BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS149D12

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    187   1e-51   Sesamum indicum [beniseed]
gb|KDO78340.1|  hypothetical protein CISIN_1g004125mg                   179   1e-49   Citrus sinensis [apfelsine]
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    181   2e-49   Nicotiana tomentosiformis
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    181   2e-49   Solanum lycopersicum
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    180   2e-49   Nicotiana sylvestris
gb|KDO78339.1|  hypothetical protein CISIN_1g004125mg                   179   4e-49   Citrus sinensis [apfelsine]
ref|XP_006449786.1|  hypothetical protein CICLE_v10014589mg             179   5e-49   
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                179   6e-49   Erythranthe guttata [common monkey flower]
ref|XP_006449787.1|  hypothetical protein CICLE_v10014589mg             178   7e-49   
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    178   1e-48   Citrus sinensis [apfelsine]
emb|CDP04437.1|  unnamed protein product                                177   3e-48   Coffea canephora [robusta coffee]
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    177   3e-48   Solanum tuberosum [potatoes]
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    177   3e-48   Sesamum indicum [beniseed]
gb|EPS60017.1|  hypothetical protein M569_14787                         174   5e-47   Genlisea aurea
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             172   1e-46   Prunus persica
ref|XP_002518432.1|  conserved hypothetical protein                     172   2e-46   
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    172   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             172   3e-46   Phaseolus vulgaris [French bean]
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    172   4e-46   Prunus mume [ume]
ref|XP_003610472.1|  Membrane protein, putative                         172   4e-46   Medicago truncatula
ref|XP_010921304.1|  PREDICTED: calcium permeable stress-gated ca...    171   6e-46   Elaeis guineensis
ref|XP_007026163.1|  ERD (early-responsive to dehydration stress)...    169   8e-46   
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    171   8e-46   
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    170   1e-45   Elaeis guineensis
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    170   1e-45   Cicer arietinum [garbanzo]
ref|XP_010099166.1|  Uncharacterized membrane protein                   170   2e-45   Morus notabilis
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          170   2e-45   
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    170   2e-45   Glycine max [soybeans]
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                169   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_007026162.1|  ERD (early-responsive to dehydration stress)...    168   3e-45   
ref|XP_006843810.1|  hypothetical protein AMTR_s00007p00254340          169   3e-45   Amborella trichopoda
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    169   4e-45   Phoenix dactylifera
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    168   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    168   5e-45   
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             168   6e-45   Nelumbo nucifera [Indian lotus]
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    171   8e-45   Populus euphratica
gb|EPS71959.1|  hypothetical protein M569_02795                         168   8e-45   Genlisea aurea
ref|XP_004145433.1|  PREDICTED: uncharacterized membrane protein ...    167   9e-45   Cucumis sativus [cucumbers]
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    167   1e-44   Cucumis melo [Oriental melon]
ref|XP_004166876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    167   1e-44   
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             167   1e-44   Tarenaya hassleriana [spider flower]
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             167   2e-44   Nicotiana sylvestris
gb|KDO54267.1|  hypothetical protein CISIN_1g018945mg                   159   2e-44   Citrus sinensis [apfelsine]
ref|XP_002317144.2|  early-responsive to dehydration family protein     166   3e-44   
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             166   3e-44   Solanum lycopersicum
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    166   3e-44   Nicotiana tomentosiformis
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...    166   5e-44   Populus euphratica
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g             166   6e-44   
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             165   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...    165   7e-44   Populus euphratica
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    165   7e-44   Nicotiana sylvestris
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    165   7e-44   Glycine max [soybeans]
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             165   7e-44   Nicotiana tomentosiformis
ref|XP_006850790.1|  hypothetical protein AMTR_s00025p00102970          165   8e-44   Amborella trichopoda
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    167   1e-43   Populus euphratica
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    164   2e-43   Solanum tuberosum [potatoes]
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             164   2e-43   Eutrema salsugineum [saltwater cress]
gb|KHN28986.1|  Putative membrane protein C2G11.09                      164   2e-43   Glycine soja [wild soybean]
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    164   2e-43   Glycine max [soybeans]
gb|EMS56195.1|  hypothetical protein TRIUR3_24213                       153   2e-43   Triticum urartu
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    164   2e-43   Prunus mume [ume]
gb|KDO54265.1|  hypothetical protein CISIN_1g018945mg                   158   2e-43   Citrus sinensis [apfelsine]
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    164   2e-43   Fragaria vesca subsp. vesca
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    164   2e-43   
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    164   2e-43   
ref|NP_172660.5|  putative ERD4 protein                                 164   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    164   2e-43   Fragaria vesca subsp. vesca
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    164   2e-43   
gb|KJB69237.1|  hypothetical protein B456_011G012200                    162   2e-43   Gossypium raimondii
gb|KJB57786.1|  hypothetical protein B456_009G181100                    164   2e-43   Gossypium raimondii
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             164   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010924082.1|  PREDICTED: calcium permeable stress-gated ca...    163   3e-43   Elaeis guineensis
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    164   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            164   3e-43   
ref|XP_010905258.1|  PREDICTED: protein OSCA1-like                      163   3e-43   Elaeis guineensis
gb|KDO54266.1|  hypothetical protein CISIN_1g018945mg                   158   3e-43   Citrus sinensis [apfelsine]
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             163   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010449935.1|  PREDICTED: CSC1-like protein At4g15430             154   4e-43   
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...    163   4e-43   Elaeis guineensis
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             163   4e-43   Capsella rubella
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    163   4e-43   
gb|KHG30770.1|  putative membrane C2G11.09                              163   4e-43   Gossypium arboreum [tree cotton]
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...    163   4e-43   
dbj|BAF98597.1|  CM0545.360.nc                                          163   4e-43   Lotus japonicus
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    163   5e-43   Populus euphratica
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    163   5e-43   Populus euphratica
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    163   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...    162   6e-43   
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    163   6e-43   Populus euphratica
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...    163   6e-43   Populus euphratica
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...    162   6e-43   Elaeis guineensis
ref|XP_003616997.1|  Transmembrane protein                              162   7e-43   Medicago truncatula
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6           162   7e-43   
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             162   7e-43   
ref|XP_006383870.1|  early-responsive to dehydration family protein     162   8e-43   
emb|CDX98089.1|  BnaA06g08400D                                          162   8e-43   
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             162   8e-43   Brassica rapa
gb|KJB69239.1|  hypothetical protein B456_011G012200                    162   8e-43   Gossypium raimondii
gb|KJB69236.1|  hypothetical protein B456_011G012200                    162   8e-43   Gossypium raimondii
dbj|BAD94445.1|  hypothetical protein                                   162   8e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30043.1|  BnaC05g09770D                                          162   9e-43   Brassica napus [oilseed rape]
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    162   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    162   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    162   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    162   1e-42   Solanum tuberosum [potatoes]
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             161   1e-42   Solanum lycopersicum
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             161   2e-42   Vitis vinifera
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             161   2e-42   Populus euphratica
emb|CBI32349.3|  unnamed protein product                                161   2e-42   Vitis vinifera
ref|XP_009395092.1|  PREDICTED: calcium permeable stress-gated ca...    161   2e-42   
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             161   2e-42   Populus euphratica
emb|CDX79125.1|  BnaA01g11920D                                          160   2e-42   
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             161   2e-42   Prunus persica
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             161   3e-42   Prunus persica
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       160   3e-42   Cicer arietinum [garbanzo]
ref|XP_002321139.1|  early-responsive to dehydration family protein     160   4e-42   Populus trichocarpa [western balsam poplar]
emb|CDX82907.1|  BnaC01g13570D                                          160   4e-42   
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    160   4e-42   Glycine max [soybeans]
gb|KDO68802.1|  hypothetical protein CISIN_1g015063mg                   157   4e-42   Citrus sinensis [apfelsine]
gb|KHG01808.1|  putative membrane C2G11.09                              160   4e-42   Gossypium arboreum [tree cotton]
ref|XP_009771290.1|  PREDICTED: CSC1-like protein At4g02900             159   4e-42   Nicotiana sylvestris
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    160   4e-42   Brassica rapa
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    160   5e-42   
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             159   7e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    159   8e-42   Nicotiana tomentosiformis
emb|CDY27443.1|  BnaC03g64830D                                          160   8e-42   Brassica napus [oilseed rape]
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             159   8e-42   Nicotiana tomentosiformis
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    159   1e-41   Solanum tuberosum [potatoes]
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             159   1e-41   Citrus clementina [clementine]
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             159   1e-41   Eucalyptus grandis [rose gum]
ref|XP_009404922.1|  PREDICTED: calcium permeable stress-gated ca...    159   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB69243.1|  hypothetical protein B456_011G012200                    159   1e-41   Gossypium raimondii
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    159   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    158   3e-41   Glycine max [soybeans]
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    158   3e-41   
gb|KHN38468.1|  Putative membrane protein C2G11.09                      158   3e-41   Glycine soja [wild soybean]
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             158   4e-41   Citrus clementina [clementine]
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      158   4e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...    157   4e-41   
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    157   5e-41   
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg             157   5e-41   
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    157   6e-41   Eucalyptus grandis [rose gum]
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             157   6e-41   
ref|XP_002886475.1|  F24O1.4                                            157   7e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             157   7e-41   Phaseolus vulgaris [French bean]
ref|XP_010278611.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    155   8e-41   
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg             157   9e-41   
emb|CAA18115.1|  putative protein                                       156   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    155   1e-40   
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             156   1e-40   Eucalyptus grandis [rose gum]
ref|XP_006287198.1|  hypothetical protein CARUB_v10000374mg             154   1e-40   
dbj|BAD93792.1|  hypothetical protein                                   156   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    155   2e-40   
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    155   2e-40   Nelumbo nucifera [Indian lotus]
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    155   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    155   2e-40   
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    155   2e-40   Solanum tuberosum [potatoes]
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    155   2e-40   
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             155   2e-40   Fragaria vesca subsp. vesca
emb|CDP11354.1|  unnamed protein product                                155   2e-40   Coffea canephora [robusta coffee]
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    155   2e-40   Solanum lycopersicum
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            155   2e-40   Malus domestica [apple tree]
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    155   3e-40   Phoenix dactylifera
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             155   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             155   3e-40   Brassica rapa
emb|CDY09064.1|  BnaC08g10180D                                          155   3e-40   Brassica napus [oilseed rape]
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    155   3e-40   
ref|XP_002533077.1|  conserved hypothetical protein                     155   3e-40   Ricinus communis
emb|CAB10322.1|  hypothetical protein                                   154   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    155   3e-40   
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             155   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             154   3e-40   
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    155   4e-40   Cucumis melo [Oriental melon]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             155   4e-40   Tarenaya hassleriana [spider flower]
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    155   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    155   5e-40   Brachypodium distachyon [annual false brome]
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    155   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    155   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    155   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    155   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             155   5e-40   Populus euphratica
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             155   5e-40   Capsella rubella
gb|KJB10673.1|  hypothetical protein B456_001G215500                    154   6e-40   Gossypium raimondii
ref|XP_004151944.1|  PREDICTED: uncharacterized protein RSN1-like       154   6e-40   Cucumis sativus [cucumbers]
ref|XP_004158583.1|  PREDICTED: uncharacterized protein RSN1-like       154   6e-40   
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             154   6e-40   
dbj|BAK03311.1|  predicted protein                                      154   7e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    154   7e-40   Cicer arietinum [garbanzo]
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             154   7e-40   
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    154   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    154   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             154   8e-40   
emb|CDY49293.1|  BnaC01g22480D                                          154   9e-40   Brassica napus [oilseed rape]
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    154   9e-40   Fragaria vesca subsp. vesca
gb|EMS66710.1|  Uncharacterized membrane protein C2G11.09               154   9e-40   Triticum urartu
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    154   1e-39   Brassica rapa
emb|CDY48898.1|  BnaA03g36370D                                          154   1e-39   Brassica napus [oilseed rape]
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    154   1e-39   Brassica rapa
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    154   1e-39   Brassica rapa
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             154   1e-39   Camelina sativa [gold-of-pleasure]
emb|CDY22920.1|  BnaA01g18580D                                          154   1e-39   Brassica napus [oilseed rape]
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    154   1e-39   Medicago truncatula
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             154   1e-39   Brassica rapa
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             154   1e-39   Camelina sativa [gold-of-pleasure]
gb|EMT27455.1|  Putative membrane protein                               154   1e-39   
emb|CDY32438.1|  BnaC03g42220D                                          153   1e-39   Brassica napus [oilseed rape]
emb|CDY08641.1|  BnaC04g19500D                                          145   1e-39   Brassica napus [oilseed rape]
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...    154   1e-39   Setaria italica
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    153   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             153   1e-39   Phaseolus vulgaris [French bean]
gb|KDP21496.1|  hypothetical protein JCGZ_21967                         153   1e-39   Jatropha curcas
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             153   1e-39   Capsella rubella
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             153   2e-39   
gb|KDP30779.1|  hypothetical protein JCGZ_13722                         153   2e-39   Jatropha curcas
gb|EMT22148.1|  Putative membrane protein                               153   2e-39   
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    153   2e-39   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK05559.1|  predicted protein                                      153   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    153   2e-39   Oryza brachyantha
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             153   2e-39   Brassica rapa
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             153   2e-39   
emb|CDY17981.1|  BnaC03g30530D                                          153   2e-39   Brassica napus [oilseed rape]
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             153   3e-39   Capsella rubella
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    152   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                152   3e-39   Erythranthe guttata [common monkey flower]
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             152   3e-39   Eutrema salsugineum [saltwater cress]
ref|XP_009765629.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    151   4e-39   Nicotiana sylvestris
gb|KHG17938.1|  putative membrane C2G11.09                              152   4e-39   Gossypium arboreum [tree cotton]
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             152   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_002301612.2|  early-responsive to dehydration family protein     152   4e-39   
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    152   4e-39   
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             152   5e-39   Capsella rubella
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             152   6e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             152   6e-39   Brachypodium distachyon [annual false brome]
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          152   7e-39   Sorghum bicolor [broomcorn]
gb|AAM74515.1|  hv711N16.16                                             144   7e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    151   7e-39   
emb|CDX90914.1|  BnaA03g25940D                                          151   7e-39   
ref|NP_001043256.1|  Os01g0534900                                       151   7e-39   
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    151   7e-39   Brassica rapa
ref|XP_010089460.1|  Uncharacterized membrane protein                   151   8e-39   
emb|CDX76386.1|  BnaA08g10140D                                          150   9e-39   
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    151   1e-38   
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          151   1e-38   Sorghum bicolor [broomcorn]
gb|EMT11783.1|  Putative membrane protein                               151   1e-38   
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               151   1e-38   Triticum urartu
ref|NP_001055457.1|  Os05g0393800                                       151   1e-38   
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    150   1e-38   
gb|EAY97938.1|  hypothetical protein OsI_19855                          150   2e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    150   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    150   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    150   2e-38   Fragaria vesca subsp. vesca
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    150   2e-38   
gb|KHG10946.1|  putative membrane C2G11.09                              150   2e-38   Gossypium arboreum [tree cotton]
dbj|BAJ96091.1|  predicted protein                                      150   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY19541.1|  BnaC09g13620D                                          150   2e-38   Brassica napus [oilseed rape]
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    150   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    150   3e-38   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY12941.1|  BnaA09g13330D                                          150   3e-38   Brassica napus [oilseed rape]
gb|EPS74192.1|  hypothetical protein M569_00556                         149   3e-38   Genlisea aurea
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             149   4e-38   Brassica rapa
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    149   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    149   4e-38   Setaria italica
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       149   4e-38   Setaria italica
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    149   4e-38   Oryza brachyantha
gb|KHN19872.1|  Putative membrane protein C2G11.09                      149   5e-38   Glycine soja [wild soybean]
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             149   6e-38   Eutrema salsugineum [saltwater cress]
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    149   7e-38   Glycine max [soybeans]
ref|XP_002529341.1|  conserved hypothetical protein                     147   1e-37   
ref|XP_010090368.1|  Uncharacterized membrane protein                   149   1e-37   
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          147   2e-37   Sorghum bicolor [broomcorn]
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             147   2e-37   Vitis vinifera
ref|NP_001056508.1|  Os05g0594700                                       147   2e-37   
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    147   3e-37   
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    147   3e-37   
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    147   3e-37   Phoenix dactylifera
gb|KJB42871.1|  hypothetical protein B456_007G171500                    147   3e-37   Gossypium raimondii
gb|KJB42870.1|  hypothetical protein B456_007G171500                    147   3e-37   Gossypium raimondii
gb|AFW81357.1|  HYP1 isoform 1                                          147   4e-37   
ref|NP_001147493.1|  LOC100281102                                       147   4e-37   
gb|EEE64912.1|  hypothetical protein OsJ_19772                          147   4e-37   
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    145   1e-36   
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    145   1e-36   
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    145   1e-36   
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                145   2e-36   
ref|XP_004164564.1|  PREDICTED: uncharacterized membrane protein ...    145   2e-36   
ref|XP_004136187.1|  PREDICTED: uncharacterized membrane protein ...    145   2e-36   
gb|EPS71707.1|  hypothetical protein M569_03051                         144   2e-36   
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             143   6e-36   
emb|CDY32032.1|  BnaA03g60360D                                          143   6e-36   
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             143   6e-36   
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             143   7e-36   
ref|XP_009404947.1|  PREDICTED: calcium permeable stress-gated ca...    142   1e-35   
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      142   1e-35   
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    142   1e-35   
emb|CDX90856.1|  BnaA03g25360D                                          142   2e-35   
emb|CDY21297.1|  BnaC03g29810D                                          142   2e-35   
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             142   2e-35   
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    142   2e-35   
ref|XP_008344855.1|  PREDICTED: uncharacterized protein LOC103407754    137   3e-35   
ref|XP_011082546.1|  PREDICTED: CSC1-like protein At4g02900             140   6e-35   
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    140   6e-35   
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    140   6e-35   
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    140   6e-35   
emb|CDP03600.1|  unnamed protein product                                140   8e-35   
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             140   8e-35   
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             140   9e-35   
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            140   1e-34   
ref|XP_006854105.1|  hypothetical protein AMTR_s00048p00143150          139   2e-34   
gb|KJB42062.1|  hypothetical protein B456_007G134700                    138   2e-34   
gb|KJB42060.1|  hypothetical protein B456_007G134700                    138   2e-34   
gb|KJB42059.1|  hypothetical protein B456_007G134700                    139   3e-34   
ref|XP_006396699.1|  hypothetical protein EUTSA_v10028449mg             137   5e-34   
gb|AAL07154.1|  unknown protein                                         137   7e-34   
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    137   8e-34   
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    137   1e-33   
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    137   2e-33   
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             136   2e-33   
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             136   3e-33   
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               135   4e-33   
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             135   4e-33   
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    134   7e-33   
ref|XP_010518924.1|  PREDICTED: CSC1-like protein At1g32090             134   9e-33   
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             134   2e-32   
ref|XP_008355138.1|  PREDICTED: uncharacterized protein LOC103418807    128   2e-32   
gb|EPS61005.1|  hypothetical protein M569_13796                         126   3e-32   
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090             133   4e-32   
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             132   5e-32   
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             132   7e-32   
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    132   7e-32   
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             132   1e-31   
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       131   1e-31   
emb|CDY35541.1|  BnaA05g16450D                                          131   1e-31   
emb|CDY29933.1|  BnaC05g29030D                                          131   1e-31   
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             131   1e-31   
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             131   1e-31   
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             130   2e-31   
emb|CDP11733.1|  unnamed protein product                                130   3e-31   
gb|KHG26829.1|  putative membrane C2G11.09                              130   3e-31   
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             130   4e-31   
ref|XP_010110413.1|  Uncharacterized protein RSN1                       127   5e-31   
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             129   5e-31   
emb|CDP11732.1|  unnamed protein product                                129   6e-31   
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             129   6e-31   
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            129   6e-31   
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    129   7e-31   
gb|KJB51549.1|  hypothetical protein B456_008G222200                    129   8e-31   
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                129   8e-31   
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             129   9e-31   
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             129   9e-31   
gb|AFI41197.1|  dehydration stress protein                              129   9e-31   
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             128   1e-30   
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             128   2e-30   
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             128   2e-30   
ref|XP_004146108.1|  PREDICTED: uncharacterized membrane protein ...    127   4e-30   
gb|KDP46674.1|  hypothetical protein JCGZ_12198                         127   4e-30   
gb|EMT23208.1|  Putative membrane protein                               127   4e-30   
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             126   8e-30   
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            125   1e-29   
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   125   1e-29   
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             125   1e-29   
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       125   2e-29   
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       125   3e-29   
gb|KHN40403.1|  Putative membrane protein C2G11.09                      125   3e-29   
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    124   4e-29   
gb|KHG01781.1|  putative membrane C2G11.09                              124   5e-29   
ref|XP_003612662.1|  Membrane protein, putative                         124   6e-29   
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    123   8e-29   
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    123   1e-28   
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             122   2e-28   
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    122   3e-28   
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    122   3e-28   
ref|XP_006368323.1|  early-responsive to dehydration family protein     122   3e-28   
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             121   4e-28   
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            121   5e-28   
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             121   6e-28   
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    120   6e-28   
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             120   7e-28   
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             120   7e-28   
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             120   7e-28   
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          120   8e-28   
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             120   1e-27   
dbj|BAK07493.1|  predicted protein                                      117   1e-27   
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              120   1e-27   
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                120   1e-27   
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             119   3e-27   
ref|XP_010054102.1|  PREDICTED: CSC1-like protein At1g32090             119   3e-27   
ref|XP_002519965.1|  Extensin-3 precursor, putative                     117   2e-26   
ref|NP_001065504.1|  Os10g0579100                                       117   2e-26   
gb|EAY79648.1|  hypothetical protein OsI_34792                          117   2e-26   
gb|EMT18085.1|  Putative membrane protein                               115   4e-26   
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               115   8e-26   
emb|CDM81261.1|  unnamed protein product                                115   8e-26   
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             115   9e-26   
gb|EMT13890.1|  Putative membrane protein                               114   1e-25   
gb|EMS50375.1|  Transmembrane protein 63B                               109   5e-24   
ref|XP_001754358.1|  predicted protein                                  107   4e-23   
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    106   7e-23   
gb|EPS60193.1|  hypothetical protein M569_14609                         104   3e-22   
ref|XP_001759032.1|  predicted protein                                  101   5e-21   
ref|XP_001782141.1|  predicted protein                                99.0    3e-20   
ref|XP_001770572.1|  predicted protein                                92.8    4e-18   
ref|XP_001768825.1|  predicted protein                                75.9    6e-13   
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                  73.6    9e-12   
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                  73.6    1e-11   
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  70.9    6e-11   
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...  70.9    6e-11   
gb|KDP20707.1|  hypothetical protein JCGZ_21178                       70.9    7e-11   
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g           70.5    9e-11   
ref|XP_001757556.1|  predicted protein                                69.3    3e-10   
emb|CDY24365.1|  BnaA07g02900D                                        57.0    8e-07   
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    2e-05   
ref|XP_009336442.1|  PREDICTED: CSC1-like protein At3g54510           51.6    1e-04   
ref|XP_010089233.1|  Uncharacterized membrane protein                 50.4    3e-04   
emb|CDX73475.1|  BnaC08g25280D                                        50.4    3e-04   
ref|XP_006292418.1|  hypothetical protein CARUB_v10018632mg           49.3    9e-04   



