDDKLVEYDALLLD FLDILQDLHG +L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRALVPGKVSEDDKLVEYDALLLDSFLDILQDLHGVDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            L+KGDF DEN+A TESDI
Sbjct  121  LRKGDFADENNATTESDI  138



>gb|ACC66283.1| phosphoenolpyruvate carboxylase [Suaeda glauca]
Length=966

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 133/137 (97%), Gaps = 1/137 (1%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            ARN+EKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQECYE
Sbjct  2    ARNIEKMASIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKL  428
            LSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR +KL
Sbjct  62   LSAEYEGKRDPKKLEELGNVLTSLDPGDSIVLAKSFSHMLNLANLAEEVQIAYRRRIKKL  121

Query  429  KKGDFVDENSAITESDI  479
            KKGDF+DENSA TESDI
Sbjct  122  KKGDFIDENSATTESDI  138



>ref|XP_007213682.1| hypothetical protein PRUPE_ppa000910mg [Prunus persica]
 gb|EMJ14881.1| hypothetical protein PRUPE_ppa000910mg [Prunus persica]
Length=965

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HD KKL ELGNVLTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDAKKLSELGNVLTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_008226531.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Prunus mume]
Length=965

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HD KKL ELGNVLTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDAKKLSELGNVLTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_008367955.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Malus domestica]
Length=965

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MANRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQAC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKL ELG+VLTSLDPGDSIV+AKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLSELGDVLTSLDPGDSIVVAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_008229092.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Prunus mume]
Length=966

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE SA TESDI
Sbjct  121  LKKGDFADEASATTESDI  138



>gb|AJP17168.1| phosphoenolpyruvate carboxylase 2 [Prunus sibirica]
Length=966

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA+RNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + DPKKLEELG VLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE SA TESDI
Sbjct  121  LKKGDFADEASATTESDI  138



>ref|XP_004297535.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Fragaria vesca 
subsp. vesca]
Length=962

 Score =   251 bits (642),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M ARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MTARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQ+AYRRR K
Sbjct  61   YELSAEYEGKRDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQMAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKG FVDE +A TESDI
Sbjct  121  LKKGGFVDEANATTESDI  138



>ref|XP_009607156.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
 ref|XP_009607157.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
Length=964

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEGLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AKS SHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYESKRDKKKLEELGNVLTSLDPGDSIVVAKSISHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF+DEN+A+TESDI
Sbjct  121  LKKGDFLDENNAMTESDI  138



>gb|KJB27013.1| hypothetical protein B456_004G272100 [Gossypium raimondii]
Length=751

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 135/145 (93%), Gaps = 5/145 (3%)
 Frame = +3

Query  45   SGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENL  224
            S ++S KM     +K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L
Sbjct  3    STSNSNKM-----QKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDL  57

Query  225  RETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQI  404
            +ETVQECYELSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQI
Sbjct  58   KETVQECYELSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQI  117

Query  405  AYRRRQKLKKGDFVDENSAITESDI  479
            AYRRR KLKKGDFVDENSA TESDI
Sbjct  118  AYRRRIKLKKGDFVDENSATTESDI  142



>ref|XP_009762944.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana sylvestris]
Length=964

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEGLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AKS SHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYESKRDKKKLEELGNVLTSLDPGDSIVVAKSISHMLNLANLAEEVQIAYRRRQK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF+DEN+A+TESDI
Sbjct  121  LKKGDFLDENNAMTESDI  138



>gb|AFN70424.1| phosphoenolpyruvate carboxylase [Manihot esculenta]
Length=965

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDI QDLHGE +RETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDISQDLHGEEIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELG VLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAY RR K
Sbjct  61   YELSAEYEGKHDPQKLEELGKVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYGRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>sp|Q01647.1|CAPP1_FLAPR RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Flaveria pringlei]
 emb|CAA45505.1| phosphoenolpyruvate carboxylase [Flaveria pringlei]
Length=967

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK+GDF DE +A TESDI
Sbjct  121  LKRGDFADEANATTESDI  138



>ref|XP_004294066.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460783.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
Length=965

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R+LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  1    MAYRSLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQSC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KL ELGNVLTSLDPGDSIVIAKSF+HML+LANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPQKLAELGNVLTSLDPGDSIVIAKSFAHMLSLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>gb|AAM14597.1|AF494192_1 phosphoenolpyruvate carboxylase FPUB966 [Flaveria pubescens]
Length=966

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK+GDF DE +A TESDI
Sbjct  121  LKRGDFADEANATTESDI  138



>emb|CAA88829.1| phosphoenolpyruvate carboxylase [Flaveria pringlei]
Length=966

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK+GDF DE +A TESDI
Sbjct  121  LKRGDFADEANATTESDI  138



>gb|KJB33217.1| hypothetical protein B456_006G001300 [Gossypium raimondii]
Length=965

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE+SA TESDI
Sbjct  121  LKKGDFADESSATTESDI  138



>emb|CDP06006.1| unnamed protein product [Coffea canephora]
Length=965

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +3

Query  75   RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  254
            RNLEK+ASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQ LHGE+L+ETVQECYEL
Sbjct  5    RNLEKLASIDAQLRLLVPAKVSDDDKLVEYDALLLDRFLDILQYLHGEDLKETVQECYEL  64

Query  255  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  434
            SAEYEGR DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKK
Sbjct  65   SAEYEGRKDPKKLEELGHVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRNKLKK  124

Query  435  GDFVDENSAITESDI  479
            GDF DENSAITESDI
Sbjct  125  GDFADENSAITESDI  139



>gb|KHG25331.1| Phosphoenolpyruvate carboxylase 2 [Gossypium arboreum]
Length=965

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE+SA TESDI
Sbjct  121  LKKGDFADESSATTESDI  138



>ref|XP_002518037.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
 gb|EEF44555.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
Length=965

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MAGRNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+H+P+KL ELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPQKLAELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>tpg|DAA61010.1| TPA: phosphoenolpyruvate carboxylase4 [Zea mays]
Length=222

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 130/140 (93%), Gaps = 2/140 (1%)
 Frame = +3

Query  66   MAA--RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  239
            MAA    +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQ
Sbjct  1    MAALGAKMERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQ  60

Query  240  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  419
            ECYE++AEYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR
Sbjct  61   ECYEVAAEYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  120

Query  420  QKLKKGDFVDENSAITESDI  479
             KLKKGDF DENSAITESDI
Sbjct  121  IKLKKGDFADENSAITESDI  140



>gb|AAB80714.1| phosphoenolpyruvate carboxylase 1 [Gossypium hirsutum]
Length=965

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R +EKMASIDAQLRLL PGKVSEDDKLVEYDA+LLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGRKVEKMASIDAQLRLLAPGKVSEDDKLVEYDAVLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPK LEELG VLTSLDPGDSIV+ KSFSHMLNL NLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVLTSLDPGDSIVVTKSFSHMLNLGNLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE+SA TESDI
Sbjct  121  LKKGDFADESSATTESDI  138



>gb|KHG25857.1| Phosphoenolpyruvate carboxylase 2 [Gossypium arboreum]
Length=969

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            +  L+K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYE
Sbjct  7    SNKLQKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYE  66

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  67   LSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRIKLK  126

Query  432  KGDFVDENSAITESDI  479
            KGDFVDENSA TESDI
Sbjct  127  KGDFVDENSATTESDI  142



>ref|XP_006582125.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Glycine max]
Length=760

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>gb|KJB27012.1| hypothetical protein B456_004G272100 [Gossypium raimondii]
Length=969

 Score =   249 bits (635),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 135/145 (93%), Gaps = 5/145 (3%)
 Frame = +3

Query  45   SGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENL  224
            S ++S KM     +K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L
Sbjct  3    STSNSNKM-----QKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDL  57

Query  225  RETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQI  404
            +ETVQECYELSAEYEG++DPKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQI
Sbjct  58   KETVQECYELSAEYEGKNDPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQI  117

Query  405  AYRRRQKLKKGDFVDENSAITESDI  479
            AYRRR KLKKGDFVDENSA TESDI
Sbjct  118  AYRRRIKLKKGDFVDENSATTESDI  142



>emb|CAA62469.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
Length=965

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RNLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDF DE++A TESDI
Sbjct  121  LKKKGDFGDESNATTESDI  139



>gb|AAM14596.1|AF494191_1 phosphoenolpyruvate carboxylase FB966 [Flaveria brownii]
Length=966

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 132/138 (96%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA +N+EK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQEC
Sbjct  1    MANKNVEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK+GDF DE +A TESDI
Sbjct  121  LKRGDFADEANATTESDI  138



>ref|XP_007021728.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 ref|XP_007021729.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOY13253.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOY13254.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
Length=972

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/133 (91%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            LEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  13   LEKLASIDAQLRLLVPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  72

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAYRRRIKLKKGD  132

Query  441  FVDENSAITESDI  479
            F+DENSA TESDI
Sbjct  133  FIDENSATTESDI  145



>ref|XP_011012152.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Populus euphratica]
Length=965

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNL+KMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETV +C
Sbjct  1    MADRNLQKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGQDIRETVHDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE  HDP+KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEAMHDPQKLEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>emb|CAC28225.1| phosphoenolpyruvate carboxylase [Sesbania rostrata]
Length=961

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE++A TESDI
Sbjct  121  LKKGDFADESNATTESDI  138



>ref|XP_003527207.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Glycine max]
Length=967

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>sp|Q9FV66.1|CAPPB_FLATR RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=PEPC 1; 
Short=PEPCase 1; Short=ppcB [Flaveria trinervia]
 gb|AAG17618.1|AF248079_1 phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=965

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDA LRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+ETVQEC
Sbjct  1    MANRNLEKLASIDAHLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ DPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE  A TESD+
Sbjct  121  LKKGDFADEAHATTESDM  138



>ref|XP_008342775.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Malus domestica]
 ref|XP_008368623.1| PREDICTED: phosphoenolpyruvate carboxylase [Malus domestica]
Length=967

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + DP+KLEELG +LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDF DE SA TESDI
Sbjct  121  LKKKGDFADEASATTESDI  139



>ref|NP_001274942.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
 sp|P29196.2|CAPP_SOLTU RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Solanum tuberosum]
 emb|CAA47437.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
Length=965

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RNL+K+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQEC
Sbjct  1    MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDF DE++A TESDI
Sbjct  121  LKKKGDFGDESNATTESDI  139



>ref|XP_010104390.1| Phosphoenolpyruvate carboxylase 2 [Morus notabilis]
 gb|EXC00235.1| Phosphoenolpyruvate carboxylase 2 [Morus notabilis]
Length=967

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M++RNLEKMASIDAQLRLL P KVSEDDKL+EYDALL DRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MSSRNLEKMASIDAQLRLLAPAKVSEDDKLIEYDALLCDRFLDILQDLHGEDLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE   DPKKLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERNLDPKKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDFVDENSA TESDI
Sbjct  121  LKKKGDFVDENSATTESDI  139



