BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS150G01

Length=210
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596448.1|  PREDICTED: mitochondrial chaperone BCS1-like     67.0    5e-11   Nicotiana tomentosiformis
ref|XP_009794987.1|  PREDICTED: mitochondrial chaperone BCS1-like     67.0    5e-11   Nicotiana sylvestris
ref|XP_004230008.1|  PREDICTED: probable mitochondrial chaperone ...  61.2    6e-09   Solanum lycopersicum
ref|XP_011093096.1|  PREDICTED: probable mitochondrial chaperone ...  56.6    2e-07   Sesamum indicum [beniseed]
ref|XP_011094241.1|  PREDICTED: probable mitochondrial chaperone ...  52.8    4e-06   Sesamum indicum [beniseed]
gb|EYU38871.1|  hypothetical protein MIMGU_mgv1a005433mg              47.0    5e-04   Erythranthe guttata [common monkey flower]



>ref|XP_009596448.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana tomentosiformis]
Length=492

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  196  ADEQGCATWKDTVPVAKEFRKLYGLLRMKSAKRSEPLDHDLESIQR  59
            A+E G   WKD+VPVAKEFRKLYGLLR+KS K+    DHD E I+R
Sbjct  447  AEETGGVNWKDSVPVAKEFRKLYGLLRLKSCKKPGSFDHDSEMIER  492



>ref|XP_009794987.1| PREDICTED: mitochondrial chaperone BCS1-like [Nicotiana sylvestris]
Length=492

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  196  ADEQGCATWKDTVPVAKEFRKLYGLLRMKSAKRSEPLDHDLESIQR  59
            A+E G   WKD+VPVAKEFRKLYGLLRMKS K+ +  D D E I+R
Sbjct  447  AEETGGVNWKDSVPVAKEFRKLYGLLRMKSCKKPDSFDQDSEMIER  492



>ref|XP_004230008.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Solanum lycopersicum]
Length=491

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -3

Query  205  PISADEQGCATWKDTVPVAKEFRKLYGLLRMKSAKRSEPLDHDLESIQR  59
            P  A+E G A WKD+VP AKE RKLYGLLR+KS K     DHD   I+R
Sbjct  443  PPHAEETGGANWKDSVPGAKEVRKLYGLLRLKSCKSPSSFDHDPGMIER  491



>ref|XP_011093096.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Sesamum indicum]
Length=468

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -3

Query  205  PISADEQGCATWKDTVPVAKEFRKLYGLLRMKSAKRSEPLDHDLESIQR  59
            P  ++E G   WK+TV V KEFRKLYGLLR+KS +R+  LDHD E  +R
Sbjct  421  PAMSEESGGVDWKETV-VPKEFRKLYGLLRLKSCRRAGSLDHDSEISER  468



>ref|XP_011094241.1| PREDICTED: probable mitochondrial chaperone BCS1-A [Sesamum indicum]
Length=478

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 2/46 (4%)
 Frame = -3

Query  196  ADEQGCATWKDTVPVAKEFRKLYGLLRMKSAKRSEPLDHDLESIQR  59
            A++ G   WK+T+P  KEFRKLYGLLR+KS KR   +D D E I+R
Sbjct  435  AEDAGGTAWKETMP--KEFRKLYGLLRLKSCKRPVSIDDDCEMIER  478



>gb|EYU38871.1| hypothetical protein MIMGU_mgv1a005433mg [Erythranthe guttata]
Length=484

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 3/39 (8%)
 Frame = -3

Query  172  WKDTVPVAKEFRKLYGLLRMKSAKRSEPLD-HDLESIQR  59
            WK+ VP  KEFRKLYGLLR+KS +    LD HD E IQR
Sbjct  448  WKEAVP--KEFRKLYGLLRLKSCRTPGSLDQHDSEMIQR  484



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557943594040