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MATFADIG+AA INIL A+ FLVAFAI+RLQP+NDRVYFPKWYLKGLR SP HSG+ + +
Sbjct  1    MATFADIGVAAGINILFAVAFLVAFAILRLQPINDRVYFPKWYLKGLRSSPMHSGSFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR+YVRFLNWVPDALRMPEPELI+HAGLDSAVYLRIYLLGLKIF+P+ALLSW
Sbjct  61   FVNLDWRSYVRFLNWVPDALRMPEPELIDHAGLDSAVYLRIYLLGLKIFIPIALLSW  117



>gb|KDO78340.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
 gb|KDO78341.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=505

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG++AA+NIL A IFL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +++
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+AL++W
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAW  117



>ref|XP_009613689.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=767

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGL+AAINI++ALIFLVAFAI+RLQP NDRVYFPKWYLKGLR SPTHSGA + +
Sbjct  1    MATLGDIGLSAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFVTK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN+DWRAY+RFLNW+PDAL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ LL+W
Sbjct  61   FVNVDWRAYIRFLNWIPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITLLAW  117



>ref|XP_004232686.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316569.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316570.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=767

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGLAAAINI++ALIFLVAFAI+RLQP NDRVYFPKWYLKGLR SPTHSGA + +
Sbjct  1    MATLGDIGLAAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFVAK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN+DWRAY+RFLNW+PDAL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ LL+W
Sbjct  61   FVNVDWRAYIRFLNWIPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITLLAW  117



>ref|XP_009772257.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=767

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGL+AAINI++ALIFLVAFAI+RLQP NDRVYFPKWYLKGLR SPTHSGA + +
Sbjct  1    MATLQDIGLSAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTHSGAFVTK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN+DWRAY+RFLNW+PDAL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ LL+W
Sbjct  61   FVNVDWRAYIRFLNWIPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITLLAW  117



>gb|KDO78339.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=677

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG++AA+NIL A IFL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +++
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+AL++W
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAW  117



>ref|XP_006449786.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63026.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=618

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG++AA+NIL A +FL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +++
Sbjct  1    MATLADIGVSAALNILGAFVFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+AL++W
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAW  117



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MATF DIG+AA +NIL A+ FL+AFA +RLQP+NDRVYFPKWYLKGLR SP ++G+++ +
Sbjct  1    MATFGDIGVAAGLNILFAVAFLIAFAFLRLQPINDRVYFPKWYLKGLRSSPVNAGSVVGK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR+YVRFLNWVPDALRMPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ALLSW
Sbjct  61   FVNLDWRSYVRFLNWVPDALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPVALLSW  117



>ref|XP_006449787.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
 gb|ESR63027.1| hypothetical protein CICLE_v10014589mg [Citrus clementina]
Length=634

 Score =   178 bits (452),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG++AA+NIL A +FL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +++
Sbjct  1    MATLADIGVSAALNILGAFVFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+AL++W
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAW  117



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG++AA+NIL A IFL+AFAI+RLQP NDRVYFPKWYLKGLRDSPTH GA +++
Sbjct  1    MATLADIGVSAALNILGAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRDSPTHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+AL++W
Sbjct  61   FVNLDFRSYIRFLNWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIALVAW  117



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  D+GL+AAINIL+AL+FLVAFAI+RLQP NDRVYFPKWYLKGLR SPT SGA + R
Sbjct  1    MATLGDMGLSAAINILSALVFLVAFAILRLQPFNDRVYFPKWYLKGLRSSPTRSGAFVTR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR+Y+RFLNW+PDALRMPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ L++W
Sbjct  61   FVNLDWRSYLRFLNWMPDALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPVTLIAW  117



>ref|XP_006348153.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
Length=767

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGLAAAINI++ALIFLVAFAI+RLQP NDRVYFPKWYLKGLR SPT SGA + +
Sbjct  1    MATLGDIGLAAAINIISALIFLVAFAILRLQPFNDRVYFPKWYLKGLRHSPTRSGAFVAK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN+DWRAY+RFLNW+PDAL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ LL+W
Sbjct  61   FVNVDWRAYIRFLNWIPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITLLAW  117



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MATF DIGLAA +NIL+AL+FLVAFAI+RLQP NDRVYFPKWYLKGLR +P  SG  + +
Sbjct  1    MATFGDIGLAAGVNILSALVFLVAFAILRLQPFNDRVYFPKWYLKGLRSNPAQSGVFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWRAY+RFLNWVPDAL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ LL+W
Sbjct  61   FVNLDWRAYIRFLNWVPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPVTLLAW  117



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MATF+DIG+AA +NILTAL+FL+AFAI+RLQP+NDRVYFPKWYLKGLR SP+HSGA + +
Sbjct  1    MATFSDIGVAAGVNILTALVFLIAFAILRLQPLNDRVYFPKWYLKGLRGSPSHSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN+D  +Y RFLNWVPDAL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ LL+W
Sbjct  61   FVNIDLVSYTRFLNWVPDALKMPEPELIDHAGLDSAVYLRIYLLGLKIFVPVTLLAW  117