>gb|KHN48472.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Glycine 
soja]
Length=967

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_006358941.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=965

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RNLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQ+C
Sbjct  1    MTTRNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDF DE++A TESDI
Sbjct  121  LKKKGDFGDESNATTESDI  139



>ref|XP_008368627.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Malus domestica]
Length=875

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAA+NLEKMASID QLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGENLRETVQ+C
Sbjct  1    MAAKNLEKMASIDVQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGENLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + DP+KL ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLAELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  L-KKGDFVDENSAITESDI  479
            + KKGDF DE SA TESDI
Sbjct  121  MKKKGDFADEASATTESDI  139



>ref|NP_001237602.1| phosphoenolpyruvate carboxylase, housekeeping isozyme [Glycine 
max]
 sp|Q02909.1|CAPP1_SOYBN RecName: Full=Phosphoenolpyruvate carboxylase, housekeeping isozyme; 
Short=PEPCase; AltName: Full=PEPC 1 [Glycine max]
 dbj|BAA01560.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+ RR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHSRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_006306678.1| hypothetical protein CARUB_v10008196mg, partial [Capsella rubella]
 gb|EOA39576.1| hypothetical protein CARUB_v10008196mg, partial [Capsella rubella]
Length=996

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  39   LWSGADSEKMAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE  218
            +WS    ++MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE
Sbjct  21   IWSEVGEKEMANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE  80

Query  219  NLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEV  398
            +LRETVQE YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVI+K+FSHMLNLANLAEEV
Sbjct  81   DLRETVQELYEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVISKAFSHMLNLANLAEEV  140

Query  399  QIAYRRR-QKLKKGDFVDENSAITESDI  479
            QIAYRRR +KLKKGDFVDE+SA TESD+
Sbjct  141  QIAYRRRVKKLKKGDFVDESSATTESDL  168



>gb|KHG02548.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Gossypium 
arboreum]
Length=969

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 130/142 (92%), Gaps = 4/142 (3%)
 Frame = +3

Query  66   MAARN----LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRET  233
            MA  N    LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRET
Sbjct  1    MATNNNNSKLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRET  60

Query  234  VQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYR  413
            VQECYELSAEYEG+ +PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYR
Sbjct  61   VQECYELSAEYEGKSNPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYR  120

Query  414  RRQKLKKGDFVDENSAITESDI  479
            RR KLKKGDF DENSA TESDI
Sbjct  121  RRIKLKKGDFADENSATTESDI  142



>ref|XP_006852422.1| hypothetical protein AMTR_s00021p00059810 [Amborella trichopoda]
 gb|ERN13889.1| hypothetical protein AMTR_s00021p00059810 [Amborella trichopoda]
Length=965

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+  +L K+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLD+LQDLHGE+LRETVQEC
Sbjct  1    MSKNSLVKLASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDVLQDLHGEDLRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YE SAEYEG+HDP+KLEELG+VLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEHSAEYEGKHDPRKLEELGSVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>gb|KJB13196.1| hypothetical protein B456_002G061400 [Gossypium raimondii]
Length=969

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 129/142 (91%), Gaps = 4/142 (3%)
 Frame = +3

Query  66   MAARN----LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRET  233
            MA  N    LEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRET
Sbjct  1    MATNNNNSKLEKLASIDAQLRALVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRET  60

Query  234  VQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYR  413
            VQECYELSAEYEG+  PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYR
Sbjct  61   VQECYELSAEYEGKSTPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYR  120

Query  414  RRQKLKKGDFVDENSAITESDI  479
            RR KLKKGDF DENSA TESDI
Sbjct  121  RRIKLKKGDFADENSATTESDI  142



>gb|KJB48959.1| hypothetical protein B456_008G095300 [Gossypium raimondii]
Length=965

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA+R +EK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MASRKVEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPK LEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            +KKGDF DE+SA TESDI
Sbjct  121  MKKGDFADESSATTESDI  138



>emb|CAA45504.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=967

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKL+ELG++LTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLDELGSLLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK GDF DE +A TESDI
Sbjct  121  LKSGDFADEANATTESDI  138



>gb|AJD81367.1| phosphoenolpyruvate carboxylase isoform 1 [Egeria densa]
Length=968

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 128/138 (93%), Gaps = 2/138 (1%)
 Frame = +3

Query  72   ARN--LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            ARN  +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ C
Sbjct  4    ARNPSIEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQRC  63

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEGR DP+KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  64   YELSAEYEGRLDPQKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAFRRRAK  123

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  124  LKKGDFADENSATTESDI  141



>gb|KHG11000.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Gossypium 
arboreum]
Length=965

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA+R +EK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MASRKVEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPK LEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPKILEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            +KKGDF DE+SA TESDI
Sbjct  121  MKKGDFADESSATTESDI  138



>gb|KDP36288.1| hypothetical protein JCGZ_09795 [Jatropha curcas]
Length=965

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA +NLEKM SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGKNLEKMVSIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YE+SAEYE +HDP+KLEELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEISAEYERKHDPQKLEELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRTK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGDF DENSA TESD+
Sbjct  121  SKKGDFADENSATTESDM  138



>gb|KEH19560.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=873

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_002302820.2| hypothetical protein POPTR_0002s22720g [Populus trichocarpa]
 gb|EEE82093.2| hypothetical protein POPTR_0002s22720g [Populus trichocarpa]
Length=995

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNL+KMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETV +C
Sbjct  31   MADRNLQKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGKDIRETVHDC  90

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HDP+KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIA RRR K
Sbjct  91   YELSAEYEAKHDPQKLEELGRVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIASRRRIK  150

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  151  LKKGDFADENSATTESDI  168



>gb|EYU26325.1| hypothetical protein MIMGU_mgv1a000844mg [Erythranthe guttata]
Length=964

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MATRNLEKMASIDAQLRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + D KKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA RRR K
Sbjct  61   YELSAEYESKRDAKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIATRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGD  DE++A TESDI
Sbjct  121  KKKGDITDESNATTESDI  138



>gb|KEH19559.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=967

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_009354255.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Pyrus x bretschneideri]
 ref|XP_009348400.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Pyrus x bretschneideri]
Length=967

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAA+NLEKMASID QLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAAKNLEKMASIDVQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + DP+KL ELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQDPQKLAELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  L-KKGDFVDENSAITESDI  479
            + KKGDF DE SA TESDI
Sbjct  121  MKKKGDFADEASATTESDI  139



>ref|XP_010911773.1| PREDICTED: phosphoenolpyruvate carboxylase 2, partial [Elaeis 
guineensis]
Length=127

 Score =   225 bits (573),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+   +EK+ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MSRNAVEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KL+ELG+VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGDVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDF  443
            LKKGDF
Sbjct  121  LKKGDF  126



>ref|XP_004251893.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
 ref|XP_010313917.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
Length=965

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA +NLEK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ TVQ+C
Sbjct  1    MATKNLEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKGTVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HDPKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDF DE++A TESDI
Sbjct  121  LKKKGDFGDESNATTESDI  139



>ref|XP_006407030.1| hypothetical protein EUTSA_v10019997mg [Eutrema salsugineum]
 dbj|BAJ34436.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48483.1| hypothetical protein EUTSA_v10019997mg [Eutrema salsugineum]
Length=968

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG  +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGNREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSATTESDI  139



>ref|XP_009146304.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
 ref|XP_009146305.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
Length=967

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ DPKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE+SA TESDI
Sbjct  121  KLKKGDFADESSATTESDI  139



>gb|ACO48251.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=969

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG V+TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVD N+A TESDI
Sbjct  121  LKKGDFVDVNNATTESDI  138



>ref|XP_007048690.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOX92847.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
Length=965

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA +++EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHG ++RETVQEC
Sbjct  1    MAGKSIEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGGDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP KLEELG V+TSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPLKLEELGKVITSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE+SA TESDI
Sbjct  121  LKKGDFADESSATTESDI  138



>gb|EPS69468.1| hypothetical protein M569_05291 [Genlisea aurea]
Length=965

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA+R LE M SIDAQLRLLVPGKVSEDD L+EYDALLLDRFLDILQDLHGE+LRETVQEC
Sbjct  1    MASRCLETMQSIDAQLRLLVPGKVSEDDHLIEYDALLLDRFLDILQDLHGEDLRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELGNVLTSLDPGDSIV+AK+FSHML+LAN+AEEVQ AYRRR K
Sbjct  61   YELSAEYEGKHDPRKLEELGNVLTSLDPGDSIVVAKAFSHMLSLANMAEEVQNAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGD+ DEN+A TESDI
Sbjct  121  KKKGDYTDENNATTESDI  138



>ref|XP_002894435.1| ATPPC1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70694.1| ATPPC1 [Arabidopsis lyrata subsp. lyrata]
Length=967

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAYRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_009357178.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Pyrus x bretschneideri]
Length=967

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+C
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGESLRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +  P+KLEELG +LTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKQVPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDF DE SA TESDI
Sbjct  121  LKKKGDFADEASATTESDI  139



>ref|XP_010479886.1| PREDICTED: phosphoenolpyruvate carboxylase 1 [Camelina sativa]
Length=967

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_010500970.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X1 
[Camelina sativa]
 ref|XP_010500971.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X2 
[Camelina sativa]
 ref|XP_010500972.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X3 
[Camelina sativa]
 ref|XP_010462211.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X1 
[Camelina sativa]
 ref|XP_010462212.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X2 
[Camelina sativa]
 ref|XP_010462213.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X3 
[Camelina sativa]
Length=967

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|NP_001237394.1| phosphoenolpyruvate carboxylase [Glycine max]
 gb|AAS67006.1| Phosphoenolpyruvate carboxylase [Glycine max]
 gb|KHN27941.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG H P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSAITESDI
Sbjct  121  LLKKGDFADENSAITESDI  139



>gb|ABU41519.1| phosphoenolpyruvate carboxylase [Jatropha curcas]
Length=965

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA +NLEKM SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAGKNLEKMVSIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YE+SA YE +HDP+KLEELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YEISAGYERKHDPQKLEELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRTK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGDF DENSA TESD+
Sbjct  121  SKKGDFADENSATTESDM  138



>ref|XP_010279120.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Nelumbo nucifera]
 ref|XP_010279121.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Nelumbo nucifera]
Length=964

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            ARNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE L+ETVQE YE
Sbjct  2    ARNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEELKETVQEVYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            L+A+YEG+HD +KLEELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIA+ RR KLK
Sbjct  62   LAAKYEGKHDFQKLEELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAHHRRTKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DENSA TESDI
Sbjct  122  KGDFHDENSATTESDI  137



>gb|KFK38845.1| phosphoenolpyruvate carboxylase [Arabis alpina]
Length=968

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ +P+KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKREPEKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSATTESDI  139