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT AD+G+ AAINIL+A +F V FAI+RLQP NDRVYFPKWY KGLR+SPTHSGA +++
Sbjct  1    MATLADLGVGAAINILSAFLFFVVFAILRLQPFNDRVYFPKWYFKGLRESPTHSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAIN+LTA IFL+AFAI+RLQP NDRVYFPKWYLKG+R SPT SGA ++R
Sbjct  1    MATLGDIGVSAAINLLTAFIFLLAFAILRLQPFNDRVYFPKWYLKGIRSSPTRSGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+ALRMPEPELI+HAGLDSAVYLRIYLLGLKIFVP+A L+W
Sbjct  61   FVNLDFRSYLRFLNWMPEALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAW  117



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  D+G+ A INIL+ALIF + FA +RLQP+NDRVYFPKWYLKGLR+SPTHSGA +++
Sbjct  1    MATLGDLGVGAGINILSALIFFLVFAFLRLQPLNDRVYFPKWYLKGLRESPTHSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P ALRMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNLDFRSYLRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_007153987.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
 gb|ESW25981.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
Length=774

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA +NIL+A IF VAFAI+RLQP NDRVYFPKWYLKGLR  P H GA +++
Sbjct  1    MATLEDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR+Y+RFLNW+P ALRMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDWRSYIRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  D+G+ AAINIL+A +F V FAI+RLQP NDRVYFPKWY KGLR+SPTHSGA +++
Sbjct  1    MATLGDLGVGAAINILSAFLFFVVFAILRLQPFNDRVYFPKWYFKGLRESPTHSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_003610472.1| Membrane protein, putative [Medicago truncatula]
 ref|XP_003619262.1| Membrane protein, putative [Medicago truncatula]
 gb|AES92669.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=774

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA  ADI LAA INIL+A IF VAFAI+RLQP+NDRVYFPKWYLKGLR  P H GA +++
Sbjct  1    MAKLADISLAAGINILSAFIFFVAFAILRLQPLNDRVYFPKWYLKGLRTDPVHGGAFMRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLDWR+Y+RFLNW+P ALRMPEPELI+HAGLDSAVYLRIYLLGLKIFVP+A L+W
Sbjct  61   IVNLDWRSYIRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAW  117



>ref|XP_010921304.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X2 [Elaeis guineensis]
Length=682

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG+AAAINIL+A  FL+AFAI+RLQP+NDRVYFPKWYLKG+R SPTHSGA +++
Sbjct  1    MATLADIGVAAAINILSAFAFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGAFVQK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNL+WR+Y+RFL W+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A+L++
Sbjct  61   FVNLEWRSYLRFLGWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAILAF  117



>ref|XP_007026163.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
 gb|EOY28785.1| ERD (early-responsive to dehydration stress) family protein isoform 
3 [Theobroma cacao]
Length=521

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA IN+L+A++F +AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA +++
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFL+W+P+AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI LAAAINIL+A IF +AFA++R+QP NDRVYFPKWYLKGLR SPT SGA ++R
Sbjct  1    MATLQDIALAAAINILSACIFFLAFAVLRIQPFNDRVYFPKWYLKGLRSSPTRSGAFVQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+PDAL+MPEPELIEHAGLDSAVYLRIYL+GLK+FVP+  L+W
Sbjct  61   FVNLDFRSYLRFLNWMPDALKMPEPELIEHAGLDSAVYLRIYLIGLKLFVPITFLAW  117



>ref|XP_010921296.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X1 [Elaeis guineensis]
Length=760

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG+AAAINIL+A  FL+AFAI+RLQP+NDRVYFPKWYLKG+R SPTHSGA +++
Sbjct  1    MATLADIGVAAAINILSAFAFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGAFVQK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNL+WR+Y+RFL W+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A+L++
Sbjct  61   FVNLEWRSYLRFLGWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAILAF  117



>ref|XP_004507664.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=773

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIGLAA INIL+A IF VAFAI+RLQP+NDRVYFPKWYLKGLR  P H GA +++
Sbjct  1    MATLSDIGLAAGINILSAFIFFVAFAILRLQPLNDRVYFPKWYLKGLRTDPVHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLDWR+Y+RFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIFVP+A L+W
Sbjct  61   IVNLDWRSYIRFLNWMPAALRMPEPELIDHAGLDSVVYLRIYLLGLKIFVPIAFLAW  117



>ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINI TA IFL+AFA++RLQP NDRVYFPKWYLKGLR+SP+ SGA ++R
Sbjct  1    MATLGDIGVSAAINIFTAFIFLLAFAVLRLQPFNDRVYFPKWYLKGLRNSPSRSGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+YVRFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNLDSRSYVRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_008371060.1| PREDICTED: transmembrane protein 63B-like [Malus domestica]
Length=772

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  D+G+AA INIL+ALIF + FA +RLQP NDRVYFPKWYLKGLR+SPTHSGA +++
Sbjct  1    MATLGDLGVAAGINILSALIFFIVFAFLRLQPFNDRVYFPKWYLKGLRESPTHSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P ALRMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+  L+W
Sbjct  61   FVNLDFRSYLRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIVFLAW  117



>ref|XP_003529649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Glycine max]
 ref|XP_006584087.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
 gb|KHN35714.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=777

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AA +NIL+A IF VAFAI+RLQP NDRVYFPKWYLKGLR  P H GA +++
Sbjct  1    MATLSDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR+Y+RFLNW+P ALRMPEPELI+HAGLDS VYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDWRSYLRFLNWMPAALRMPEPELIDHAGLDSVVYLRIYLIGLKIFVPIAFLAW  117



>gb|EYU27725.1| hypothetical protein MIMGU_mgv1a001730mg [Erythranthe guttata]
Length=768

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA F DIGLAA +NIL+ALIFL+AFAI+RLQP NDRVYFPKWYLKGLR SPT SGA   +
Sbjct  1    MADFRDIGLAAGVNILSALIFLIAFAILRLQPFNDRVYFPKWYLKGLRTSPTQSGAFANK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR+Y+RFL WVP+AL+MPE ELI+HAGLDSAVYLRIYLLGLKIFVP+ LL+W
Sbjct  61   FVNLDWRSYIRFLTWVPEALKMPEQELIDHAGLDSAVYLRIYLLGLKIFVPVTLLAW  117



>ref|XP_007026162.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
 gb|EOY28784.1| ERD (early-responsive to dehydration stress) family protein isoform 
2 [Theobroma cacao]
Length=618

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA IN+L+A++F +AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA +++
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFL+W+P+AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_006843810.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AA+NIL A  FL+AFAI+RLQP+NDRVYFPKWYLKGLR SPTHSG  + +
Sbjct  1    MATLRDIGVSAAVNILMAFAFLLAFAILRLQPINDRVYFPKWYLKGLRSSPTHSGVFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+ LRMPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ +L +
Sbjct  61   FVNLDYRSYIRFLNWMPEGLRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIMILGF  117



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINIL+A  FL+AFAI+RLQP+NDRVYFPKWYLKG+R SPTHSG  +++
Sbjct  1    MATLSDIGVAAAINILSAFTFLLAFAILRLQPINDRVYFPKWYLKGVRSSPTHSGTFVQK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNL+WR+Y+RFL W+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A+L++
Sbjct  61   FVNLEWRSYLRFLGWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAILAF  117



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  D+G+ A INIL+AL+F + FA +RLQP NDRVYFPKWYLKGLR+SPTHSGA +++
Sbjct  1    MATLGDLGVGAGINILSALVFFLVFAFLRLQPFNDRVYFPKWYLKGLRESPTHSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P ALRMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+  L+W
Sbjct  61   FVNLDFRSYLRFLNWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIVFLAW  117



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA IN+L+A++F +AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA +++
Sbjct  1    MATLGDIGVAAGINLLSAVVFFLAFAILRLQPFNDRVYFPKWYLKGLRSSPSGSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFL+W+P+AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYLRFLHWMPEALKMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG++AAIN+L+A  FLVAFAI+RLQP NDRVYFPKWYL+G+R SPTHSGAL+++
Sbjct  1    MASLQDIGVSAAINLLSAFAFLVAFAILRLQPFNDRVYFPKWYLRGIRSSPTHSGALVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+P ALRMPEPELI+HAGLDSAVY+RIYLLGLKIF+P  +LS+
Sbjct  61   FVNLDCRTYIRFLNWMPAALRMPEPELIQHAGLDSAVYIRIYLLGLKIFIPFTVLSF  117



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score =   171 bits (432),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP+NDRVYFPKWYLKG+R SP  SGAL++R
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
             VNLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLD AVYLRIYL+GLKIFVP+A ++
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAVYLRIYLMGLKIFVPIAFVA  116



>gb|EPS71959.1| hypothetical protein M569_02795, partial [Genlisea aurea]
Length=761

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INIL+A+ FL+AFA++RLQP NDRVYFPKWYLKGLR SP  SG  + +
Sbjct  1    MATLEDIGVAAGINILSAVAFLIAFAVLRLQPFNDRVYFPKWYLKGLRGSP-RSGTFVAK  59

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDW++Y+RFLNWVPDA+RMPEPELI+HAGLDS VYLRIYLLGLKIFVP+ALLSW
Sbjct  60   FVNLDWKSYLRFLNWVPDAIRMPEPELIDHAGLDSVVYLRIYLLGLKIFVPVALLSW  116



>ref|XP_004145433.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+ALIFL+ FA++RLQP NDRVYF KWYLKGLR SPTH+GA ++R
Sbjct  1    MATLQDIGVSAAINILSALIFLLVFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+A+RMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYLKFLNWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINILTA IFL+ FA++RLQP NDRVYF KWYLKGLR SPTH+GA ++R
Sbjct  1    MATLQDIGVSAAINILTAFIFLLVFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+A+RMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYLKFLNWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_004166876.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=773

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+ALIFL+ FA++RLQP NDRVYF KWYLKGLR SPTH+GA ++R
Sbjct  1    MATLQDIGVSAAINILSALIFLLXFAVLRLQPFNDRVYFSKWYLKGLRSSPTHAGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+A+RMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYLKFLNWMPEAIRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
Length=776

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINIL+A IFL+AFAI+R+QP NDRVYFPKWYLKGLR SP HSGAL+++
Sbjct  1    MATLGDIGVAAAINILSAFIFLLAFAILRIQPFNDRVYFPKWYLKGLRSSPLHSGALVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNLDLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINIL+A +FL+AFAI+R+QPVNDRVYFPKWYLKGLR SP HSG ++ +
Sbjct  1    MATLSDIGVAAAINILSACVFLIAFAILRIQPVNDRVYFPKWYLKGLRSSPLHSGTIVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A +++
Sbjct  61   FVNLDFRAYLKFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFIAF  117



>gb|KDO54267.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=272

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INIL+A  FL AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G L+ +
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFL+W+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIF+P+A L +
Sbjct  61   FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGF  117



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI ++ A+N+L A IFL+AFAI+R+QP NDRVYFPKWYLKGLR S +HSGA  +R
Sbjct  1    MATLGDIAVSGALNLLGAFIFLLAFAILRIQPFNDRVYFPKWYLKGLRSSASHSGAFARR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+Y RFLNW+P+AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   IVNLDFRSYTRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAW  117



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINIL+A IFL+AFA +R+QPVNDRVYFPKWYLKGLR SP HSG ++ +
Sbjct  1    MATLSDIGVAAAINILSACIFLIAFAFLRIQPVNDRVYFPKWYLKGLRGSPLHSGTIVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+A +++
Sbjct  61   FVNLDFRAYLKFLNWMPAALQMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFIAF  117



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+A IFL+AFAI+RLQP+NDRVYFPKWYLKGLR+S T  GA +K+
Sbjct  1    MATLGDIGVSAAINILSAFIFLLAFAILRLQPLNDRVYFPKWYLKGLRNSVTQPGAFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLDWRAY+RFLNWVPDAL+MPE ELI+HAGLDSAVYLRIYLLGLKIF+P+ LL++
Sbjct  61   IVNLDWRAYIRFLNWVPDALKMPELELIDHAGLDSAVYLRIYLLGLKIFIPITLLAF  117



>ref|XP_011014901.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA ++R
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
             VNLD+R+Y+RFLNW+P+AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP++ L+
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPISFLA  116



>ref|XP_006383869.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
 gb|ERP61666.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
Length=802

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP NDRVYFPKWYLKG+R SP+ SGAL++R
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGVRGSPSRSGALVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+Y+RFLNW+P+AL+MPEPELI+HAGLD AVYLRIYL+GLKIFVP+  L+W
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDYAVYLRIYLMGLKIFVPITFLAW  117



>ref|XP_009393118.1| PREDICTED: CSC1-like protein At4g02900 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+ ADIG++AA+NIL+ALIFL+ FA++RLQP NDRVYFPKWYLKG+R SPTHSG  +K+
Sbjct  1    MASLADIGMSAALNILSALIFLIVFAVLRLQPYNDRVYFPKWYLKGIRSSPTHSGNFIKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+P ALRMPEPELI+HAGLDSAVY+RIYLLGLKIF P+A+L++
Sbjct  61   FVNLDCRTYLRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLLGLKIFAPIAVLAF  117



>ref|XP_011046975.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046976.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP NDRVYFPKWYLKGLR SP+ SGA ++R
Sbjct  1    MATLADIAVSGAINLLSAFIFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
             VNLD+R+Y+RFLNW+P+AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A ++
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFVA  116



>ref|XP_009803475.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
 ref|XP_009803477.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=768

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+A IFL+AFAI+RLQP+NDRVYFPKWYL GLR+  T SGA++K+
Sbjct  1    MATLGDIGVSAAINILSAFIFLLAFAILRLQPLNDRVYFPKWYLMGLRNGVTQSGAIVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLDWRAY+RFLNWVPDAL+MPE ELI+HAGLDSAVYLRIYLLGLKIFVP+ LL++
Sbjct  61   IVNLDWRAYIRFLNWVPDALKMPELELIDHAGLDSAVYLRIYLLGLKIFVPITLLAF  117



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AA +NIL+A IF VAFAI+RLQP NDRVYFPKWYLKGLR  P H GA +++
Sbjct  1    MATLSDIGVAAGLNILSAFIFFVAFAILRLQPFNDRVYFPKWYLKGLRTDPVHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR+Y+RFLNW+P ALRMPE ELI+HAGLDS VYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDWRSYLRFLNWMPAALRMPELELIDHAGLDSVVYLRIYLVGLKIFVPIAFLAW  117



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+ +DIG+AAAINIL+A IFL+AFAI+R+QPVNDRVYFPKWYLKGLR SP HSG ++ +
Sbjct  1    MASLSDIGVAAAINILSACIFLIAFAILRIQPVNDRVYFPKWYLKGLRSSPLHSGTIVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A +++
Sbjct  61   FVNLDFRAYLKFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFIAF  117



>ref|XP_006850790.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG++ +IN  TAL FL+AFAI+RLQP NDRVYFPKWYLKGLR SP HSG ++ +
Sbjct  1    MATTSDIGVSLSINFPTALAFLIAFAILRLQPFNDRVYFPKWYLKGLRSSPRHSGTIVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDW+ Y+RFLNW+P ALRMPEPELI+HAGLDSAVY+RIYL+GLK+FVP+ LL++
Sbjct  61   FVNLDWKNYMRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLVGLKLFVPITLLAF  117



>ref|XP_011046985.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=1186

 Score =   167 bits (422),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 84/116 (72%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP+NDRVYFPKWYLKG+R SP  SGAL++R
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
             VNLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLD AVYLRIYL+GLKIFVP+A ++
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAVYLRIYLMGLKIFVPIAFVA  116



>ref|XP_006363038.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363039.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006363040.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Solanum 
tuberosum]
Length=768

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINIL+A IFL+AFA +R+QPVNDRVYFPKWYL GLR SP HSG ++ +
Sbjct  1    MATLTDIGVAAAINILSACIFLIAFAFLRIQPVNDRVYFPKWYLNGLRSSPLHSGTIVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P AL+MPEPELIEHAGLDSAVYLRIYL+GLKIFVP+A +++
Sbjct  61   FVNLDFRAYLKFLNWMPAALQMPEPELIEHAGLDSAVYLRIYLIGLKIFVPIAFIAF  117



>ref|XP_006417282.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
 gb|ESQ35635.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
Length=770

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNL+  +Y+RFLNW+P AL+MPEPELI HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNLNLGSYLRFLNWMPAALKMPEPELIHHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>gb|KHN28986.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            M T +DIG+AAAINI TAL+F VAFAI+RLQP NDRVYFPKWYLKGLR  P H  AL+ +
Sbjct  1    MTTLSDIGVAAAINISTALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLDWRAY+ FLNW+P+ALRMPEPELI+HAGLDS VYLRIYL+GLKIF+P+A L+W
Sbjct  61   FINLDWRAYLSFLNWMPEALRMPEPELIDHAGLDSVVYLRIYLIGLKIFIPIAFLAW  117



>ref|XP_003555683.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoformX1 
[Glycine max]
 ref|XP_006605689.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
Length=774

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            M T +DIG+AAAINI TAL+F VAFAI+RLQP NDRVYFPKWYLKGLR  P H  AL+ +
Sbjct  1    MTTLSDIGVAAAINISTALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLDWRAY+ FLNW+P+ALRMPEPELI+HAGLDS VYLRIYL+GLKIF+P+A L+W
Sbjct  61   FINLDWRAYLSFLNWMPEALRMPEPELIDHAGLDSVVYLRIYLIGLKIFIPIAFLAW  117



>gb|EMS56195.1| hypothetical protein TRIUR3_24213 [Triticum urartu]
Length=139

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+A+IFL+AFA +RLQP+NDRVYFPKWYLKG R SP+H GA +++
Sbjct  1    MATIEDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGSRQSPSHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FL+W+P AL+MPE ELI HAGLDSAVYLRIYL GLKIFVP+ +L++
Sbjct  61   FVNLDMRSYLKFLSWMPAALQMPEDELISHAGLDSAVYLRIYLTGLKIFVPITILAF  117



>ref|XP_008234907.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Prunus mume]
Length=756

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI ++AAINIL+AL FLVAFA+IRLQP NDRVYFPKWYLKG+R SPT SGAL+K+
Sbjct  1    MATLQDIAVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGALVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
            FVNLD + Y++FLNW+P ALRMPEPELIEHAGLDSA Y+RIY+LGLKIFVP+  L+
Sbjct  61   FVNLDAKTYIKFLNWMPAALRMPEPELIEHAGLDSAAYIRIYILGLKIFVPITALA  116



>gb|KDO54265.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=305

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INIL+A  FL AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G L+ +
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFL+W+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIF+P+A L +
Sbjct  61   FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGF  117



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+F DIG+ AAINIL+A +F + FAI+RLQP+NDRVYFPKWY KG+RDSPT SG  + +
Sbjct  1    MASFRDIGVGAAINILSAFVFFIVFAILRLQPLNDRVYFPKWYFKGVRDSPTRSGTFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
            FVNLD+R+YVRFLNW+P AL MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+AL++
Sbjct  61   FVNLDYRSYVRFLNWMPAALNMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALVA  116



>ref|XP_008234908.1| PREDICTED: uncharacterized protein RSN1 isoform X2 [Prunus mume]
Length=749

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI ++AAINIL+AL FLVAFA+IRLQP NDRVYFPKWYLKG+R SPT SGAL+K+
Sbjct  1    MATLQDIAVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGALVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
            FVNLD + Y++FLNW+P ALRMPEPELIEHAGLDSA Y+RIY+LGLKIFVP+  L+
Sbjct  61   FVNLDAKTYIKFLNWMPAALRMPEPELIEHAGLDSAAYIRIYILGLKIFVPITALA  116



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI +AAAINILTA  F VAFAI+R+QPVNDRVYFPKWY+KGLR SP+  GAL+ +
Sbjct  1    MATLNDIAVAAAINILTACAFFVAFAILRIQPVNDRVYFPKWYIKGLRSSPSSGGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P AL+MPEPELI+HAGLDSA YLRIYL+GLKIFVP+A +++
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAAYLRIYLIGLKIFVPIAFIAF  117



>ref|NP_172660.5| putative ERD4 protein [Arabidopsis thaliana]
 sp|B5TYT3.1|CSCL7_ARATH RecName: Full=CSC1-like protein At1g11960 [Arabidopsis thaliana]
 gb|ACI01072.1| putative membrane protein [Arabidopsis thaliana]
 gb|AEE28821.1| putative ERD4 protein [Arabidopsis thaliana]
 gb|AIU34615.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Arabidopsis 
thaliana]
Length=771

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGVAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+ A+INIL+A +F V FA +RLQP NDRVYFPKWYLKG+RDSPT SGA +++
Sbjct  1    MATLGDIGVGASINILSAFLFFVVFAFLRLQPFNDRVYFPKWYLKGVRDSPTRSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P+AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+AL++W
Sbjct  61   FVNLDYRSYVRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALVAW  117



>ref|XP_007050676.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX94833.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=751

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI ++AAIN+L+A  FLVAFAI+RLQP+NDRV+FPKWY KG+R SPT SGA + +
Sbjct  1    MATLQDITVSAAINLLSAFAFLVAFAILRLQPINDRVFFPKWYRKGIRSSPTRSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR Y++FLNW+P ALRMPEPELI+HAGLDS VY+RIYLLGLKI VPLA+L++
Sbjct  61   FVNLDWRTYIKFLNWMPAALRMPEPELIDHAGLDSVVYIRIYLLGLKITVPLAVLAF  117



>gb|KJB69237.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=612

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAA N+L+A +F +AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +K+
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPE ELI+HAGLDSAVYLRIYL+GLKIFVP+ +++W
Sbjct  61   FVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITIVAW  117



>gb|KJB57786.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
 gb|KJB57787.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
Length=770

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AA IN+L+A +FL+AFAI+RLQP NDRVYFPKWYLKGLR SP+ SG  +K+
Sbjct  1    MATLSDIGVAAGINLLSAFVFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGTFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+AL+MPE ELI+HAGLDSAVYLRIYL+GLKIFVP+  L+W
Sbjct  61   FVNLDFRSYLRFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITFLAW  117



>ref|XP_010458617.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_010924082.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X5 [Elaeis guineensis]
Length=688

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y+RFL W+P AL+MPEPELIEHAGLDS+VYLRIYL+GLKIFVP+ +L++
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAF  117



>gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 from A. thaliana 
[Arabidopsis thaliana]
Length=783

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGVAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  D+G+ A INIL+ALIF + FA +RLQP+NDRVYFPKWY KGLR+SPT SGA +++
Sbjct  1    MATLGDLGVGAGINILSALIFFLVFAFLRLQPLNDRVYFPKWYFKGLRESPTPSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFL+W+P ALRMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FVNLDFRSYLRFLDWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_010905258.1| PREDICTED: protein OSCA1-like [Elaeis guineensis]
Length=682

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI L+A INIL+A +F VAFAI+RLQP NDRVYFPKW+LKG+R SP HSG  + +
Sbjct  1    MASLQDIALSAFINILSAFVFFVAFAILRLQPFNDRVYFPKWHLKGIRSSPRHSGKSVTK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR Y+RFLNW+P ALRMPEPELI+HAGLDSAVY+RIYLLGLKIFVPL +L++
Sbjct  61   FVNLDWRTYLRFLNWMPAALRMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLTVLAF  117



>gb|KDO54266.1| hypothetical protein CISIN_1g018945mg [Citrus sinensis]
Length=348

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INIL+A  FL AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G L+ +
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFL+W+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIF+P+A L +
Sbjct  61   FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGF  117



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGLAAAINILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGLAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_010449935.1| PREDICTED: CSC1-like protein At4g15430 [Camelina sativa]
Length=185

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_010924081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X4 [Elaeis guineensis]
Length=726

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y+RFL W+P AL+MPEPELIEHAGLDS+VYLRIYL+GLKIFVP+ +L++
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAF  117



>ref|XP_006306821.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
 gb|EOA39719.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
Length=771

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA+INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLEDIGVAASINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN+D  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL GLKIFVP+ALL+W
Sbjct  61   FVNVDLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLTGLKIFVPVALLAW  117



>ref|XP_010493595.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g11960 [Camelina 
sativa]
Length=779

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGLAA INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGLAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>gb|KHG30770.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=770

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA IN+L+A +FL+AFAI+RLQP NDRVYFPKWYLKGLR SP+ SG  +K+
Sbjct  1    MATLGDIGVAAGINLLSAFVFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSRSGTFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+AL+MPE ELI+HAGLDSAVYLRIYL+GLKIFVP+  L+W
Sbjct  61   FVNLDFRSYLRFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITFLAW  117



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y+RFL W+P AL+MPEPELIEHAGLDS+VYLRIYL+GLKIFVP+ +L++
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAF  117



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIGLAAAINILTA  FL+AFA++R+QP+NDRVYFPKWYLKGLR SP   GA + +
Sbjct  1    MASLGDIGLAAAINILTAFAFLIAFAVLRIQPINDRVYFPKWYLKGLRSSPLQGGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP++LL++
Sbjct  61   FVNLDFRSYIRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPISLLAF  117



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI ++ AIN+L+A IFL+AFA++R+QP NDRVYFPKWY KGLR S + SGA ++R
Sbjct  1    MATLGDIAVSGAINLLSAFIFLLAFAVLRIQPFNDRVYFPKWYFKGLRSSASRSGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+Y+RFLNW+P+AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAW  117



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI ++ AIN+L+A IFL+AFA++R+QP NDRVYFPKWY KGLR S + SGA ++R
Sbjct  1    MATLGDIAVSGAINLLSAFIFLLAFAVLRIQPFNDRVYFPKWYFKGLRSSASRSGAFVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+Y+RFLNW+P+AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPIAFLAW  117



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGLAAAINIL+A+ FL+AFAI+RLQP NDRVYFPKWYLKGLR SP+H GA + +
Sbjct  1    MATLGDIGLAAAINILSAVAFLLAFAILRLQPFNDRVYFPKWYLKGLRSSPSHVGAFVHK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+  L++
Sbjct  61   FVNLDFRSYLRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPITFLAF  117



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y+RFL W+P AL+MPEPELIEHAGLDS+VYLRIYL+GLKIFVP+ +L++
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAF  117



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAIN+L+ALIFL  FAI+RLQP NDRVYFPKWYLKGLR+SP+ S AL+ R
Sbjct  1    MATLEDIGVSAAINLLSALIFLFLFAILRLQPFNDRVYFPKWYLKGLRNSPSRSRALVSR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ +L+W
Sbjct  61   FVNLDCRSYIQFLNWMPQALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPITILAW  117



>ref|XP_011046977.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046978.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++ AIN+L+A IFL+AFAI+RLQP+NDRVYFPKWYLKG+R SP  SGAL++R
Sbjct  1    MATLADITVSGAINVLSAFIFLLAFAILRLQPLNDRVYFPKWYLKGVRGSPLRSGALVRR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
             VNLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLD AVYLRIYL+GLKIFVPL  L+
Sbjct  61   VVNLDFRSYIRFLNWMPEALKMPEPELVDHAGLDYAVYLRIYLMGLKIFVPLTFLA  116



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y+RFL W+P AL+MPEPELIEHAGLDS+VYLRIYL+GLKIFVP+ +L++
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAF  117



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIGLAAAINILTA++FL+AFAI+R+QP+NDRVYFPKWY+KGLR SP   GA + +
Sbjct  1    MASLGDIGLAAAINILTAIVFLLAFAILRIQPINDRVYFPKWYMKGLRSSPLQGGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN+D+R+Y+RFLNW+P AL+MPEPELIEHAGLDSAVYLRIYLLGLKIFVP++LL++
Sbjct  61   FVNIDFRSYIRFLNWMPAALQMPEPELIEHAGLDSAVYLRIYLLGLKIFVPISLLAF  117



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+A  FL+AFA++RLQP+NDRVYFPKWYLKG+R SP HSG  +++
Sbjct  1    MATLADIGLAAAINILSAFAFLLAFAVLRLQPINDRVYFPKWYLKGVRSSPIHSGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y+RFL W+P AL+MPEPELIEHAGLDS+VYLRIYL+GLKIFVP+ +L++
Sbjct  61   FVNLDLRSYLRFLGWMPAALKMPEPELIEHAGLDSSVYLRIYLIGLKIFVPITILAF  117



>ref|XP_002892667.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68926.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INILTA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLEDIGVAATINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALNMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAIN+L+ALIFL  FAI+RLQP NDRVYFPKWYLKGLR+SP+ S AL+ R
Sbjct  1    MATLEDIGVSAAINLLSALIFLFLFAILRLQPFNDRVYFPKWYLKGLRNSPSRSRALVSR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ +L+W
Sbjct  61   FVNLDCRSYIQFLNWMPQALKMPEPELIDHAGLDSAVYLRIYLMGLKIFVPITILAW  117