>ref|NP_001275821.1| phosphoenolpyruvate carboxylase [Citrus sinensis]
 gb|ABK54024.2| phosphoenolpyruvate carboxylase [Citrus sinensis]
Length=967

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 2/140 (1%)
 Frame = +3

Query  66   MAA-RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQE  242
            MAA RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE
Sbjct  1    MAANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQE  60

Query  243  CYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-  419
            CYEL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR 
Sbjct  61   CYELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRI  120

Query  420  QKLKKGDFVDENSAITESDI  479
            +KLKKGDF DENSA TESDI
Sbjct  121  KKLKKGDFADENSATTESDI  140



>pdb|3ZGB|A Chain A, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|3ZGB|B Chain B, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
Length=972

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            LEK+ASIDAQLRLLVPGKVSEDDKL+EYDALLLD+FLDILQDLHGE+L+E VQECYELSA
Sbjct  12   LEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKEAVQECYELSA  71

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLK+GD
Sbjct  72   EYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKRGD  131

Query  441  FVDENSAITESDI  479
            F DE +A TESDI
Sbjct  132  FADEANATTESDI  144



>gb|KHN36697.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG H P KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPDKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSAITESDI
Sbjct  121  LLKKGDFADENSAITESDI  139



>ref|XP_002882904.1| ATPPC3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59163.1| ATPPC3 [Arabidopsis lyrata subsp. lyrata]
Length=968

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSATTESDI  139



>ref|XP_003543306.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Glycine max]
Length=972

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG H P KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHKPDKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSAITESDI
Sbjct  121  LLKKGDFADENSAITESDI  139



>ref|XP_006306679.1| hypothetical protein CARUB_v10008196mg [Capsella rubella]
 gb|EOA39577.1| hypothetical protein CARUB_v10008196mg [Capsella rubella]
Length=967

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAYRRRVK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_007133202.1| hypothetical protein PHAVU_011G160200g [Phaseolus vulgaris]
 gb|ESW05196.1| hypothetical protein PHAVU_011G160200g [Phaseolus vulgaris]
Length=967

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDA LRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAHLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG HD KKL+ELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGNHDSKKLDELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>ref|XP_007149391.1| hypothetical protein PHAVU_005G066400g [Phaseolus vulgaris]
 gb|ESW21385.1| hypothetical protein PHAVU_005G066400g [Phaseolus vulgaris]
Length=968

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ+LHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPSKVSEDDKLIEYDALLLDRFLDILQNLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_006442514.1| hypothetical protein CICLE_v10018719mg [Citrus clementina]
 gb|ESR55754.1| hypothetical protein CICLE_v10018719mg [Citrus clementina]
Length=969

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 2/140 (1%)
 Frame = +3

Query  66   MAA-RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQE  242
            MAA RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE
Sbjct  1    MAANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQE  60

Query  243  CYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-  419
            CYEL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR 
Sbjct  61   CYELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRI  120

Query  420  QKLKKGDFVDENSAITESDI  479
            +KLKKGDF DENSA TESDI
Sbjct  121  KKLKKGDFADENSATTESDI  140



>gb|AAU07997.1| phosphoenolpyruvate carboxylase 2 [Lupinus albus]
Length=967

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKLVEYDALLLDRFLDILQDLHGE+++ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDMKETVQEI  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_006487452.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Citrus sinensis]
 ref|XP_006487453.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Citrus sinensis]
 ref|XP_006487454.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X3 [Citrus sinensis]
 gb|KDO44634.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
 gb|KDO44635.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
Length=969

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 2/140 (1%)
 Frame = +3

Query  66   MAA-RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQE  242
            MAA RNLEKMASIDAQLRLLVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE
Sbjct  1    MAANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQE  60

Query  243  CYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-  419
            CYEL+AEYEG++DP K +ELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEE+QIA+RRR 
Sbjct  61   CYELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRI  120

Query  420  QKLKKGDFVDENSAITESDI  479
            +KLKKGDF DENSA TESDI
Sbjct  121  KKLKKGDFADENSATTESDI  140



>emb|CBI21984.3| unnamed protein product [Vitis vinifera]
Length=944

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE+L+ETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQEIHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELG V+TSLD GDSIV+AKSFS+ML LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGRVITSLDAGDSIVVAKSFSNMLTLANLAEEVQIAFRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE+SA TESDI
Sbjct  121  LKKGDFHDESSATTESDI  138



>sp|Q9AU12.1|CAPP_PHAVU RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Phaseolus vulgaris]
 gb|AAK28444.1|AF288382_1 phosphoenolpyruvate carboxylase [Phaseolus vulgaris]
Length=968

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ+LHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPSKVSEDDKLIEYDALLLDRFLDILQNLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_009406237.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            LEKMASIDA +RLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE +RETVQE YELSA
Sbjct  4    LEKMASIDAHMRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEEIRETVQELYELSA  63

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYEG H+P+KLEELGNVLTSLDPGD+IV++KSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  64   EYEGNHEPEKLEELGNVLTSLDPGDTIVVSKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  123

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  124  FADENSAITESDI  136



>ref|XP_002280569.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
 ref|XP_010657037.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
 emb|CAN77927.1| hypothetical protein VITISV_018739 [Vitis vinifera]
Length=965

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE+L+ETVQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQEIHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELG V+TSLD GDSIV+AKSFS+ML LANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPQKLEELGRVITSLDAGDSIVVAKSFSNMLTLANLAEEVQIAFRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE+SA TESDI
Sbjct  121  LKKGDFHDESSATTESDI  138



>ref|XP_006392801.1| hypothetical protein EUTSA_v10011967mg, partial [Eutrema salsugineum]
 gb|ESQ30087.1| hypothetical protein EUTSA_v10011967mg, partial [Eutrema salsugineum]
Length=935

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+HDPKKLE+LG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHDPKKLEDLGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_003597124.1| Phosphoenolpyruvate carboxylase [Medicago truncatula]
 gb|AES67375.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPKKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG H P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSAITESDI
Sbjct  121  LLKKGDFADENSAITESDI  139



>gb|KJB82054.1| hypothetical protein B456_013G173500 [Gossypium raimondii]
Length=750

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA+RRR KLKKGD
Sbjct  72   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAHRRRIKLKKGD  131

Query  441  FVDENSAITESDI  479
            FVDEN+A TESD+
Sbjct  132  FVDENNATTESDL  144



>dbj|BAJ34480.1| unnamed protein product [Thellungiella halophila]
Length=967

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+HDPKKLE+LG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHDPKKLEDLGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_010052683.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Eucalyptus grandis]
 gb|KCW89639.1| hypothetical protein EUGRSUZ_A01915 [Eucalyptus grandis]
 gb|KCW89640.1| hypothetical protein EUGRSUZ_A01915 [Eucalyptus grandis]
Length=966

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEK+ SIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MAARNLEKLTSIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGESIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ +P+KLEELG +LT LDPGDSIVI KSF+HMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKQEPQKLEELGKMLTGLDPGDSIVITKSFAHMLNLANLAEEVQIAHRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE SA TESDI
Sbjct  121  LKKGDFADEASATTESDI  138



>ref|NP_001241357.1| phosphoenolpyruvate carboxylase [Glycine max]
 ref|XP_006591889.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X1 [Glycine 
max]
 ref|XP_006591890.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X2 [Glycine 
max]
 sp|P51061.1|CAPP2_SOYBN RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Glycine max]
 dbj|BAA03100.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MATRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>dbj|BAH19953.1| AT1G53310 [Arabidopsis thaliana]
Length=967

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|NP_175738.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 ref|NP_001031178.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 ref|NP_001031179.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 sp|Q9MAH0.1|CAPP1_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=AtPPC1; 
Short=PEPC 1; Short=PEPCase 1; AltName: Full=107-kDa PEPC 
polypeptide [Arabidopsis thaliana]
 gb|AAF69546.1|AC008007_21 F12M16.21 [Arabidopsis thaliana]
 gb|AAL09748.1| At1g53310/F12M16_21 [Arabidopsis thaliana]
 gb|AAN18213.1| At1g53310/F12M16_21 [Arabidopsis thaliana]
 emb|CAD58725.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE32921.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 gb|AEE32922.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 gb|AEE32923.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
Length=967

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R LEKMASID  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_006296907.1| hypothetical protein CARUB_v10012899mg [Capsella rubella]
 gb|EOA29805.1| hypothetical protein CARUB_v10012899mg [Capsella rubella]
Length=968

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ +PKKLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSATTESDI  139



>sp|P30694.2|CAPPA_FLATR RecName: Full=C4 phosphoenolpyruvate carboxylase; Short=C4 PEPC; 
Short=C4 PEPCase; Short=ppcA; AltName: Full=Photosynthetic 
PEPCase [Flaveria trinervia]
 emb|CAA43601.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=966

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK GDF DE +A TESDI
Sbjct  121  LKSGDFADEANATTESDI  138



>prf||1801241A phosphoenolpyruvate carboxylase
Length=966

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK GDF DE +A TESDI
Sbjct  121  LKSGDFADEANATTESDI  138



>gb|ABR17346.1| unknown [Picea sitchensis]
Length=963

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA  NLEKMASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MARNNLEKMASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIREMVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YE S EYEG++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YERSGEYEGKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            +K+G F DE++A TESDI
Sbjct  121  IKRGGFADESNATTESDI  138



>ref|XP_004516076.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Cicer arietinum]
Length=967

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDA LR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAHLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEGKHDPEKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>emb|CAA81072.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=966

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  1    MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LK GDF DE +A TESDI
Sbjct  121  LKSGDFADEANATTESDI  138



>gb|KDP32538.1| hypothetical protein JCGZ_14741 [Jatropha curcas]
Length=957

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  90   MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  269
            MASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELS EYE
Sbjct  1    MASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSGEYE  60

Query  270  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVD  449
            G+HD KKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIA+RRR KLKKGDF D
Sbjct  61   GKHDGKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAHRRRNKLKKGDFAD  120

Query  450  ENSAITESDI  479
            EN+A TESDI
Sbjct  121  ENNATTESDI  130



>ref|XP_007132856.1| hypothetical protein PHAVU_011G130400g [Phaseolus vulgaris]
 gb|ESW04850.1| hypothetical protein PHAVU_011G130400g [Phaseolus vulgaris]
Length=966

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLRLLVP KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ+C
Sbjct  1    MATRNLEKMASIDAQLRLLVPSKVSDDDKLVEYDALLLDRFLDILQDLHGGDIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+++P+KLEELGN+LT LD GDSIVI+KSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGQNNPQKLEELGNMLTGLDAGDSIVISKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF+DENSAITESDI
Sbjct  121  LLKKGDFIDENSAITESDI  139



>pdb|3ZGE|A Chain A, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|3ZGE|B Chain B, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|4BXC|A Chain A, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
 pdb|4BXC|B Chain B, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
 pdb|4BXH|A Chain A, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
Length=990

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  25   MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  84

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  85   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  144

Query  426  LKKGDFVDENSAITESDI  479
            LK GDF DE +A TESDI
Sbjct  145  LKSGDFADEANATTESDI  162



>pdb|4BXH|B Chain B, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
Length=990

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLD+FLDILQDLHGE+L+E VQ+C
Sbjct  25   MANRNVEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDKFLDILQDLHGEDLKEAVQQC  84

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELG++LTSLD GDSIVIAK+FSHMLNLANLAEE+QIAYRRR K
Sbjct  85   YELSAEYEGKHDPKKLEELGSLLTSLDTGDSIVIAKAFSHMLNLANLAEELQIAYRRRIK  144

Query  426  LKKGDFVDENSAITESDI  479
            LK GDF DE +A TESDI
Sbjct  145  LKSGDFADEANATTESDI  162



>ref|XP_010552117.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Tarenaya hassleriana]
 ref|XP_010552118.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Tarenaya hassleriana]
Length=967

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQ+ 
Sbjct  1    MAARNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQDL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+H+P KLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKHEPGKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KL K DF DENSA TESDI
Sbjct  121  KLAKRDFADENSATTESDI  139



>gb|KHN36882.1| Phosphoenolpyruvate carboxylase [Glycine soja]
Length=967

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|XP_006593478.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X1 [Glycine 
max]
 dbj|BAC41249.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>ref|NP_001236741.1| phosphoenolpyruvate carboxylase [Glycine max]
 dbj|BAA23419.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>gb|AAO42888.1| At3g14940 [Arabidopsis thaliana]
 dbj|BAE99551.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=968

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ +P KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSATTESDI  139



>ref|NP_188112.1| phosphoenolpyruvate carboxylase 3 [Arabidopsis thaliana]
 sp|Q84VW9.2|CAPP3_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 3; Short=AtPPC3; 
Short=PEPC 3; Short=PEPCase 3 [Arabidopsis thaliana]
 gb|AAC24594.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 emb|CAA10486.1| phospho enole pyruvate carboxylase [Arabidopsis thaliana]
 dbj|BAA97057.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE75592.1| phosphoenolpyruvate carboxylase 3 [Arabidopsis thaliana]
Length=968

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ +P KLEELG+VLTSLDPGDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPSKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSATTESDI  139



>ref|XP_010542308.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Tarenaya hassleriana]
Length=967

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 127/139 (91%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKM SIDAQLR LVP KV EDD+LVEYDALLLDRFLDILQDLHGE LRETVQE 
Sbjct  1    MATRNLEKMVSIDAQLRQLVPAKVGEDDRLVEYDALLLDRFLDILQDLHGEGLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+HDPKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KL + DF DENSA TESDI
Sbjct  121  KLARRDFADENSATTESDI  139



>gb|AJD81371.1| phosphoenolpyruvate carboxylase isoform 5, partial [Egeria densa]
Length=967

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  78   NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETV-QECYEL  254
            N+EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETV Q CYEL
Sbjct  6    NVEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVVQRCYEL  65

Query  255  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  434
            SAEYEGR DP+KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR KLKK
Sbjct  66   SAEYEGRLDPQKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAFRRRAKLKK  125

Query  435  GDFVDENSAITESDI  479
            GDF DENSA TESDI
Sbjct  126  GDFGDENSATTESDI  140



>gb|AAO15570.1|AF459644_1 phosphoenolpyruvate carboxylase [Lupinus albus]
Length=967

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKLVEYDALLLDRFLDILQDLHGE+++ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDMKETVQEI  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR  
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNN  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>gb|ABR29878.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=965

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNL  MASIDAQLRLL   KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+C
Sbjct  1    MAGRNLVIMASIDAQLRLLALRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+H+P+KL ELG VLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHNPQKLAELGKVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSATTESDI  138



>gb|ABV80356.1| phosphoenolpyruvate carboxylase [Gossypium hirsutum]
Length=971

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYEG+  PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLA+LAEEVQIAYRRR KLKKGD
Sbjct  72   EYEGKSTPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLADLAEEVQIAYRRRIKLKKGD  131

Query  441  FVDENSAITESDI  479
            F DENSA TESDI
Sbjct  132  FADENSATTESDI  144



>gb|KJB82053.1| hypothetical protein B456_013G173500 [Gossypium raimondii]
Length=964

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
             EK+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQECYELSA
Sbjct  12   FEKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQECYELSA  71

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYEG+++PKKLEELGNVLTSLDPGDSIV+AK+FSHMLNLANLAEEVQIA+RRR KLKKGD
Sbjct  72   EYEGKNNPKKLEELGNVLTSLDPGDSIVVAKAFSHMLNLANLAEEVQIAHRRRIKLKKGD  131

Query  441  FVDENSAITESDI  479
            FVDEN+A TESD+
Sbjct  132  FVDENNATTESDL  144



>emb|CAB65170.1| phosphoenolpyruvate carboxylase 1 [Solanum lycopersicum var. 
cerasiforme]
Length=964

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RNL+K+ASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ TVQ+C
Sbjct  1    MTTRNLDKLASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKGTVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HDPKKLEELGNVLTSL PGDSIVIAK+FSHMLNLANLAEEVQIAYRRRQK
Sbjct  61   YELSAEYEAKHDPKKLEELGNVLTSLVPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK  120

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDF DE++A TESDI
Sbjct  121  LKKKGDFGDESNATTESDI  139



>gb|EEC83482.1| hypothetical protein OsI_28999 [Oryza sativa Indica Group]
Length=684

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DENSA+TESDI
Sbjct  122  KGDFADENSALTESDI  137



>gb|AJD81369.1| phosphoenolpyruvate carboxylase isoform 3 [Egeria densa]
Length=978

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  78   NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  257
            N+EKMASIDAQLR+L P KVSEDDKLVEYDALL+DRFLDILQDLHGE LRETVQ CYELS
Sbjct  18   NVEKMASIDAQLRILAPSKVSEDDKLVEYDALLVDRFLDILQDLHGEELRETVQRCYELS  77

Query  258  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG  437
            AEYEG+ DP+KLEELGNVLTSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR KLKKG
Sbjct  78   AEYEGKLDPQKLEELGNVLTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAFRRRAKLKKG  137

Query  438  DFVDENSAITESDI  479
            DF DE+SA TESDI
Sbjct  138  DFADESSATTESDI  151



>ref|XP_008813762.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X1 
[Phoenix dactylifera]
Length=966

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+   +EK+ASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQ LHGE+LRETVQE 
Sbjct  1    MSRNVVEKLASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQYLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ DP KL+ELGNVLTSLDPGDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKPDPSKLDELGNVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSAATESDI  138



>sp|P51063.1|CAPP_PICAB RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Picea abies]
 emb|CAA55700.1| phosphoenolpyruvate carboxylase [Picea abies]
Length=963

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA  NLEKMASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++R  VQEC
Sbjct  1    MARNNLEKMASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIRAMVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YE S EYEG++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YERSGEYEGKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            +K+G F DE++A TESDI
Sbjct  121  IKRGGFADESNATTESDI  138



>ref|XP_007149740.1| hypothetical protein PHAVU_005G095300g [Phaseolus vulgaris]
 gb|ESW21734.1| hypothetical protein PHAVU_005G095300g [Phaseolus vulgaris]
Length=966

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG H P+KLEELGN+LT LD GDSIVI+KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVISKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSA+TESDI
Sbjct  121  LLKKGDFADENSAMTESDI  139



>ref|XP_010920051.1| PREDICTED: LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase, 
housekeeping isozyme-like [Elaeis guineensis]
Length=966

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+   +EK+ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MSRNAVEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDP+KL+ELGNVLTSLDPGDSIVI KSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKHDPRKLDELGNVLTSLDPGDSIVITKSFSNMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSAATESDI  138



>ref|XP_008793018.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Phoenix dactylifera]
Length=966

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+   +EK+AS+DAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MSRNGVEKLASVDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+ DP KL+ELGNVLTSLDPGDSIV+ KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGKRDPSKLDELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKG F DENSA TESDI
Sbjct  121  LKKGYFADENSAATESDI  138



>emb|CAJ84247.1| phosphoenolpyruvate carboxylase [Lupinus luteus]
Length=967

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +H+P+KLE+LGN++TSLD GDSIV AK+FSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEEKHEPEKLEKLGNIITSLDAGDSIVFAKAFSHMLNLANLAEEVQIAHRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>gb|AJD81368.1| phosphoenolpyruvate carboxylase isoform 2 [Egeria densa]
Length=968

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  78   NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  257
            N+EKM SIDAQLR+L P KVSEDDKLVEYDALL+DRFLDILQDLHGE LRETVQ CYELS
Sbjct  8    NVEKMVSIDAQLRILAPSKVSEDDKLVEYDALLVDRFLDILQDLHGEELRETVQRCYELS  67

Query  258  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG  437
            AEYEG+ DP+KLE+LGNVLTSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR KLKKG
Sbjct  68   AEYEGKLDPQKLEKLGNVLTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAFRRRAKLKKG  127

Query  438  DFVDENSAITESDI  479
            DF DENSA TESDI
Sbjct  128  DFADENSATTESDI  141



>ref|XP_009135413.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
Length=967

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNIEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ +PKKLEELG VLTSLD GDSIVI+K+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELSAEYEGKREPKKLEELGKVLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSAATESDI  139



>ref|NP_001267665.1| phosphoenolpyruvate carboxylase 2-like [Cucumis sativus]
 ref|XP_004155470.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Cucumis sativus]
 gb|AFS33791.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
 gb|KGN43627.1| Phosphoenolpyruvate carboxylase 1 [Cucumis sativus]
Length=965

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  69   AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  248
            A +NLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQECY
Sbjct  3    AVKNLEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQECY  62

Query  249  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  428
            E +AEYE + DP+KLEELGN LTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR KL
Sbjct  63   EFAAEYERKRDPEKLEELGNALTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRIKL  122

Query  429  KKGDFVDENSAITESDI  479
            KKG F DE +A TESDI
Sbjct  123  KKGGFADEANATTESDI  139



>ref|XP_003527347.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Glycine max]
 gb|KHN33958.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M  RN EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++RETVQ+C
Sbjct  1    MGTRNFEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+++P+KLEELGN+LT LD GDSIVI+KSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGQNNPQKLEELGNMLTGLDAGDSIVISKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSAITESDI
Sbjct  121  LLKKGDFADENSAITESDI  139



>ref|XP_009395707.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/133 (89%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            LEK ASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRE VQECYE SA
Sbjct  4    LEKTASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLREMVQECYEHSA  63

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE +HDP+KLEELGN LTSLDPGD IV+ KSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  64   EYERKHDPRKLEELGNELTSLDPGDLIVVTKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  123

Query  441  FVDENSAITESDI  479
            F DENSA TESDI
Sbjct  124  FADENSATTESDI  136



>ref|XP_008812088.1| PREDICTED: SCAR-like protein 2 [Phoenix dactylifera]
Length=2243