>emb|CDX98089.1| BnaA06g08400D [Brassica napus]
Length=768

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INI+TA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_009148626.1| PREDICTED: CSC1-like protein At1g11960 [Brassica rapa]
Length=768

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INI+TA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAA N+L+A +F +AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +K+
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPE ELI+HAGLDSAVYLRIYL+GLKIFVP+ +++W
Sbjct  61   FVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITIVAW  117



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAA N+L+A +F +AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +K+
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPE ELI+HAGLDSAVYLRIYL+GLKIFVP+ +++W
Sbjct  61   FVNLDFRSYLKFLNWMPEALKMPELELIDHAGLDSAVYLRIYLIGLKIFVPITIVAW  117



>dbj|BAD94445.1| hypothetical protein [Arabidopsis thaliana]
Length=756

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INILT   F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G    +
Sbjct  1    MATLTDIGVAATINILTVFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAF  117



>emb|CDY30043.1| BnaC05g09770D [Brassica napus]
Length=768

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INI+TA+IFL+AFAI+R+QP NDRVYFPKWYLKG+R SP HSGAL+ +
Sbjct  1    MATLGDIGVAATINIITAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVN++  +Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALL+W
Sbjct  61   FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAW  117



>ref|XP_010522697.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Tarenaya hassleriana]
Length=785

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG++AAIN+L+A  FL+AFAI+RLQPVNDRVYFPKWYLKG+R SP  S  ++ R
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRSRGVVTR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR Y+RFLNW+P AL+MPEPELIEHAGLDSAVY+RIYLLGLK+FVP+++L++
Sbjct  61   FVNLDWRTYIRFLNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAF  117



>ref|XP_010522696.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Tarenaya hassleriana]
Length=800

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG++AAIN+L+A  FL+AFAI+RLQPVNDRVYFPKWYLKG+R SP  S  ++ R
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRSRGVVTR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR Y+RFLNW+P AL+MPEPELIEHAGLDSAVY+RIYLLGLK+FVP+++L++
Sbjct  61   FVNLDWRTYIRFLNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAF  117



>ref|XP_010522695.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Tarenaya hassleriana]
Length=803

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG++AAIN+L+A  FL+AFAI+RLQPVNDRVYFPKWYLKG+R SP  S  ++ R
Sbjct  1    MASLQDIGISAAINLLSACAFLIAFAILRLQPVNDRVYFPKWYLKGIRGSPRRSRGVVTR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLDWR Y+RFLNW+P AL+MPEPELIEHAGLDSAVY+RIYLLGLK+FVP+++L++
Sbjct  61   FVNLDWRTYIRFLNWMPAALKMPEPELIEHAGLDSAVYIRIYLLGLKMFVPISILAF  117



>ref|XP_006355875.1| PREDICTED: uncharacterized protein C354.08c-like [Solanum tuberosum]
Length=751

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            VAFAI+RLQP+NDRVYF KWYLKG+R SP  SG  +K+FVNLD R Y+RFLNW+P ALRM
Sbjct  23   VAFAILRLQPINDRVYFSKWYLKGIRASPRSSGTFVKKFVNLDCRTYIRFLNWMPAALRM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELI HAGLDSAVY+RIYLLGLKIFVPLALLS+
Sbjct  83   PEPELIGHAGLDSAVYIRIYLLGLKIFVPLALLSF  117



>ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum]
Length=751

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            VAFAI+RLQP+NDRVYF KWYLKG+R SP  SG  +K+FVNLD R Y+RFLNW+P ALRM
Sbjct  23   VAFAILRLQPMNDRVYFSKWYLKGIRASPRTSGTFMKKFVNLDCRTYLRFLNWMPAALRM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELI+HAGLDSAVY+RIYLLGLKIFVPLALLS+
Sbjct  83   PEPELIDHAGLDSAVYIRIYLLGLKIFVPLALLSF  117



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI +AA INIL+AL FLVAFAI+RLQP NDRVYFPKWYLKG+R SP  SGA + +
Sbjct  1    MATLQDISVAATINILSALAFLVAFAILRLQPFNDRVYFPKWYLKGIRGSPRRSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+P AL+MPEPELI+HAGLDSAV++RIYLLGLKIFVPLA+L++
Sbjct  61   FVNLDCRTYLRFLNWMPVALKMPEPELIDHAGLDSAVFIRIYLLGLKIFVPLAVLAF  117



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F + FAI+R+QPVNDRVYFPKWY+KGLR SP  +GA + +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFVGK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L++
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAF  117



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI +AA INIL+AL FLVAFAI+RLQP NDRVYFPKWYLKG+R SP  SGA + +
Sbjct  1    MATLQDISVAATINILSALAFLVAFAILRLQPFNDRVYFPKWYLKGIRGSPRRSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+P AL+MPEPELI+HAGLDSAV++RIYLLGLKIFVPLA+L++
Sbjct  61   FVNLDCRTYLRFLNWMPVALKMPEPELIDHAGLDSAVFIRIYLLGLKIFVPLAVLAF  117



>ref|XP_009395092.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395094.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395095.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGLAAAINIL+A+ FL+AFA++RLQP+NDRVYFPKWYLKG+R SPT SG  + +
Sbjct  1    MATLTDIGLAAAINILSAVAFLIAFAVLRLQPINDRVYFPKWYLKGVRGSPTRSGTFVHK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNL+ R+Y+RFL W+P ALRMPEPELI+HAGLDSAVYLRIYL+GLK+FVP+A+LS+
Sbjct  61   FVNLNLRSYLRFLEWMPAALRMPEPELIDHAGLDSAVYLRIYLIGLKLFVPMAILSF  117



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F + FAI+R+QPVNDRVYFPKWY+KGLR SP  +GA + +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFVGK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L++
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAF  117



>emb|CDX79125.1| BnaA01g11920D [Brassica napus]
Length=695

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG++A INIL+A IF + FA++RLQP NDRVYF KWYLKGLR SP+  GA ++R
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFVQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIFVP+A+L+W
Sbjct  61   FVNLDFRAYLKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFVPIAVLAW  117



>ref|XP_007200309.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
 gb|EMJ01508.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
Length=756

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI ++AAINIL+AL FLVAFA+IRLQP NDRVYFPKWYLKG+R SPT SGA +K+
Sbjct  1    MATLQDISVSAAINILSALGFLVAFALIRLQPFNDRVYFPKWYLKGIRGSPTSSGAFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
            FVNLD + Y++FLNW+P ALRMPEPELI+HAGLDSA Y+RIY+LGLKIFVP+  L+
Sbjct  61   FVNLDAKTYIKFLNWMPAALRMPEPELIDHAGLDSAAYIRIYILGLKIFVPITALA  116



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DI +AAAINILTA  F VAFAI+R+QPVNDRVYFPKWY+KGLR SP+  GAL+ +
Sbjct  1    MATLNDIAVAAAINILTACAFFVAFAILRIQPVNDRVYFPKWYIKGLRSSPSSGGALVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y +FLNW+P AL+MPEPELI+HAGLDSA YLRIYL+GLKIFVP+A +++
Sbjct  61   FVNLDFRSYAKFLNWMPAALQMPEPELIDHAGLDSAAYLRIYLIGLKIFVPIAFVAF  117



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIGLAAAINILTA  FL+AFAI+R+QP+NDRVYFPKWYLKGLR SP   GA + +
Sbjct  1    MASLGDIGLAAAINILTAFAFLIAFAILRIQPINDRVYFPKWYLKGLRCSPLQGGAFVTK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P AL+MPEPELIEHAGLDSA+YLRIYLLGLKIFVP++ L++
Sbjct  61   FVNLDFRSYIKFLNWMPAALQMPEPELIEHAGLDSAIYLRIYLLGLKIFVPISFLAF  117



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F + FAI+R+QPVNDRVYFPKWY+KGLR SP  +GA + +
Sbjct  1    MATISDIGVAAAINILTAFAFFIVFAILRIQPVNDRVYFPKWYIKGLRSSPLGTGAFVGK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL GLKIFVP+A L++
Sbjct  61   FVNLDFRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLTGLKIFVPIAFLAF  117



>emb|CDX82907.1| BnaC01g13570D [Brassica napus]
Length=768

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG++A INIL+A IF + FA++RLQP NDRVYF KWYLKGLR SP+  GA ++R
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFVQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIFVP+A+L+W
Sbjct  61   FVNLDFRAYLKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFVPIAVLAW  117



>ref|XP_003542161.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
 gb|KHN42234.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            M T +DIG+AAAINI +AL+F VAFAI+RLQP NDRVYFPKWYLKGLR  P H   L+ +
Sbjct  1    MTTLSDIGVAAAINISSALLFFVAFAILRLQPWNDRVYFPKWYLKGLRTDPVHGRPLVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLDWRAY+  LNW+P+ALRMPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L+W
Sbjct  61   FINLDWRAYLGSLNWMPEALRMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAW  117



>gb|KDO68802.1| hypothetical protein CISIN_1g015063mg [Citrus sinensis]
Length=414

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA   DIG++AAIN+L+A  FLV FAI+R+QPVNDRVYFPKWY KG+R SPTHSG    +
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+PDAL+MPE EL++HAGLDS  YLRIYLLGLKIFVPLA+L++
Sbjct  61   FVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAF  117



>gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=772

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAA N+L+A +F +AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +++
Sbjct  1    MATLGDIGVAAAFNLLSAFVFFIAFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPE EL++HAGLDSAVYLRIYL+GLKIFVP+ +++W
Sbjct  61   FVNLDFRSYLKFLNWMPEALKMPELELVDHAGLDSAVYLRIYLIGLKIFVPITIVAW  117



>ref|XP_009771290.1| PREDICTED: CSC1-like protein At4g02900, partial [Nicotiana sylvestris]
Length=654

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            VAFAI+RLQP NDRVYF KWYLKG+R SP  SGA +++FVNLD R Y+RFLNW+P ALRM
Sbjct  23   VAFAILRLQPFNDRVYFSKWYLKGIRASPRSSGAFVRKFVNLDCRTYIRFLNWMPAALRM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELI+HAGLDSAVY+RIYLLGLKIFVP+AL S+
Sbjct  83   PEPELIDHAGLDSAVYIRIYLLGLKIFVPIALFSF  117



>ref|XP_009135587.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brassica 
rapa]
Length=768

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG++A INIL+A IF + FA++RLQP NDRVYF KWYLKGLR SP+  GA ++R
Sbjct  1    MATLSDIGVSAGINILSAFIFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFVQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIFVP+A+L+W
Sbjct  61   FVNLDFRAYLKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFVPIAVLAW  117



>ref|XP_004231619.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010315702.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=765

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG+AAA+NIL+ALIFL+AFAI+RLQP+NDRVYFPKWYL GLR+ P  SG  +K+
Sbjct  1    MATLADIGVAAALNILSALIFLLAFAILRLQPLNDRVYFPKWYLVGLRNDPLKSGGFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLDW+AY+RFLNWVP AL+MPE ELI+HAGLDSAVYLRIYLLGLKIF+P+ LL++
Sbjct  61   VVNLDWKAYIRFLNWVPAALKMPELELIDHAGLDSAVYLRIYLLGLKIFIPITLLAF  117



>ref|XP_010684236.1| PREDICTED: CSC1-like protein At4g02900 [Beta vulgaris subsp. 
vulgaris]
Length=755

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            + FAI+RLQP+NDRVYFPKWYLKG+R +PTHS  L+ +FVNLD R Y+RFLNW+P+ALRM
Sbjct  23   IVFAILRLQPINDRVYFPKWYLKGIRATPTHSRGLVNKFVNLDLRTYLRFLNWMPEALRM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLDS  Y+RIYLLGLKIFVP+A+L++
Sbjct  83   PEPELIEHAGLDSVAYIRIYLLGLKIFVPIAVLAF  117



>ref|XP_009601331.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
tomentosiformis]
Length=755

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI ++A IN+L+AL+FL+AFAI+RLQP+NDRVYFPKWYLKG+R SP  SGA + +
Sbjct  1    MASVQDISVSAVINLLSALVFLLAFAIVRLQPINDRVYFPKWYLKGIRASPRSSGAFVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R Y+RFLNW+P AL+MPE ELI+HAGLDSAVY+RIYLLGLKIFVP+ +LS+
Sbjct  61   FVNLDFRTYIRFLNWMPAALKMPEQELIDHAGLDSAVYIRIYLLGLKIFVPITMLSF  117



>emb|CDY27443.1| BnaC03g64830D [Brassica napus]
Length=775

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A IF V FAI+RLQP NDRVYF KWYLKGLR SPT  GA ++R
Sbjct  1    MATLVDIGVSAGINILSAFIFFVIFAILRLQPFNDRVYFSKWYLKGLRSSPTRGGAFVQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRAYLKFLNWMPQALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAW  117



>ref|XP_009625807.1| PREDICTED: CSC1-like protein At4g02900 [Nicotiana tomentosiformis]
 ref|XP_009625808.1| PREDICTED: CSC1-like protein At4g02900 [Nicotiana tomentosiformis]
Length=750

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            VAFAI+RLQP NDRVYF KWYLKG+R SP  SGA +++FVNLD R Y+RFLNW+P ALRM
Sbjct  23   VAFAILRLQPFNDRVYFSKWYLKGIRASPRSSGAFVRKFVNLDCRTYIRFLNWMPAALRM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELI+HAGLDSAVY+RIYLLGLKIFVP+AL S+
Sbjct  83   PEPELIDHAGLDSAVYIRIYLLGLKIFVPIALFSF  117



>ref|XP_006350470.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=767

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+ALIFL+AFAI+RLQP+NDRVYFPKWYL GLR+ P  SG  +K+
Sbjct  1    MATIGDIGVSAAINILSALIFLLAFAILRLQPLNDRVYFPKWYLAGLRNDPLKSGGFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLDW+AY+RFLNWVP AL+MPE ELI+HAGLDSAVYLRIYLLGLKIF+P+ LL++
Sbjct  61   VVNLDWKAYIRFLNWVPAALKMPELELIDHAGLDSAVYLRIYLLGLKIFIPITLLAF  117



>ref|XP_006447609.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
 ref|XP_006469643.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469644.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 gb|ESR60849.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
Length=759