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 138/159 (87%), Gaps = 2/159 (1%)
 Frame = +3

Query  6     TICRFR*LKSGLWSGADSEK-MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLD  182
             +ICR + L+ G   G + E+ M+  +LE+ AS+DA+LRLL PGKVSEDDKLVEYDALLLD
Sbjct  1259  SICR-KLLQRGSERGGEREREMSKNSLERHASMDAKLRLLAPGKVSEDDKLVEYDALLLD  1317

Query  183   RFLDILQDLHGENLRETVQECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFS  362
             RFLDILQDLHGE +RETVQECYELSAEYE + DPKKL+ELGNVLTSLDPGDSIV++ SFS
Sbjct  1318  RFLDILQDLHGEEIRETVQECYELSAEYERKQDPKKLDELGNVLTSLDPGDSIVVSSSFS  1377

Query  363   HMLNLANLAEEVQIAYRRRQKLKKGDFVDENSAITESDI  479
             HMLNLANLAEEVQIA+RRR K KKGDF DENSA TESDI
Sbjct  1378  HMLNLANLAEEVQIAHRRRIKRKKGDFADENSATTESDI  1416



>ref|XP_010465426.1| PREDICTED: phosphoenolpyruvate carboxylase 3-like [Camelina sativa]
Length=968

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ +PKKLEELG++LTSLD GDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSLLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSATTESDI  139



>ref|XP_010502354.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Camelina sativa]
Length=968

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYEG+ +PKKLEELG++LTSLD GDSIVI+K+FSHMLNLANLAEEVQIA+RRR +
Sbjct  61   YELSAEYEGKREPKKLEELGSLLTSLDAGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESDI
Sbjct  121  KLKKGDFVDESSATTESDI  139



>ref|XP_004487157.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Cicer arietinum]
Length=965

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++R+TVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGQDIRQTVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG H+ +KLEELGN+LT LD GDSIVI+KSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGNHESEKLEELGNMLTGLDAGDSIVISKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSAITESDI
Sbjct  121  LLKKGDFADENSAITESDI  139



>ref|XP_010915515.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Elaeis guineensis]
Length=965

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + DPKKL+ELGNV TSLDPGDSIV++ SFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEQKQDPKKLDELGNVFTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAHRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGDF DENSA TESDI
Sbjct  121  RKKGDFADENSATTESDI  138



>ref|NP_001061646.1| Os08g0366000 [Oryza sativa Japonica Group]
 dbj|BAC24913.1| phosphoenolpyruvate carboxylase [Oryza sativa Japonica Group]
 dbj|BAF23560.1| Os08g0366000 [Oryza sativa Japonica Group]
 gb|EAZ06753.1| hypothetical protein OsI_28997 [Oryza sativa Indica Group]
 gb|EAZ42509.1| hypothetical protein OsJ_27076 [Oryza sativa Japonica Group]
 dbj|BAG93600.1| unnamed protein product [Oryza sativa Japonica Group]
Length=964

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLRELVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DENSA+TESDI
Sbjct  122  KGDFADENSALTESDI  137



>ref|XP_008455304.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Cucumis melo]
Length=965

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  69   AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  248
            A +NLEKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQECY
Sbjct  3    AVKNLEKMASIDAQLRLLAPSKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQECY  62

Query  249  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  428
            E +AEYE + DP+KLEELG+ LTSLDPGDSIV+AKSFSHML+LANLAEEVQIAYRRR KL
Sbjct  63   EFAAEYERKRDPRKLEELGSALTSLDPGDSIVVAKSFSHMLSLANLAEEVQIAYRRRIKL  122

Query  429  KKGDFVDENSAITESDI  479
            KKG F DE +A TESDI
Sbjct  123  KKGGFADEANATTESDI  139



>ref|XP_004505496.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Cicer arietinum]
Length=966

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M +R +EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG+++RETVQ+C
Sbjct  1    MTSRKIEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG ++P+KLEELGN+LT LD GDSIVIAKSF+HMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGENNPQKLEELGNMLTGLDAGDSIVIAKSFAHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSAITESDI
Sbjct  121  LLKKGDFADENSAITESDI  139



>ref|XP_006659319.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Oryza brachyantha]
Length=964

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  +EKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            ++AEYEG+HD +KL ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYEGKHDSQKLSELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DENSA+TESDI
Sbjct  122  KGDFADENSALTESDI  137



>emb|CDY45929.1| BnaC06g09980D [Brassica napus]
Length=838

 Score =   235 bits (599),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELG+VLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>gb|ACO48250.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=966

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA + +EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ+C
Sbjct  1    MATKKVEKMASIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGLDIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG +DP KLEELGN+LT LD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGENDPHKLEELGNMLTGLDAGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDFVDENSAITESD+
Sbjct  121  LLKKGDFVDENSAITESDL  139



>emb|CDY25721.1| BnaC03g69540D [Brassica napus]
Length=891

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_009106983.1| PREDICTED: phosphoenolpyruvate carboxylase 1 [Brassica rapa]
 emb|CDY02513.1| BnaA08g01200D [Brassica napus]
Length=964

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>emb|CAA11415.1| phosphoenolpyruvate carboxylase [Brassica juncea]
Length=964

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_009795584.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana sylvestris]
Length=964

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEG+HDP+KLEELG +LTSLD GDSIV+ K+FS+MLNLANLAEEVQIAYRRR KLK
Sbjct  62   LSAEYEGKHDPQKLEELGRMLTSLDAGDSIVVTKAFSNMLNLANLAEEVQIAYRRRSKLK  121

Query  432  KGDFVDENSAITESDI  479
            K DF DE SA+TESDI
Sbjct  122  KRDFSDEASALTESDI  137



>ref|XP_010925637.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Elaeis guineensis]
Length=965

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEY  + D KKL ELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYGRKQDLKKLGELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DENSA TESDI
Sbjct  121  LKKGDFADENSAPTESDI  138



>emb|CAA11414.1| phosphoenolpyrovate carboxylase [Brassica juncea]
Length=964

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M    LEKMAS+D  LR LVPGKVSEDDKLVEYDALLLDRFLDILQ+LHGE+LRETVQE 
Sbjct  1    MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQELHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE SAEYEG+H+PKKLEELGNVLTSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SA TESD+
Sbjct  121  KLKKGDFVDESSATTESDL  139



>ref|XP_009416509.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +EKMASIDA +RLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+++RETVQ+ YELSA
Sbjct  4    VEKMASIDAHMRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGDDIRETVQDLYELSA  63

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYEG+HDP+KL ELGNVLTSLD GD+IV+ KSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  64   EYEGKHDPEKLVELGNVLTSLDAGDTIVVTKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  123

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  124  FADENSAITESDI  136



>emb|CAC83482.1| phosphoenolpyruvate carboxylase [Phalaenopsis amabilis]
Length=965

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+   +E+ ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE++RETVQEC
Sbjct  1    MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE  HD KKLEELG+VLTSLDPGDSIV+AKSFS+MLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEATHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSAATESDI  138



>emb|CDP15935.1| unnamed protein product [Coffea canephora]
Length=968

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RN+EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDI QDLHGE +RETVQ+C
Sbjct  1    MATRNIEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDIFQDLHGEEIRETVQDC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE + DP+KL+ELG +LTSLD GDSIV+AKSFS+MLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYERKRDPQKLDELGRMLTSLDAGDSIVVAKSFSNMLNLANLAEEVQIAYRRRSK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKK DF DE SA TESDI
Sbjct  121  LKKRDFSDEASATTESDI  138



>emb|CAC83481.1| phosphoenolpyruvate carboxylase [Phalaenopsis equestris]
Length=965

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+   +E+ ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ++HGE++RETVQEC
Sbjct  1    MSRSTVERHASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQEIHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE  HD KKLEELG+VLTSLDPGDSIV+AKSFS+MLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYEATHDSKKLEELGHVLTSLDPGDSIVVAKSFSNMLNLANLAEEVQIAFRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSAATESDI  138



>gb|ACN32213.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=966

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A+ LEKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE YE
Sbjct  2    AKKLEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEVYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEG+HD KKL+ELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYEGKHDSKKLDELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRIKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DEN+A TESDI
Sbjct  122  KGDFADENNATTESDI  137



>ref|XP_002444204.1| hypothetical protein SORBIDRAFT_07g014960 [Sorghum bicolor]
 gb|EES13699.1| hypothetical protein SORBIDRAFT_07g014960 [Sorghum bicolor]
Length=964

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  LEKMASIDAQLR+L P K+SEDDKLVEYDALLLDRFLDILQDLHGE+LRE VQECYE
Sbjct  2    AGKLEKMASIDAQLRMLAPAKLSEDDKLVEYDALLLDRFLDILQDLHGEDLRELVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            ++AEYE +HD +KL+ELGN+LTSLDPGDSIV AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYERKHDSEKLDELGNMLTSLDPGDSIVTAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DENSA+TESDI
Sbjct  122  KGDFADENSALTESDI  137



>ref|XP_006348868.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=964

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEGRHDP KLEELG +LTSLD GDSIV+ K+FS+MLNL NLAEEVQIAYRRR KLK
Sbjct  62   LSAEYEGRHDPHKLEELGRMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKLK  121

Query  432  KGDFVDENSAITESDI  479
            K DF DE SA+TESDI
Sbjct  122  KRDFSDEASALTESDI  137



>gb|ABY87944.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=968

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 3/141 (2%)
 Frame = +3

Query  66   MAA--RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  239
            MAA  RN+EKMASIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHGE++R+TVQ
Sbjct  1    MAATSRNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQ  60

Query  240  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  419
            +CYELSAEYEG+H  +KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR
Sbjct  61   DCYELSAEYEGKHKTEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  120

Query  420  QK-LKKGDFVDENSAITESDI  479
             K LKKGDF DEN AITESDI
Sbjct  121  IKLLKKGDFADENPAITESDI  141



>dbj|BAC41248.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQ    ENL+ETVQE 
Sbjct  1    MATRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQGFTWENLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG+HDPKKLEELGN++TSLD GDSI++AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYEGKHDPKKLEELGNLITSLDAGDSILVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>dbj|BAC20365.1| phosphoenolpyruvate carboxylase [Lotus japonicus]
Length=967

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +H+P++LE LGN++TSLD GDSIV+AKSF+HMLNLANLAEEVQIA+RRR K
Sbjct  61   YELSAEYERKHEPQRLEVLGNLITSLDAGDSIVVAKSFAHMLNLANLAEEVQIAHRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DE +A TESDI
Sbjct  121  LKKGDFADEGNATTESDI  138



>sp|P16097.1|CAPP2_MESCR RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2 [Mesembryanthemum crystallinum]
 emb|CAA32728.2| phosphoenolpyruvate carboxylase [Mesembryanthemum crystallinum]
Length=960