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INIL+A  FL AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G L+ +
Sbjct  1    MATLGDIGVAATINILSAFAFLSAFAILRIQPINDRVYFPKWYLKGLRSSPLQTGTLVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFL+W+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIF+P+A L +
Sbjct  61   FVNLDFRSYLRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLIGLKIFIPIACLGF  117



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI ++AAINIL+A+ FLVAFAI+RLQP+NDRVYFPKWYLKG+R SPT SG     
Sbjct  1    MASLQDISVSAAINILSAIAFLVAFAILRLQPINDRVYFPKWYLKGIRGSPTRSGGFAST  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R Y+RFL+W+P ALRMPEPELI+HAGLDSA Y+RIYLLGLKIFVP+  L++
Sbjct  61   FVNLDFRTYIRFLSWMPAALRMPEPELIDHAGLDSAAYIRIYLLGLKIFVPITFLAF  117



>ref|XP_009404922.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009404937.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=768

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGLAAAINIL A+ FLVAFAI+RLQP+NDRVYFPKWYLKG+R SPT SGA +++
Sbjct  1    MATLTDIGLAAAINILVAIAFLVAFAILRLQPINDRVYFPKWYLKGVRSSPTCSGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNL+  +Y+RFL W+P ALRMPEPELI HAGLDS VYLRIYL+GLKIFVP+A+L++
Sbjct  61   FVNLNLSSYLRFLGWMPAALRMPEPELINHAGLDSVVYLRIYLIGLKIFVPMAILAF  117



>gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=764

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +1

Query  298  AFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMP  477
            AFA++RLQP NDRVYFPKWYLKGLR SP  SGA +K+FVNLD+R+Y++FLNW+P+AL+MP
Sbjct  16   AFAVLRLQPFNDRVYFPKWYLKGLRTSPASSGAFVKKFVNLDFRSYLKFLNWMPEALKMP  75

Query  478  EPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            E ELI+HAGLDSAVYLRIYL+GLKIFVP+ +++W
Sbjct  76   ELELIDHAGLDSAVYLRIYLIGLKIFVPITIVAW  109



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INILTA IF V FAI+RLQP NDRVYF KWYLK LR SPTH GA + R
Sbjct  1    MATLLDIGVSAGINILTAFIFFVVFAILRLQPFNDRVYFSKWYLKRLRSSPTHGGAFVSR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y+RFLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+AL++W
Sbjct  61   FVNLDLRSYLRFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIALVAW  117



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = +1

Query  223  VKMATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALL  402
            + MA+  DIGLAAAINIL+A  FL+AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G  +
Sbjct  1    MHMASLGDIGLAAAINILSAFAFLLAFAILRIQPINDRVYFPKWYLKGLRSSPLQAGIFV  60

Query  403  KRFVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             +FVNLD+++Y+RFL+W+P AL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+A+L++
Sbjct  61   SKFVNLDFKSYIRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAVLAF  119



>ref|XP_006479762.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
Length=760

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA   DIG++AAIN+L+A  FLV FAI+R+QPVNDRVYFPKWY KG+R SPTHSG    +
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+PDAL+MPE EL++HAGLDS  YLRIYLLGLKIFVPLA+L++
Sbjct  61   FVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAF  117



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIGLAAAINIL+A  FL+AFAI+R+QP+NDRVYFPKWYLKGLR SP  +G  + +
Sbjct  1    MASLGDIGLAAAINILSAFAFLLAFAILRIQPINDRVYFPKWYLKGLRSSPLQAGIFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+++Y+RFL+W+P AL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+A+L++
Sbjct  61   FVNLDFKSYIRFLSWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAVLAF  117



>ref|XP_006444131.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
 ref|XP_006479761.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 gb|ESR57371.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
Length=760

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA   DIG++AAIN+L+A  FLV FAI+R+QPVNDRVYFPKWY KG+R SPTHSG    +
Sbjct  1    MANLKDIGVSAAINLLSAFAFLVVFAILRIQPVNDRVYFPKWYRKGVRSSPTHSGTFANK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+PDAL+MPE EL++HAGLDS  YLRIYLLGLKIFVPLA+L++
Sbjct  61   FVNLDLRTYLRFLNWMPDALKMPESELVDHAGLDSVAYLRIYLLGLKIFVPLAILAF  117



>sp|F4HYR3.2|CSCL6_ARATH RecName: Full=CSC1-like protein At1g62320 [Arabidopsis thaliana]
 gb|AAF70851.1|AC003113_18 F24O1.4 [Arabidopsis thaliana]
Length=778

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+ALIFL+ FAI+R+QP NDRVYFPKWYLKG+R SP +SGA + +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPVNSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             +NLD+R+YVRFLNW+PDAL+MPEPELI+HAGLDSAVYLRIYL+GLKIF P+ALLSW
Sbjct  61   IMNLDFRSYVRFLNWMPDALKMPEPELIDHAGLDSAVYLRIYLIGLKIFGPIALLSW  117



>ref|NP_176422.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE33953.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34616.1| hyperosmolality-gated Ca2+ permeable channel 1.4 [Arabidopsis 
thaliana]
Length=769

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+ALIFL+ FAI+R+QP NDRVYFPKWYLKG+R SP +SGA + +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPVNSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             +NLD+R+YVRFLNW+PDAL+MPEPELI+HAGLDSAVYLRIYL+GLKIF P+ALLSW
Sbjct  61   IMNLDFRSYVRFLNWMPDALKMPEPELIDHAGLDSAVYLRIYLIGLKIFGPIALLSW  117



>ref|XP_010448929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448930.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448931.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448932.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448933.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448934.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A +F + FA++RLQP+NDRVYF KWYLKGLR SP   GA  +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPLNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YV+FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRSYVKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAW  117



>ref|XP_006414511.1| hypothetical protein EUTSA_v10024504mg [Eutrema salsugineum]
 gb|ESQ55964.1| hypothetical protein EUTSA_v10024504mg [Eutrema salsugineum]
Length=743

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAIAFLIAFAILRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_010052882.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Eucalyptus grandis]
 gb|KCW77010.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=774

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+A +F V FA++RLQP NDRVYFPKWYLKGLR SP   G   ++
Sbjct  1    MATLADIGLAAAINILSAFVFFVVFAVLRLQPFNDRVYFPKWYLKGLRTSPARGGPFARK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+PDAL+MPE ELIEHAGLDSAVYLRIYLLGLK+FVP+ALL+W
Sbjct  61   FVNLDFRSYIKFLNWMPDALKMPEQELIEHAGLDSAVYLRIYLLGLKVFVPMALLAW  117



>ref|XP_002867790.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44049.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A +F + FAI+RLQP NDRVYF KWYLKGLR SP   GA  +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAILRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRSYMRFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAW  117



>ref|XP_002886475.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62734.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG+AAAINIL+ALIFL+ FAI+R+QP NDRVYFPKWYLKG+R SP +SGA + +
Sbjct  1    MATLADIGVAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPVNSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             +NLD+R+YVRFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALLSW
Sbjct  61   IMNLDFRSYVRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSW  117



>ref|XP_007145950.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
 gb|ESW17944.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
Length=773

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            M T +DIG+AAAINI +AL+F +AFAI+RLQP NDRVYFPKWYLKGLR  P    A + +
Sbjct  1    MTTLSDIGVAAAINISSALLFFLAFAILRLQPWNDRVYFPKWYLKGLRTDPIQGRAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLDWR+Y+ FLNW+P+A+RMPEPELI+HAGLDS VYLRIYL+GLKIFVP+A L+W
Sbjct  61   FINLDWRSYLGFLNWMPEAIRMPEPELIDHAGLDSVVYLRIYLIGLKIFVPIAFLAW  117



>ref|XP_010278611.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Nelumbo nucifera]
Length=607

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++A IN+L+A+ FLVAFA++RLQP NDRVYFPKWYLKG+R  P  SGA   +
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAFGNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R Y  F NW+P AL+MPEPELI+HAGLDSAVY+RIYLLGLKIFVPL +L++
Sbjct  61   FVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLTVLAF  117



>ref|XP_006391905.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
 gb|ESQ29191.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
Length=766

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG+AAAINIL+ALIFL+ FAI+R+QP NDRVYFPKWYLKGLR +P  SGA + +
Sbjct  1    MATLADIGVAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGLRSNPVTSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VN D+R+Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALLSW
Sbjct  61   IVNFDFRSYIRFLNWIPGALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSW  117



>emb|CAA18115.1| putative protein [Arabidopsis thaliana]
 emb|CAB79167.1| putative protein [Arabidopsis thaliana]
Length=697

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKGLR SP   GA  +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAW  117



>ref|XP_010278603.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nelumbo nucifera]
Length=709

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++A IN+L+A+ FLVAFA++RLQP NDRVYFPKWYLKG+R  P  SGA   +
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAFGNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R Y  F NW+P AL+MPEPELI+HAGLDSAVY+RIYLLGLKIFVPL +L++
Sbjct  61   FVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLTVLAF  117



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINIL+A  F + FAI+R+QP NDRVYFPKWYL+GLR SP  S A   +
Sbjct  1    MATLSDIGVAAAINILSAFAFFIVFAIVRIQPFNDRVYFPKWYLRGLRCSPLRSDAFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y+RFLNW+P+AL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+ +L++
Sbjct  61   FVNLDLRSYLRFLNWMPEALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPITILAF  117



>ref|XP_006287198.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
 gb|EOA20096.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
Length=497

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P AL+MPEPE
Sbjct  27   MLRLQPVNDRVYFPKWYLKGIRGSPTRSRGIMNRFVNLDWTTYVKFLNWMPAALKMPEPE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LIEHAGLDSAVY+RIYLLGLK+FVP+ LL++
Sbjct  87   LIEHAGLDSAVYIRIYLLGLKMFVPITLLAF  117



>dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKGLR SP   GA  +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAW  117



>ref|XP_010323041.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Solanum lycopersicum]
Length=688

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI ++A IN+++AL+FL+AFAI RLQP+NDRVYFPKWYLKG+R SP  SG+ + +
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSYVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R Y+RFLNW+P AL+MPE ELI HAGLDSAVY+R+YLLGLKIFVP+ LLS+
Sbjct  61   FVNLDFRTYIRFLNWMPAALKMPEQELISHAGLDSAVYIRMYLLGLKIFVPITLLSF  117



>ref|XP_010278586.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
 ref|XP_010278595.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
Length=756

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI ++A IN+L+A+ FLVAFA++RLQP NDRVYFPKWYLKG+R  P  SGA   +
Sbjct  1    MATLADIVVSAVINLLSAIAFLVAFALLRLQPFNDRVYFPKWYLKGMRSRPNCSGAFGNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R Y  F NW+P AL+MPEPELI+HAGLDSAVY+RIYLLGLKIFVPL +L++
Sbjct  61   FVNLDFRTYRNFFNWMPTALKMPEPELIDHAGLDSAVYIRIYLLGLKIFVPLTVLAF  117



>ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q5XEZ5.1|CSC1_ARATH RecName: Full=Calcium permeable stress-gated cation channel 1; 
Short=AtCSC1 [Arabidopsis thaliana]
 gb|AAU94384.1| At4g22120 [Arabidopsis thaliana]
 gb|AAW50707.1| At4g22120 [Arabidopsis thaliana]
 gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34614.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Arabidopsis 
thaliana]
Length=771

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKGLR SP   GA  +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAW  117



>ref|XP_010439363.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439364.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439365.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
Length=771

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKGLR SP   GA  +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAW  117



>ref|XP_006352784.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=766

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI ++A IN+++AL+FL+AFAI RLQP+NDRVYFPKWYLKG+R SP  SG+ + +
Sbjct  1    MASVQDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSFVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+P AL+MPE ELI HAGLDSAVY+RIYLLGLKIFVP+ LLS+
Sbjct  61   FVNLDLRTYIRFLNWMPAALKMPEQELIGHAGLDSAVYIRIYLLGLKIFVPITLLSF  117



>ref|XP_010323040.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Solanum lycopersicum]
Length=704

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI ++A IN+++AL+FL+AFAI RLQP+NDRVYFPKWYLKG+R SP  SG+ + +
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSYVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R Y+RFLNW+P AL+MPE ELI HAGLDSAVY+R+YLLGLKIFVP+ LLS+
Sbjct  61   FVNLDFRTYIRFLNWMPAALKMPEQELISHAGLDSAVYIRMYLLGLKIFVPITLLSF  117



>ref|XP_010418218.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418219.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418220.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+ALIFL+ FAI+R+QP NDRVYFPKWYLKG+R SP +SGA   +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPLNSGAFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VN D+RAY+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALLSW
Sbjct  61   IVNFDFRAYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSW  117



>ref|XP_004292602.1| PREDICTED: CSC1-like protein At4g02900 [Fragaria vesca subsp. 
vesca]
Length=759

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            VAFA++RLQP NDRVYFPKWYLKG+R SPT SG ++++FVNLD   YV+FLNW+P ALRM
Sbjct  23   VAFALLRLQPFNDRVYFPKWYLKGIRGSPTSSGTVVQKFVNLDIMTYVKFLNWMPAALRM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
            PEPELIEHAGLDSA Y+RIYLLGLKIF P+ ++S
Sbjct  83   PEPELIEHAGLDSAAYIRIYLLGLKIFFPITIVS  116



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADI +AA+INIL+A  F VAFAI+R+QP+NDRVYFPKWYLKGLR SP  SGA + +
Sbjct  1    MATIADISVAASINILSAFAFFVAFAILRIQPINDRVYFPKWYLKGLRSSPLQSGAFVHK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+ +Y+RFLNW+P A+RMPEPELI+HAGLDSAVYLRIYL GLKIFVP+A++++
Sbjct  61   FVNLDFHSYLRFLNWMPAAMRMPEPELIDHAGLDSAVYLRIYLTGLKIFVPIAVIAF  117



>ref|XP_004242328.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Solanum lycopersicum]
Length=766

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI ++A IN+++AL+FL+AFAI RLQP+NDRVYFPKWYLKG+R SP  SG+ + +
Sbjct  1    MASVKDISVSAVINLISALVFLLAFAIARLQPINDRVYFPKWYLKGIRASPRSSGSYVNK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R Y+RFLNW+P AL+MPE ELI HAGLDSAVY+R+YLLGLKIFVP+ LLS+
Sbjct  61   FVNLDFRTYIRFLNWMPAALKMPEQELISHAGLDSAVYIRMYLLGLKIFVPITLLSF  117