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  90   MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  269
            MASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQECYE SAEYE
Sbjct  1    MASIDAQLRLLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQECYERSAEYE  60

Query  270  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-QKLKKGDFV  446
            G+HDPKKL+ELG+VLTSLD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR +KLKKGD  
Sbjct  61   GKHDPKKLDELGSVLTSLDAGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIKKLKKGDLS  120

Query  447  DENSAITESDI  479
            DENSA TESDI
Sbjct  121  DENSATTESDI  131



>ref|XP_011100202.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Sesamum indicum]
Length=966

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            +R +EKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE +RETVQ+CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQDCYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            +SAEYEG+ DP+KLEELG VLTSLD GDSIV+AKSFS+MLNLANLAEEVQIAYRRR KLK
Sbjct  62   ISAEYEGKRDPQKLEELGRVLTSLDAGDSIVVAKSFSNMLNLANLAEEVQIAYRRRIKLK  121

Query  432  KGDFVDENSAITESDI  479
            K DF DE SA TESDI
Sbjct  122  KRDFSDEASATTESDI  137



>emb|CAJ86550.1| phosphoenolpyrovate carboxylase [Lupinus luteus]
Length=968

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  75   RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  254
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE L++TVQE YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEGLKDTVQEVYEL  64

Query  255  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  434
            S+EYEG+HDPKKLEE+GNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KLKK
Sbjct  65   SSEYEGKHDPKKLEEIGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  435  GDFVDENSAITESDI  479
            G+F DE +A TESDI
Sbjct  125  GNFADETNATTESDI  139



>ref|XP_010924612.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Elaeis guineensis]
Length=966

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+  +LE+ AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC
Sbjct  1    MSKNSLERHASVDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEY  + D KKL ELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYGRKQDLKKLGELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKG F DEN A TESDI
Sbjct  121  LKKGYFADENCATTESDI  138



>gb|AAO25631.1| phosphoenolpyruvate carboxylase [Oryza sativa Indica Group]
Length=964

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  +EKMASIDAQLR+L P   SEDDKLVEYDALLLDRFLDILQDLHG++LRE VQECYE
Sbjct  2    AGKVEKMASIDAQLRMLAPAHRSEDDKLVEYDALLLDRFLDILQDLHGDDLREMVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            ++AEYEG+HD +KL+ELGN+LTSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLK
Sbjct  62   IAAEYEGKHDSQKLDELGNMLTSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DENSA+TESDI
Sbjct  122  KGDFADENSALTESDI  137



>ref|XP_010524060.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Tarenaya hassleriana]
Length=965

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASID QLRLL PGKVSEDDKLVE+DALLLDRFLDILQDLHGE +RE VQEC
Sbjct  1    MAARNLEKMASIDVQLRLLAPGKVSEDDKLVEFDALLLDRFLDILQDLHGEEIREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++AEY+G+ D +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAAEYDGKRDTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>ref|XP_009603289.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
Length=964

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQACYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEG+HDP+KLEELG +LTSLD GDSIV+ K+FS+MLNLANLAEEVQIAYRRR KLK
Sbjct  62   LSAEYEGKHDPQKLEELGRMLTSLDAGDSIVVTKAFSNMLNLANLAEEVQIAYRRRSKLK  121

Query  432  KGDFVDENSAITESDI  479
            K DF DE SA+TESDI
Sbjct  122  KRDFSDEASALTESDI  137



>ref|XP_010277028.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Nelumbo nucifera]
Length=964

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            ARNLEK+ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGE+L+ETVQE YE
Sbjct  2    ARNLEKLASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEVYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYE  HDP+KL+ELG VLTSLD GDSIV+ K+FSHMLNLANLAEEVQIAYRRR + K
Sbjct  62   LSAEYERNHDPQKLDELGKVLTSLDAGDSIVLTKAFSHMLNLANLAEEVQIAYRRRTRQK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DE++A TESDI
Sbjct  122  KGDFHDESNATTESDI  137



>gb|AAU07999.1| phosphoenolpyruvate carboxylase 4 [Lupinus albus]
Length=968

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  75   RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  254
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L++TVQE YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDTVQEVYEL  64

Query  255  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  434
            S++YEG+HDPKKLEE+GNV+TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KLKK
Sbjct  65   SSQYEGKHDPKKLEEIGNVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  435  GDFVDENSAITESDI  479
            G+F DE +A TESDI
Sbjct  125  GNFADETNATTESDI  139



>ref|XP_006293629.1| hypothetical protein CARUB_v10022582mg [Capsella rubella]
 gb|EOA26527.1| hypothetical protein CARUB_v10022582mg [Capsella rubella]
Length=963

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>tpg|DAA61011.1| TPA: phosphoenolpyruvate carboxylase4 [Zea mays]
Length=967

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  8    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  67

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  68   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  127

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  128  FADENSAITESDI  140



>ref|XP_003607582.1| Phosphoenolpyruvate carboxylase [Medicago truncatula]
 gb|AES89779.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M +R LEK  SIDAQLRLL P KVS+DDKLVEYDALLLDRFLDILQDLHG ++RETVQ C
Sbjct  1    MTSRKLEKTTSIDAQLRLLAPSKVSDDDKLVEYDALLLDRFLDILQDLHGHDIRETVQNC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYEG ++P+KLEELGN+LT LD GDSIVIAKSFSHMLNLANLAEEVQIAYRRR K
Sbjct  61   YELSAEYEGNNNPQKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  426  -LKKGDFVDENSAITESDI  479
             LKKGDF DENSAITESDI
Sbjct  121  LLKKGDFGDENSAITESDI  139



>sp|P29194.1|CAPP2_SORBI RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2; AltName: Full=CP28 [Sorghum bicolor]
 emb|CAA42549.1| phosphoenolpyruvate carboxylase [Sorghum bicolor]
Length=960

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  1    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  60

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  61   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKGD  120

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  121  FADENSAITESDI  133



>ref|XP_009380945.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380946.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+  +LE+ ASIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQ LHGE+LRETVQEC
Sbjct  1    MSRDSLERHASIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQCLHGEDLRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YE+SA+YEG  DP KL+ELGNVL SLDPGDSI++A SFSHMLNL NLAEEVQIAYRRR +
Sbjct  61   YEISAKYEGTGDPSKLDELGNVLMSLDPGDSILVASSFSHMLNLGNLAEEVQIAYRRRNR  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDEN+A TESDI
Sbjct  121  LKKGDFVDENNATTESDI  138



>ref|NP_850373.4| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 ref|NP_850372.4| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 sp|Q5GM68.2|CAPP2_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=AtPPC2; 
Short=PEPC 2; Short=PEPCase 2 [Arabidopsis thaliana]
 gb|AEC10145.1| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 gb|AEC10146.1| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
Length=963

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>ref|XP_002462179.1| hypothetical protein SORBIDRAFT_02g021090 [Sorghum bicolor]
 gb|EER98700.1| hypothetical protein SORBIDRAFT_02g021090 [Sorghum bicolor]
Length=967

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  78   NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  257
             +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++
Sbjct  7    KMERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVA  66

Query  258  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG  437
            AEYE +HD +KL+ELG ++TSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR KLKKG
Sbjct  67   AEYETKHDLQKLDELGKMITSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIKLKKG  126

Query  438  DFVDENSAITESDI  479
            DF DENSAITESDI
Sbjct  127  DFADENSAITESDI  140



>gb|AAP43628.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=963

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>gb|AAD31452.1|AF135371_1 phosphoenol pyruvate carboxylase [Lotus corniculatus]
Length=957

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HD +KLEELG V+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>gb|AAD22994.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=941

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>emb|CAD58726.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=963

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>ref|XP_002881863.1| phosphoenolpyruvate carboxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58122.1| phosphoenolpyruvate carboxylase [Arabidopsis lyrata subsp. lyrata]
Length=963

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>gb|AAK58636.1|AF271162_1 phosphoenolpyruvate carboxylase isoform 2 [Hydrilla verticillata]
Length=968

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = +3

Query  66   MAARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETV  236
            MAARN   +E+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFLDILQDLHGE+LRETV
Sbjct  1    MAARNSNHVERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLDILQDLHGEDLRETV  60

Query  237  QECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRR  416
            Q CYELSAEYE   +P+KLEELG +LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RR
Sbjct  61   QSCYELSAEYESTLNPEKLEELGKMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRR  120

Query  417  RQKLKKGDFVDENSAITESDI  479
            R KLKKGDF DENSA TESDI
Sbjct  121  RIKLKKGDFADENSATTESDI  141



>ref|XP_004243288.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum lycopersicum]
Length=964

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            +R +EKMASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQDLHGE++RETVQ+CYE
Sbjct  2    SRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDCYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYEG+HDP KLEELG++LTSLD GDSIV+ K+FS+MLNL NLAEEVQIAYRRR KLK
Sbjct  62   LSAEYEGKHDPHKLEELGSMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKLK  121

Query  432  KGDFVDENSAITESDI  479
            K DF DE SA+TESDI
Sbjct  122  KRDFSDEASALTESDI  137



>dbj|BAC20364.1| phosphoenolpyruvate carboxylase [Lotus japonicus]
Length=961

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE 
Sbjct  1    MANRNLEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEV  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HD +KLEELG V+TSLD GDSIV+AKSFSHMLNLANLAEEVQI+ RRR K
Sbjct  61   YELSAEYERKHDHEKLEELGKVITSLDAGDSIVVAKSFSHMLNLANLAEEVQISRRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDF DEN+A TESDI
Sbjct  121  LKKGDFADENNATTESDI  138



>gb|AAK58637.1|AF271163_1 phosphoenolpyruvate carboxylase isoform 3 [Hydrilla verticillata]
Length=970

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 3/140 (2%)
 Frame = +3

Query  69   AARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  239
             ARN   LE+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFL+ILQDLHGE+LRETVQ
Sbjct  4    TARNPNHLERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLEILQDLHGEDLRETVQ  63

Query  240  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  419
             CYELSAEYE   DP+KLEELGN+LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RRR
Sbjct  64   SCYELSAEYESTLDPQKLEELGNMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRRR  123

Query  420  QKLKKGDFVDENSAITESDI  479
             KLKKGDF DENSA TESDI
Sbjct  124  IKLKKGDFADENSAATESDI  143



>ref|XP_004489030.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Cicer arietinum]
Length=966

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ETVQE YELSA
Sbjct  5    MEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEVYELSA  64

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE  +DPKKLEELGN++TSLD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLKKGD
Sbjct  65   EYERNYDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLKKGD  124

Query  441  FVDENSAITESDI  479
            FVDEN+A TESDI
Sbjct  125  FVDENNATTESDI  137



>gb|AAK58635.2|AF271161_1 phosphoenolpyruvate carboxylase isoform 1 [Hydrilla verticillata]
Length=970

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 124/140 (89%), Gaps = 3/140 (2%)
 Frame = +3