>ref|XP_008386531.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=757

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA F DI ++AAINIL+A  FLVAF ++RLQP NDRVYFPKWYLKG+R SPT SGA +++
Sbjct  1    MANFQDIMMSAAINILSAFGFLVAFGLLRLQPFNDRVYFPKWYLKGMRGSPTSSGATVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
            FVNLD + Y +FLNW+P ALRMPEPELI+HAGLDSA Y+RIY+LGLKIFVP+  L+
Sbjct  61   FVNLDAKTYFKFLNWMPAALRMPEPELIDHAGLDSAAYIRIYVLGLKIFVPITALA  116



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQP+NDRVYFPKWYLKG+R SPTHSG  +++FVNLD R+Y+RFL W+P AL+MPEPE
Sbjct  27   VLRLQPINDRVYFPKWYLKGVRSSPTHSGTFVRKFVNLDLRSYLRFLGWMPAALKMPEPE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LI+HAGLDSAVYLRIYL+GLKIF+P+A+L++
Sbjct  87   LIDHAGLDSAVYLRIYLIGLKIFIPIAILAF  117



>ref|XP_010430277.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430278.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430279.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430280.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430281.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+ALIFL+ FAI+R+QP NDRVYFPKWYLKG+R SP +SGA   +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPLNSGAFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VN D+RAY+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALLSW
Sbjct  61   IVNFDFRAYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSW  117



>ref|XP_009107840.1| PREDICTED: CSC1-like protein At4g15430 [Brassica rapa]
 emb|CDY22738.1| BnaA08g05680D [Brassica napus]
Length=755

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  +IG+AAAINI+T++ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINEIGVAAAINIVTSIAFLIAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>emb|CDY09064.1| BnaC08g10180D [Brassica napus]
Length=761

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  +IG+AAAINI+T++ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINEIGVAAAINIVTSIAFLIAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_008673458.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
Length=768

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGL+AAINI+ A++FLVAFA +RLQP+NDRVYFPKWYLKG R+SP+H G  +++
Sbjct  1    MATIQDIGLSAAINIMGAVVFLVAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FL+WVP AL+MPE ELI HAGLDSAVYLRIYL+GLKIF P+++L++
Sbjct  61   FVNLDMRSYLKFLSWVPAALKMPEDELISHAGLDSAVYLRIYLVGLKIFAPISVLAF  117



>ref|XP_002533077.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29316.1| conserved hypothetical protein [Ricinus communis]
Length=756

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA   DIG +AA+N+L+A+ FL+AFAI+RLQP+NDRVYFPKWYLKG+R SPTHS A + +
Sbjct  1    MANLQDIGYSAAVNLLSAIAFLIAFAILRLQPINDRVYFPKWYLKGIRASPTHSRAFVTK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD + Y+RFLNW+P ALRMPE ELI+HAGLDS VY+RIYLLGLKIFVP+ +L++
Sbjct  61   FVNLDAKTYIRFLNWMPAALRMPELELIDHAGLDSVVYIRIYLLGLKIFVPITVLAF  117



>emb|CAB10322.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78585.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_008675529.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008675530.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 tpg|DAA59084.1| TPA: hypothetical protein ZEAMMB73_475653 [Zea mays]
Length=768

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGL+AAINI+ A++FLVAFA +RLQP+NDRVYFPKWYLKG R+SP+H G  +++
Sbjct  1    MATIQDIGLSAAINIMGAVLFLVAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FL+WVP AL+MPE ELI HAGLDSAVYLRIYL+GLKIF P+++L++
Sbjct  61   FVNLDMRSYLKFLSWVPAALKMPEDELISHAGLDSAVYLRIYLVGLKIFAPISVLAF  117



>ref|XP_010473449.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473450.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473451.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=779

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIGLAAAINIL+ALIFL+ FAI+R+QP NDRVYFPKWYLKG+R SP +SGA   +
Sbjct  1    MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPLNSGAFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VN D+RAY+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+ALLSW
Sbjct  61   IVNFDFRAYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLSW  117



>ref|XP_006287199.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
 gb|EOA20097.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
Length=685

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P AL+MPEPE
Sbjct  27   MLRLQPVNDRVYFPKWYLKGIRGSPTRSRGIMNRFVNLDWTTYVKFLNWMPAALKMPEPE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LIEHAGLDSAVY+RIYLLGLK+FVP+ LL++
Sbjct  87   LIEHAGLDSAVYIRIYLLGLKMFVPITLLAF  117



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+ AAINIL+A  F V FA++R+QPVNDRVYFPKWY+KGLR SP  SGA++ R
Sbjct  1    MASIGDIGVGAAINILSAFAFFVVFALLRIQPVNDRVYFPKWYIKGLRGSPLSSGAIVGR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+Y++FLNW+  ALRMPEPELI+HAGLDSAVYLRIYLLGLKIFVP+A L++
Sbjct  61   IVNLDFRSYLKFLNWMVAALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIACLAF  117



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINIL+A  F +AFAI+R+QPVNDRVYFPKWYLKGLR SP  +GA + +
Sbjct  1    MATLNDIGIAAAINILSAFAFFIAFAILRIQPVNDRVYFPKWYLKGLRSSPHRTGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P+ALRMPEPELI+HAGLDS VYLRIYLLG+KIF P+ALL++
Sbjct  61   FVNLDFRSYVRFLNWMPEALRMPEPELIDHAGLDSVVYLRIYLLGIKIFFPIALLAF  117



>ref|XP_010449938.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+A+IFL+AFA +RLQP+NDRVYFPKWYLKG R SP+H GA +++
Sbjct  1    MATIEDIGVSAAINILSAIIFLLAFAFLRLQPINDRVYFPKWYLKGARQSPSHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FL+W+P AL+MPE ELI HAGLDSAVYLRIYL+GLKIFVP+ +L++
Sbjct  61   FVNLDMRSYLKFLSWMPAALQMPEDELISHAGLDSAVYLRIYLIGLKIFVPITILAF  117



>ref|XP_010434983.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_010434078.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A +F + FA++RLQP NDRVYF KWYLKG+R SP   GA  +R
Sbjct  1    MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGIRSSPARGGAFAQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAW  117



>ref|XP_010449936.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Camelina sativa]
Length=763

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_010434984.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F  AFAI+R+QPVNDRVYFPKWY+KGLR SP  +GA + +
Sbjct  1    MATLSDIGVAAAINILTAFAFFFAFAILRIQPVNDRVYFPKWYIKGLRSSPFGTGAFVGK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P AL MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L++
Sbjct  61   FVNLDFRSYVRFLNWMPAALHMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAF  117



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A++F + FA++RLQP NDRVYF KWYLKGLR SP+  GA  +R
Sbjct  1    MATLQDIGVSAGINILSAVVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPSRGGAFAQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FLNW+P+AL+MPEPELI+HAGLDS VYLRIY +GLKIF P+A+L+W
Sbjct  61   FVNLDLRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWMGLKIFAPIAVLAW  117



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINIL+A  F +AFAI+R+QPVNDRVYFPKWYLKGLR SP  +GA + +
Sbjct  1    MATLSDIGVAAAINILSAFAFFLAFAILRIQPVNDRVYFPKWYLKGLRCSPLANGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYLLGLKIFVP+A L++
Sbjct  61   FVNLDFRSYARFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAF  117



>ref|XP_004151944.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+ AAINIL+A  F + FA++R+QPVNDRVYFPKWY+KGLR SP  SGAL+ R
Sbjct  1    MASIGDIGVGAAINILSAFAFFLVFALLRIQPVNDRVYFPKWYIKGLRGSPMSSGALVGR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+Y++FLNW+  ALRMPEPELI+HAGLDSAVYLRIYLLGLKIFVP+A L++
Sbjct  61   IVNLDFRSYLKFLNWMVAALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIACLAF  117



>ref|XP_004158583.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
Length=768

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+ AAINIL+A  F + FA++R+QPVNDRVYFPKWY+KGLR SP  SGAL+ R
Sbjct  1    MASIGDIGVGAAINILSAFAFFLVFALLRIQPVNDRVYFPKWYIKGLRGSPMSSGALVGR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+Y++FLNW+  ALRMPEPELI+HAGLDSAVYLRIYLLGLKIFVP+A L++
Sbjct  61   IVNLDFRSYLKFLNWMVAALRMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIACLAF  117



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TAL FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTALAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>dbj|BAK03311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+A+IFL+AFA +RLQP+NDRVYFPKWYLKG R SP+H GA +++
Sbjct  1    MATIQDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGTRQSPSHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FL+W+P AL+MPE ELI HAGLDSAVYLRIYL GLKIFVP+ +L++
Sbjct  61   FVNLDMRSYLKFLSWMPAALQMPEDELISHAGLDSAVYLRIYLTGLKIFVPITILAF  117



>ref|XP_004493651.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004493652.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Cicer 
arietinum]
Length=759

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT ADIG++A IN+L+A  FL AFA++RLQP NDR+YFPKWYLKG+R SPT+S + +K+
Sbjct  1    MATLADIGISAGINLLSAFTFLFAFAMLRLQPFNDRIYFPKWYLKGIRSSPTNSRSFVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+  Y+RFLNW+P AL MPEPELI+HAGLDSAVY+RIY+LG KIF P+ LL++
Sbjct  61   FVNLDFGTYIRFLNWMPAALHMPEPELIDHAGLDSAVYIRIYVLGFKIFAPITLLAF  117



>ref|XP_010422520.1| PREDICTED: CSC1-like protein At4g02900 [Camelina sativa]
Length=770

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P AL+MPEPE
Sbjct  27   MLRLQPVNDRVYFPKWYLKGIRGSPTRSRGIMNRFVNLDWTTYVKFLNWMPAALQMPEPE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LIEHAGLDSAVY+RIYLLGLK+FVP+ LL++
Sbjct  87   LIEHAGLDSAVYIRIYLLGLKMFVPITLLAF  117



>ref|NP_001154237.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE83603.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34618.1| hyperosmolality-gated Ca2+ permeable channel 1.6 [Arabidopsis 
thaliana]
Length=760

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|NP_193278.4| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q8VZM5.1|CSCL3_ARATH RecName: Full=CSC1-like protein At4g15430 [Arabidopsis thaliana]
 gb|AAL36364.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83602.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
Length=761

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_010430503.1| PREDICTED: CSC1-like protein At4g02900 [Camelina sativa]
Length=770

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P AL+MPEPE
Sbjct  27   MLRLQPVNDRVYFPKWYLKGIRGSPTRSRGIMNRFVNLDWTTYVKFLNWMPAALQMPEPE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LIEHAGLDSAVY+RIYLLGLK+FVP+ LL++
Sbjct  87   LIEHAGLDSAVYIRIYLLGLKMFVPITLLAF  117



>emb|CDY49293.1| BnaC01g22480D [Brassica napus]
Length=756

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL+ HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_004293316.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=734

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  310  IRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPEL  489
            +RLQP NDRVYF KWYLKG R SPT SG    +FVNLD+R+YVRFLNWVP+AL+MPEPEL
Sbjct  28   LRLQPCNDRVYFAKWYLKGERGSPTSSGTFGSKFVNLDYRSYVRFLNWVPEALKMPEPEL  87

Query  490  IEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            I+HAGLDSAVYLRIYL+GLKIFVP+A ++W
Sbjct  88   IDHAGLDSAVYLRIYLMGLKIFVPIAFVAW  117



>gb|EMS66710.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=743

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFAI+R+QP+NDRVYFPKWYLKG R SP H GA   +FVN D+  Y+RFLNW+P AL+M
Sbjct  23   LAFAILRIQPINDRVYFPKWYLKGTRSSPRHIGAGFSKFVNADFSTYLRFLNWMPAALQM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLD+AVY+RIYLLGLKIFVP+ALL++
Sbjct  83   PEPELIEHAGLDAAVYVRIYLLGLKIFVPIALLAF  117



>ref|XP_009147369.1| PREDICTED: CSC1-like protein At4g15430 isoform X3 [Brassica rapa]
Length=756

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL+ HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>emb|CDY48898.1| BnaA03g36370D [Brassica napus]
Length=756

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G L  +
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGLASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A L++
Sbjct  61   FVNLDFRSYIKFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACLAF  117



>ref|XP_009147329.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147337.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147346.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147353.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
Length=762

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL+ HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_009147362.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Brassica rapa]
Length=761

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL+ HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_010510410.1| PREDICTED: CSC1-like protein At3g21620 [Camelina sativa]
Length=757

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG AA INILTA  F +AFA++RLQPVNDRVYFPKWY+KGLR SP  +G    +
Sbjct  1    MATLSDIGFAATINILTAFAFFIAFAVLRLQPVNDRVYFPKWYIKGLRSSPIKTGGFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FVNLDFRSYVRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAF  117



>emb|CDY22920.1| BnaA01g18580D [Brassica napus]
Length=756

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+AAAINI+TA+ FL+AFAI+R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MASINDIGVAAAINIVTAIAFLLAFAILRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL+ HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVHHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>gb|KEH23730.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=764

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A IN+ +A +FL+AFA++RLQP NDRVYFPKWYLKG+R SPT+S +++K+
Sbjct  1    MATLVDIGVSAGINLFSATMFLLAFAVLRLQPFNDRVYFPKWYLKGIRSSPTNSRSIVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+  Y+RFLNW+P AL MPEPELI+HAGLDSAV++RIY+LG+KIF P  LL++
Sbjct  61   FVNLDFGTYIRFLNWMPAALHMPEPELIDHAGLDSAVFIRIYILGVKIFAPTTLLAF  117



>ref|XP_009135761.1| PREDICTED: CSC1-like protein At3g21620 [Brassica rapa]
Length=756

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G L  +
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGLASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A L++
Sbjct  61   FVNLDFRSYIKFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACLAF  117



>ref|XP_010440309.1| PREDICTED: CSC1-like protein At4g15430 [Camelina sativa]
Length=762

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWY KGLR S   +G    +
Sbjct  1    MATINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYFKGLRSSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYIRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>gb|EMT27455.1| Putative membrane protein [Aegilops tauschii]
Length=816

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+A+IFL+AFA +RLQP+NDRVYFPKWYLKG R SP+H GA +++
Sbjct  1    MATIEDIGVSAAINILSAVIFLLAFAFLRLQPINDRVYFPKWYLKGSRQSPSHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FL+W+P AL+MPE ELI HAGLDSAVYLRIYL GLKIFVP+ +L++
Sbjct  61   FVNLDMRSYLKFLSWMPAALQMPEDELISHAGLDSAVYLRIYLTGLKIFVPITILAF  117