Query  69   AARN---LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQ  239
             ARN   LE+MAS+DAQLR+L P KVSEDD LVEYDALLLDRFL+ILQDLHGE+LRETVQ
Sbjct  4    TARNPNHLERMASVDAQLRMLAPSKVSEDDNLVEYDALLLDRFLEILQDLHGEDLRETVQ  63

Query  240  ECYELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR  419
             CYELSAEYE   DP+KLEELGN+LTSLDPGDSIV+A SFSHMLNL NLAEEVQIA+RRR
Sbjct  64   SCYELSAEYESTLDPQKLEELGNMLTSLDPGDSIVVASSFSHMLNLGNLAEEVQIAFRRR  123

Query  420  QKLKKGDFVDENSAITESDI  479
             KLKKGDF DENSA TESDI
Sbjct  124  IKLKKGDFADENSAATESDI  143



>gb|AAD45696.1|AF159051_1 phosphoenolpyruvate carboxylase [Picea abies]
Length=955

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  90   MASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYE  269
            MASIDAQ+RLLVPGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQECYE S EYE
Sbjct  1    MASIDAQMRLLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDIREMVQECYERSGEYE  60

Query  270  GRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVD  449
            G++DP KLEELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQIAYRRR K+K+G F D
Sbjct  61   GKNDPHKLEELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQIAYRRRNKIKRGGFAD  120

Query  450  ENSAITESDI  479
            E++A TESDI
Sbjct  121  ESNATTESDI  130



>ref|XP_004970018.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Setaria italica]
 ref|XP_004970019.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Setaria italica]
Length=969

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA   ++K  SIDAQLRLL P K+SEDDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  4    MARNAVDKATSIDAQLRLLAPQKLSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  63

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  64   YELAAEYESKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  123

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  124  LKKGDFVDENSATTESDI  141



>ref|XP_010413019.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Camelina sativa]
Length=894

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  +  KLEELGN+LTSLDPGDSIV+ K+FS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTDKLEELGNMLTSLDPGDSIVVTKAFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>ref|XP_010508551.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Camelina sativa]
Length=963

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAARNLEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  +  KLEELGN+LTSLDPGDSIV+ K+FS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTDKLEELGNMLTSLDPGDSIVVTKAFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>ref|XP_010527380.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Tarenaya hassleriana]
Length=967

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 127/139 (91%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MAAR LEKMASIDAQLR LVP KVSEDDKLVEYDALLLDRFLDILQDLHGE+LRETVQE 
Sbjct  1    MAARKLEKMASIDAQLRQLVPVKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YELSAEYE +HDPKKLEELGNVLT+LDPGD+IVI+K+FSHMLNLANLAE+VQIAY R+ +
Sbjct  61   YELSAEYERKHDPKKLEELGNVLTNLDPGDAIVISKAFSHMLNLANLAEKVQIAYLRKIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KL K  F DENSA TESDI
Sbjct  121  KLTKRGFADENSATTESDI  139



>gb|AAU07998.1| phosphoenolpyruvate carboxylase 3 [Lupinus albus]
Length=968

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  75   RNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYEL  254
            RN+EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+ TVQ+ YEL
Sbjct  5    RNMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKNTVQDVYEL  64

Query  255  SAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKK  434
            S+EYEG+HDPKKLEE+GN +TSLD GDSIV+AKSFSHMLNLANLAEEVQI++RRR KLKK
Sbjct  65   SSEYEGKHDPKKLEEIGNAITSLDAGDSIVVAKSFSHMLNLANLAEEVQISHRRRNKLKK  124

Query  435  GDFVDENSAITESDI  479
            G+F DE +A TESDI
Sbjct  125  GNFADETNATTESDI  139



>sp|P29193.1|CAPP1_SACHY RecName: Full=Phosphoenolpyruvate carboxylase, housekeeping isozyme; 
Short=PEPC; Short=PEPCase [Saccharum sp.]
 pir||S28614 phosphoenolpyruvate carboxylase (EC 4.1.1.31) - sugarcane hybrid 
H32-8560
 gb|AAC33164.1| phosphoenolpyruvate carboxylase [Saccharum hybrid cultivar H32-8560]
Length=966

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA   ++K  SIDAQLRLL P K+S+DDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAVDKATSIDAQLRLLAPQKLSDDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YELAAEYENKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSATTESDI  138



>ref|XP_008655339.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 ref|XP_008655340.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 ref|XP_008655341.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 gb|AFW85037.1| hypothetical protein ZEAMMB73_388983 [Zea mays]
 gb|AFW85038.1| hypothetical protein ZEAMMB73_388983 [Zea mays]
Length=966

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA   ++K  SIDAQLRLL P K+S+DDKLVEYDALLLDRFLDILQDLHGE++RETVQEC
Sbjct  1    MARNAVDKATSIDAQLRLLAPQKLSDDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YEL+AEYE + DPK L+E+GNVLTSLDPGDSIVI KSFSHML LANLAEEVQIAYRRR K
Sbjct  61   YELAAEYENKLDPKMLDEIGNVLTSLDPGDSIVITKSFSHMLILANLAEEVQIAYRRRIK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDENSA TESDI
Sbjct  121  LKKGDFVDENSATTESDI  138



>gb|EYU41129.1| hypothetical protein MIMGU_mgv1a000842mg [Erythranthe guttata]
Length=966

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            +R LEKMASIDAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+ +RETVQ+CYE
Sbjct  2    SRKLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGDEIRETVQDCYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            +SAEYEG+ DP+KLEELG VLTSLD GDSIV+AKSFS+ML LANLAEEVQIAYRRR KLK
Sbjct  62   ISAEYEGKRDPQKLEELGRVLTSLDAGDSIVVAKSFSNMLTLANLAEEVQIAYRRRIKLK  121

Query  432  KGDFVDENSAITESDI  479
            K DF DE SA TES+I
Sbjct  122  KNDFSDEASATTESNI  137



>ref|NP_001105438.1| phosphoenolpyruvate carboxylase 2 [Zea mays]
 sp|P51059.1|CAPP2_MAIZE RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2 [Zea mays]
 emb|CAA43709.1| phosphoenolpyruvate carboxylase [Zea mays]
Length=967

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++A
Sbjct  8    MERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVAA  67

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE +HD +KL+ELG ++TSLDPGDSIVIAKS SHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  68   EYETKHDLQKLDELGKMITSLDPGDSIVIAKSLSHMLNLANLAEEVQIAYRRRIKLKKGD  127

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  128  FADENSAITESDI  140



>ref|XP_004956559.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Setaria italica]
Length=967

 Score =   229 bits (583),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +3

Query  78   NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  257
             +E+++SIDAQLR+LVPGKVSEDDKL+EYDALLLDRFLDILQDLHG++L+E VQECYE++
Sbjct  7    KVERLSSIDAQLRMLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGDDLKEMVQECYEVA  66

Query  258  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG  437
            AEYE +HD +KL+ELG ++TSLDPGDSIV+AK+FSHMLNLANLAEEVQIAYRRR KLKKG
Sbjct  67   AEYETKHDLQKLDELGKMITSLDPGDSIVMAKAFSHMLNLANLAEEVQIAYRRRIKLKKG  126

Query  438  DFVDENSAITESDI  479
            DF DENSAITESDI
Sbjct  127  DFADENSAITESDI  140



>gb|EPS65212.1| hypothetical protein M569_09565, partial [Genlisea aurea]
Length=289

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +EK AS+DAQLRLL PGKVSEDDKLVEYDALLLDRFLDILQDLHG+ +RETVQ+CYE+ A
Sbjct  5    IEKTASMDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGDEIRETVQDCYEICA  64

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EY+ + DP+KL+ELG VLT LDPGDSIV+AKSFS+MLNLANLAEEVQIA RRR KLKK D
Sbjct  65   EYQRKRDPRKLDELGEVLTGLDPGDSIVVAKSFSNMLNLANLAEEVQIASRRRIKLKKND  124

Query  441  FVDENSAITESDI  479
            F DE SA TESD+
Sbjct  125  FSDEASATTESDL  137



>emb|CAB59571.1| phosphoenolpyruvate carboxylase [Vanilla planifolia]
Length=335

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +3

Query  96   SIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEGR  275
            SIDAQLRLL P KVSEDDKLVEY ALLLDRFLDILQDLHGE +RETVQE YELSAEYE +
Sbjct  1    SIDAQLRLLAPAKVSEDDKLVEYVALLLDRFLDILQDLHGEVVRETVQELYELSAEYESK  60

Query  276  HDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDEN  455
            HDPKKL+ELGN+L SLDPG+SIVIA SFSHMLNLANLAEEVQIA+RRR KLKKGDF DE 
Sbjct  61   HDPKKLDELGNLLISLDPGNSIVIASSFSHMLNLANLAEEVQIAFRRRIKLKKGDFADEA  120

Query  456  SAITESDI  479
            SA TESD 
Sbjct  121  SATTESDF  128



>ref|XP_003596385.1| Phosphoenolpyruvate-carboxylase [Medicago truncatula]
 gb|AES66636.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  +EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYE +HDPKKLEELGN++TS D GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYERKHDPKKLEELGNLITSFDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DE++A TESDI
Sbjct  122  KGDFRDESNATTESDI  137



>sp|Q02735.1|CAPP_MEDSA RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Medicago sativa]
 gb|AAB46618.1| phosphoenolpyruvate carboxylase [Medicago sativa]
 gb|AAB41903.1| phosphoenolpyruvate carboxylase [Medicago sativa]
Length=966

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  +EKMASIDAQLR LVP KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYE +HDPKKLEELGN++TS D GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYERKHDPKKLEELGNLITSFDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DE++A TESDI
Sbjct  122  KGDFRDESNATTESDI  137



>gb|KFK37112.1| hypothetical protein AALP_AA4G214300 [Arabis alpina]
Length=963

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R+LEKMASIDAQLRLL PGKVSEDDKL+EYDALLLDRFLDILQDLHGE++RE VQEC
Sbjct  1    MAGRSLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>ref|XP_008781416.1| PREDICTED: LOW QUALITY PROTEIN: SCAR-like protein 2 [Phoenix 
dactylifera]
Length=2296

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  66    MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
             M+  +LE+ AS+DAQLRLL PGKVSEDD LVEYDALLLDRFLDILQDLHGEN+RETVQEC
Sbjct  1332  MSKNSLERHASVDAQLRLLAPGKVSEDDMLVEYDALLLDRFLDILQDLHGENIRETVQEC  1391

Query  246   YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
             YELSAEY  + D KKL+ELGN LTSLDPGDSIV+A SFSHMLNLANLAEEVQIA+RRR K
Sbjct  1392  YELSAEYGRKQDLKKLDELGNELTSLDPGDSIVVASSFSHMLNLANLAEEVQIAHRRRIK  1451

Query  426   LKKGDFVDENSAITESDI  479
             LKKGDF DENSA TESDI
Sbjct  1452  LKKGDFADENSAPTESDI  1469



>gb|EMT08272.1| Phosphoenolpyruvate carboxylase 2 [Aegilops tauschii]
Length=972

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD  132

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  133  FADENSAITESDI  145



>dbj|BAJ97144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=972

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD  132

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  133  FADENSAITESDI  145



>dbj|BAJ85327.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=972

 Score =   226 bits (576),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD  132

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  133  FADENSAITESDI  145



>emb|CAA07610.1| phospoenolpyruvate carboxylase [Triticum aestivum]
Length=972

 Score =   226 bits (576),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  81   LEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSA  260
            +E+++SIDAQLRLLVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECYE++A
Sbjct  13   IERLSSIDAQLRLLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECYEVAA  72

Query  261  EYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGD  440
            EYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKGD
Sbjct  73   EYETKHDLEKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVKLKKGD  132

Query  441  FVDENSAITESDI  479
            F DENSAITESDI
Sbjct  133  FADENSAITESDI  145



>dbj|BAJ33978.1| unnamed protein product [Thellungiella halophila]
Length=740

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 126/139 (91%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA  NL+KMASIDAQLRL+ PGKVSEDDKLVEYDALLLDRFLDILQDLHGE +RE VQEC
Sbjct  1    MATGNLKKMASIDAQLRLIAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEEVREFVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE++A+Y+G  + +KLEELGN+LTSLDPGDSIV+ KSFS+ML+LANLAEEVQIAYRRR +
Sbjct  61   YEVAADYDGNRNTEKLEELGNMLTSLDPGDSIVVTKSFSNMLSLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DE SA TESDI
Sbjct  121  KLKKGDFADEASATTESDI  139



>gb|AEG78834.1| phosphoenolpyruvate carboxylase [Dendrobium catenatum]
Length=964

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            ++ +EKMAS+DA LRLL PGKVSEDDKLVEYDALLLDRFL+I+QDLHGEN+RETVQECYE
Sbjct  2    SKGVEKMASMDAHLRLLAPGKVSEDDKLVEYDALLLDRFLEIVQDLHGENIRETVQECYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYE +HD KKL+ELG+VLT LDPGDSIV+A SFSHMLNL+NLAEEVQIA RRR K K
Sbjct  62   LSAEYERKHDSKKLDELGSVLTGLDPGDSIVVASSFSHMLNLSNLAEEVQIATRRRIKPK  121

Query  432  KGDFVDENSAITESD  476
            KGDF DE SA TESD
Sbjct  122  KGDFADEASATTESD  136



>ref|XP_003577980.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Brachypodium distachyon]
Length=968

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  69   AARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECY  248
            A   +E+++SIDAQLR+LVP KVSEDDKL+EYDALLLDRFLD+LQ LHG++LRE VQECY
Sbjct  5    APGKIERLSSIDAQLRMLVPAKVSEDDKLIEYDALLLDRFLDVLQGLHGDDLREMVQECY  64

Query  249  ELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKL  428
            E++AEYE +HD +KL+ELG ++TSLDPGDSIVIAK+FSHMLNLANLAEEVQIAYRRR KL
Sbjct  65   EVAAEYETKHDLQKLDELGEMITSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKL  124

Query  429  KKGDFVDENSAITESDI  479
            KKGDF +ENSAITESDI
Sbjct  125  KKGDFAEENSAITESDI  141



>dbj|BAF80187.1| phosphoenolpyruvate carboxylase [Aloe arborescens]
Length=964

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 125/139 (90%), Gaps = 2/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA R +EK+ASIDAQLR L P KVSEDDKLVEYDALLLDRFL+IL+DLHGE++RETVQ C
Sbjct  1    MATR-VEKLASIDAQLRALAPKKVSEDDKLVEYDALLLDRFLEILEDLHGEDIRETVQAC  59

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE +HDPKKL+ELGNVLTSLDPGDSIV+A SFSHMLNLANLAEEVQ AYRR+ K
Sbjct  60   YELSAEYEAKHDPKKLDELGNVLTSLDPGDSIVVASSFSHMLNLANLAEEVQTAYRRKIK  119

Query  426  L-KKGDFVDENSAITESDI  479
            L KKGDF+DE  A TESDI
Sbjct  120  LNKKGDFLDEACATTESDI  138



>ref|XP_006348299.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=964

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDIL+DLHGE ++ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPTKVSEDDKLVEYDALLLDRFLDILEDLHGEGIKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE   D KKLEELG+VLTSLDPGDSIV+AKS SHMLN+ANLAEEVQIA   R+K
Sbjct  61   YELSAEYENTRDKKKLEELGSVLTSLDPGDSIVVAKSISHMLNMANLAEEVQIANSGREK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGDF DE++ +TESDI
Sbjct  121  SKKGDFSDESNLMTESDI  138



>gb|AHF21553.1| phosphoenolpyruvate carboxylase [Hylocereus undatus]
Length=958

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA   LEK+ASIDAQLRLL P KVSEDDKLVEYDALLLDRFLDILQ LHGE++RETVQE 
Sbjct  1    MATAKLEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQSLHGEDIRETVQEL  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YE +AEYE   DPKKLEELGN++TSLD GDSIV+ KSF+HMLNLANLAEEVQIA+RRR +
Sbjct  61   YEHAAEYERTRDPKKLEELGNMITSLDAGDSIVVTKSFTHMLNLANLAEEVQIAHRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDFVDE+SAITESDI
Sbjct  121  KLKKGDFVDESSAITESDI  139



>sp|P51062.1|CAPP_PEA RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Pisum sativum]
 dbj|BAA10902.1| phosphoenolpyruvate carboxylase [Pisum sativum]
Length=967

 Score =   223 bits (569),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYE +HDPKKLEELG ++T LD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYERKHDPKKLEELGKLITGLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DE++A TESDI
Sbjct  122  KGDFRDESNATTESDI  137



>emb|CAA09588.1| phosphoenolpyruvate-carboxylase [Vicia faba]
Length=966

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  72   ARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYE  251
            A  +EKMASIDAQLR L P KVSEDDKL+EYDALLLDRFLDILQDLHGE+L+++VQE YE
Sbjct  2    ANKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYE  61

Query  252  LSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLK  431
            LSAEYE +HDPKKLEELG ++T LD GDSIV+AKSFSHMLNLANLAEEVQIA+RRR KLK
Sbjct  62   LSAEYERKHDPKKLEELGKLITGLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLK  121

Query  432  KGDFVDENSAITESDI  479
            KGDF DE++A TES+I
Sbjct  122  KGDFRDESNATTESNI  137



>emb|CAA09807.1| ppc2 [Solanum tuberosum]
Length=964

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA RNLEK+ASIDAQLRLLVP KVSEDDKLVEYDALLLDRFLDIL+ LHGE ++ETVQEC
Sbjct  1    MATRNLEKLASIDAQLRLLVPTKVSEDDKLVEYDALLLDRFLDILEGLHGEGIKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YELSAEYE   D KKLEELG+VLTSLDPGDSIV+AKS SHMLN+ANLAEEVQIA   R+K
Sbjct  61   YELSAEYENTRDKKKLEELGSVLTSLDPGDSIVVAKSISHMLNMANLAEEVQIANSGREK  120

Query  426  LKKGDFVDENSAITESDI  479
             KKGDF DE++ +TESDI
Sbjct  121  SKKGDFSDESNLMTESDI  138



>dbj|BAC19851.1| phosphoenolpyruvate carboxylase [Eleocharis vivipara]
Length=968

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            MA +N+EK+ASIDA LRLL P KVSEDDKLVEYDALLLDRFLDILQ LHGE+L+ETVQEC
Sbjct  1    MATKNVEKLASIDAHLRLLAPKKVSEDDKLVEYDALLLDRFLDILQALHGEDLKETVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRR-Q  422
            YEL+AEYE   D  KL+ELGNVL SLD GDSIV+AKSFSHMLNLANLAEEVQIAYRRR +
Sbjct  61   YELAAEYEKNLDQAKLDELGNVLMSLDAGDSIVLAKSFSHMLNLANLAEEVQIAYRRRIK  120

Query  423  KLKKGDFVDENSAITESDI  479
            KLKKGDF DENSA TESD+
Sbjct  121  KLKKGDFGDENSATTESDL  139



>ref|XP_009404506.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404507.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=964

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  66   MAARNLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQEC  245
            M+  ++E+ ASIDAQLRLL PGKVSEDDKLVEYDALL+DRFLDILQ LHGE+LR+TVQEC
Sbjct  1    MSRYSMERHASIDAQLRLLAPGKVSEDDKLVEYDALLVDRFLDILQSLHGEDLRDTVQEC  60

Query  246  YELSAEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQK  425
            YE+SA+YEG  D  KL+ELG+VL SLDPGDSI++A SFSHMLNL NLAEEVQIA+RRR K
Sbjct  61   YEISAKYEGTRDLSKLDELGHVLMSLDPGDSILVASSFSHMLNLGNLAEEVQIAHRRRNK  120

Query  426  LKKGDFVDENSAITESDI  479
            LKKGDFVDE++A TESDI
Sbjct  121  LKKGDFVDESNATTESDI  138



>emb|CAA60627.1| phosphoenolpyruvate-carboxylase [Vanilla planifolia]
Length=956

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +3

Query  93   ASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELSAEYEG  272
            +SIDAQLRLL P KVSEDDKLVEY  LLLDRFLDILQDLHGE +RETVQE YELSAEYE 
Sbjct  3    SSIDAQLRLLAPAKVSEDDKLVEYVRLLLDRFLDILQDLHGEVVRETVQELYELSAEYES  62

Query  273  RHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKGDFVDE  452
            +HDPKKL+ELGN+L SLDPG+SIVIA SFSHMLNLANLAEEVQIA+RRR KLKKGDFVDE
Sbjct  63   KHDPKKLDELGNLLISLDPGNSIVIASSFSHMLNLANLAEEVQIAHRRRIKLKKGDFVDE  122

Query  453  NSAITESDI  479
            NSA TESDI
Sbjct  123  NSATTESDI  131



>ref|XP_006660531.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Oryza brachyantha]
Length=970

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  78   NLEKMASIDAQLRLLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGENLRETVQECYELS  257
             +E+++SIDAQLRLLVP K+SEDDKL+EYDALLLDRFLD+L  LHG++L+E VQECYE++
Sbjct  10   KVERLSSIDAQLRLLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHGDDLKEMVQECYEVA  69

Query  258  AEYEGRHDPKKLEELGNVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRQKLKKG  437
            AEYE +HD +KL+ELGN++TSLD GDSIVIAK+FSHMLNLANLAEEVQIAYRRR KLKKG
Sbjct  70   AEYETKHDLQKLDELGNMITSLDAGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIKLKKG  129

Query  438  DFVDENSAITESDI  479
            DF DENSAITESDI
Sbjct  130  DFADENSAITESDI  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140