>emb|CDY32438.1| BnaC03g42220D [Brassica napus]
Length=756

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G L  +
Sbjct  1    MATLSDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGLASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y++FLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A L++
Sbjct  61   FVNLDFRSYIKFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACLAF  117



>emb|CDY08641.1| BnaC04g19500D [Brassica napus]
Length=214

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSP-THSGALLK  405
            MAT ADIG+AA INILTALIFL+ FAI+R+QP NDRVYFPKWYLKGLR SP  + GAL+ 
Sbjct  1    MATLADIGVAAGINILTALIFLLLFAILRIQPFNDRVYFPKWYLKGLRSSPLVNPGALVS  60

Query  406  RFVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            + VNLD+R+Y+RFL+W+P AL+MPE ELI+HAG DSAVYLRIYL+GLKIFVP+ALLSW
Sbjct  61   KIVNLDFRSYIRFLSWMPAALKMPESELIDHAGFDSAVYLRIYLIGLKIFVPIALLSW  118



>ref|XP_004968885.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGL+AAINIL A+IFL+AFA +RLQP+NDRVYFPKWYLKG R+SP+H G  +++
Sbjct  1    MATIKDIGLSAAINILGAIIFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FL+W+P AL+MPE ELI HAGLDSAVYLRIYL+GLKIFVP+ +L++
Sbjct  61   FVNLDMRSYLKFLSWMPAALKMPEDELISHAGLDSAVYLRIYLVGLKIFVPITILAF  117



>ref|XP_010488175.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
 ref|XP_010488176.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG AAAINILTA  F +AFA++RLQPVNDRVYFPKWY+KGLR SP  +G    +
Sbjct  1    MATLSDIGFAAAINILTAFAFFIAFAVLRLQPVNDRVYFPKWYIKGLRSSPIKTGGFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FVNLDFRSYVRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAF  117



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+ +DIGLAAAINIL+A  FL+AFA++R+QP+NDRVYFPKWYLKGLR SP  +G  + +
Sbjct  3    MASLSDIGLAAAINILSAFTFLLAFALLRIQPINDRVYFPKWYLKGLRSSPLQAGLFVSK  62

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+++Y+ FL+W+P AL+MPEPELI+HAGLDSAV+LRIYLLGLKIFVP+A L++
Sbjct  63   FVNLDFKSYISFLSWMPSALQMPEPELIDHAGLDSAVFLRIYLLGLKIFVPIAFLAF  119



>gb|KDP21496.1| hypothetical protein JCGZ_21967 [Jatropha curcas]
Length=755

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA   DI  +AA+NIL+A  FL+AFAI+RLQP+NDRVYFPKWY KG+R SPTHS   + +
Sbjct  1    MANLQDIVYSAAVNILSAFAFLLAFAILRLQPINDRVYFPKWYRKGIRASPTHSRGAVTK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+RFLNW+P ALRMPE ELIEHAGLDS VY+RIYLLGLKIFVP+ +L++
Sbjct  61   FVNLDIRTYIRFLNWMPAALRMPELELIEHAGLDSVVYIRIYLLGLKIFVPITILAF  117



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DIG+AAAINI+TA  FL+AFAI R+QPVNDRVYFPKWYLKGLR S   +G    +
Sbjct  1    MASINDIGVAAAINIVTAFAFLLAFAIFRIQPVNDRVYFPKWYLKGLRTSSIQTGGFGSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+YVRFLNW+P+AL+MPEPEL++HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FINLDFRSYVRFLNWMPEALKMPEPELVDHAGLDSVVYLRIYLLGLKIFFPIACVAF  117



>ref|XP_002874888.1| hypothetical protein ARALYDRAFT_352535 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51147.1| hypothetical protein ARALYDRAFT_352535 [Arabidopsis lyrata subsp. 
lyrata]
Length=776

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  313  RLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPELI  492
            RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P AL+MPEPELI
Sbjct  29   RLQPVNDRVYFPKWYLKGIRGSPTRSRGIMTRFVNLDWTTYVKFLNWMPAALKMPEPELI  88

Query  493  EHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            EHAGLDSAVY+RIYLLGLK+FVP+ LL++
Sbjct  89   EHAGLDSAVYIRIYLLGLKMFVPITLLAF  117



>gb|KDP30779.1| hypothetical protein JCGZ_13722 [Jatropha curcas]
Length=770

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F +AFA++R+QPVNDRVYFPKWY+KGLR SP  +GA + +
Sbjct  1    MATLSDIGVAAAINILTAFAFFLAFAVLRIQPVNDRVYFPKWYIKGLRSSPLGTGAFVGK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            F+NLD+R+Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L++
Sbjct  61   FMNLDFRSYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAF  117



>gb|EMT22148.1| Putative membrane protein [Aegilops tauschii]
Length=770

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFAI+R+QP+NDRVYFPKWYLKG R SP H GA   +FVN D   Y+RFLNW+P AL+M
Sbjct  23   LAFAILRIQPINDRVYFPKWYLKGTRSSPRHIGAGFSKFVNADLSTYLRFLNWMPAALQM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLD+AVY+RIYLLGLKIFVP+ALL++
Sbjct  83   PEPELIEHAGLDAAVYVRIYLLGLKIFVPIALLAF  117



>ref|NP_192199.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q9SY14.1|CSCL2_ARATH RecName: Full=CSC1-like protein At4g02900 [Arabidopsis thaliana]
 gb|AAD15333.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77775.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82248.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34619.1| hyperosmolality-gated Ca2+ permeable channel 1.7 [Arabidopsis 
thaliana]
Length=785

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  313  RLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPELI  492
            RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P AL+MPEPELI
Sbjct  29   RLQPVNDRVYFPKWYLKGIRGSPTRSRGIMTRFVNLDWTTYVKFLNWMPAALQMPEPELI  88

Query  493  EHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            EHAGLDSAVY+RIYLLGLK+FVP+ LL++
Sbjct  89   EHAGLDSAVYIRIYLLGLKMFVPITLLAF  117



>dbj|BAK05559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFAI+R+QP+NDRVYFPKWYLKG R SP H GA   +FVN D   Y+RFLNW+P AL+M
Sbjct  23   LAFAILRIQPINDRVYFPKWYLKGTRSSPRHIGAGFSKFVNADLSTYLRFLNWMPAALQM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLD+AVY+RIYLLGLKIFVP+ALL++
Sbjct  83   PEPELIEHAGLDAAVYVRIYLLGLKIFVPIALLAF  117



>ref|XP_006654360.1| PREDICTED: uncharacterized protein C354.08c-like [Oryza brachyantha]
Length=767

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFA++R+QP+NDRVYFPKWYLKG R SP H G +  +FVN D   Y+RFLNW+P AL+M
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRHLGNVFSKFVNADLSTYIRFLNWMPAALQM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLDSAVY+RIYLLGLKIFVP+A+L++
Sbjct  83   PEPELIEHAGLDSAVYVRIYLLGLKIFVPIAVLAF  117



>ref|XP_009134388.1| PREDICTED: CSC1-like protein At4g02900 [Brassica rapa]
Length=769

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P ALRMPEPE
Sbjct  27   MLRLQPVNDRVYFPKWYLKGIRGSPTRSRGVMNRFVNLDWTTYVKFLNWMPAALRMPEPE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LIEHAGLDSAVY+RIYLLGLK+FVP+ + ++
Sbjct  87   LIEHAGLDSAVYIRIYLLGLKMFVPITVFAF  117



>ref|XP_006396516.1| hypothetical protein EUTSA_v10029277mg, partial [Eutrema salsugineum]
 gb|ESQ37969.1| hypothetical protein EUTSA_v10029277mg, partial [Eutrema salsugineum]
Length=766

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  313  RLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPELI  492
            RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P AL+MPEPELI
Sbjct  29   RLQPVNDRVYFPKWYLKGIRGSPTRSRGIMTRFVNLDWTTYVKFLNWMPAALKMPEPELI  88

Query  493  EHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            EHAGLDSAVY+RIYLLGLK+F+P+ LL++
Sbjct  89   EHAGLDSAVYIRIYLLGLKMFIPITLLAF  117



>emb|CDY17981.1| BnaC03g30530D [Brassica napus]
Length=769

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P ALRMPEPE
Sbjct  27   MLRLQPVNDRVYFPKWYLKGIRGSPTRSRGVMNRFVNLDWTTYVKFLNWMPAALRMPEPE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LIEHAGLDSAVY+RIYLLGLK+FVP+ + ++
Sbjct  87   LIEHAGLDSAVYIRIYLLGLKMFVPITVFAF  117



>ref|XP_006300401.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
 gb|EOA33299.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
Length=774

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIGLAAAINIL+ALIFL+ FAI+R+QP NDRVYFPKWYLKG+R +P  SGA + +
Sbjct  1    MATLSDIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSNPLTSGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+Y+RFLNW+P AL+MPEPELI+HAGLDSAVYLRIY++GLKIFVP+ALLSW
Sbjct  61   VVNLDFRSYIRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYMIGLKIFVPIALLSW  117



>ref|NP_188799.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9LVE4.1|CSCL4_ARATH RecName: Full=CSC1-like protein At3g21620 [Arabidopsis thaliana]
 dbj|BAB02357.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76531.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34617.1| hyperosmolality-gated Ca2+ permeable channel 1.5 [Arabidopsis 
thaliana]
Length=756

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AA INILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G    +
Sbjct  1    MATLTDIGVAATINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAF  117



>gb|EYU38139.1| hypothetical protein MIMGU_mgv1a022024mg [Erythranthe guttata]
Length=761

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI  +A IN+L+ L+FL+ FA +RLQP+NDRVYFPKWYLKG+R+SP  SG L+K+
Sbjct  1    MASLQDIATSAYINLLSVLMFLLGFAFLRLQPINDRVYFPKWYLKGIRESPNKSGTLVKK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD++ Y+ F NW+P ALRMPE ELI+HAGLDS VY+RIYLLGLKIFVP+A+LS+
Sbjct  61   FVNLDFKTYLFFWNWMPAALRMPESELIDHAGLDSVVYIRIYLLGLKIFVPIAILSF  117



>ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
 gb|ESQ47703.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
Length=757

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  SG    +
Sbjct  1    MATLNDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKSGGFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAF  117



>ref|XP_009765629.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765630.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
sylvestris]
Length=620

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            I+RLQP+NDRVYFPKWYLKG+R SP  SGA   +FVNLD+R Y+RFLNW+P AL+MPE E
Sbjct  27   IVRLQPINDRVYFPKWYLKGIRASPRSSGAFGNKFVNLDFRTYIRFLNWMPAALKMPEQE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LI+HAGLDSAVY+RIYLLGLKIFVP+ +LS+
Sbjct  87   LIDHAGLDSAVYIRIYLLGLKIFVPITMLSF  117



>gb|KHG17938.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=756

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA+  DI  +A+IN+L+A  FL+AFAI+R+QP NDRVYFP+WY KG R SPT SGA   +
Sbjct  1    MASLRDIVTSASINLLSAFGFLMAFAILRIQPFNDRVYFPRWYKKGTRSSPTRSGAYASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R Y+ FLNW+P ALRMPEPELI+HAGLDS  Y+RIYLLGLKIFVPLA+LS+
Sbjct  61   FVNLDCRTYLNFLNWMPAALRMPEPELIDHAGLDSVAYIRIYLLGLKIFVPLAVLSF  117



>ref|XP_009356857.1| PREDICTED: CSC1-like protein At4g02900 [Pyrus x bretschneideri]
Length=757

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MA F DI ++AAINIL+A  FL AF ++R+QPV DRVYFPKWYLKG+R SPT SGA +++
Sbjct  1    MANFQDIMMSAAINILSAFGFLAAFGLLRVQPVIDRVYFPKWYLKGMRGSPTSSGATVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLS  576
            FVNLD + Y++FLNW+P ALRMPEPELI+HAGLDSA Y+RIY+LGLKIFVP+  L+
Sbjct  61   FVNLDAKTYLKFLNWMPAALRMPEPELIDHAGLDSAAYIRIYVLGLKIFVPITTLA  116



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG+AAAINILTA  F  AFAI+R+QPVNDRVYFPKWY+KGLR SP  +GA + +
Sbjct  1    MATLSDIGVAAAINILTAFAFFFAFAILRIQPVNDRVYFPKWYIKGLRSSPFGTGAFVGK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
             VNLD+R+YVRFLNW+P AL MPEPELI+HAGLDSAVYLRIYL+GLKIFVP+A L++
Sbjct  61   VVNLDFRSYVRFLNWMPAALHMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIAFLAF  117



>ref|XP_010466415.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT +DIG AAAINILTA  F +AFAI+RLQPVNDRVYFPKWY+KGLR SP  +G    +
Sbjct  1    MATLSDIGFAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYIKGLRSSPIKTGGFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+YVRFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FVNLDFRSYVRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAF  117



>ref|XP_006299035.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
 gb|EOA31933.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
Length=756

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINILTA  F +AFA +RLQPVNDRVYFPKWYLKGLR SP  +G    +
Sbjct  1    MATLNDIGVAAAINILTAFAFFIAFAFLRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAF  117



>ref|XP_002885454.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61713.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINILTA  F +AFAI+RLQPVNDRVYFPKWYLKGLR SP  +G    +
Sbjct  1    MATLNDIGVAAAINILTAFAFFIAFAILRLQPVNDRVYFPKWYLKGLRSSPIKTGGFASK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+R+Y+RFLNW+P ALRMPEPELI+HAGLDS VYLRIYLLGLKIF P+A +++
Sbjct  61   FVNLDFRSYIRFLNWMPQALRMPEPELIDHAGLDSVVYLRIYLLGLKIFFPIACIAF  117



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFA++R+QP+NDRVYFPKWYLKG R SP   G +L +FVN D   Y+RFLNW+P AL+M
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRSIGTVLSKFVNADLSTYIRFLNWMPAALQM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLDSAVY+RIYLLGLKIFVP+A+L++
Sbjct  83   PEPELIEHAGLDSAVYVRIYLLGLKIFVPIAVLAF  117



>ref|XP_002457968.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
 gb|EES03088.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
Length=768

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGL+AAINIL A++FL+AFA +RLQP+NDRVYFPKWYLKG R+SP+H G  +++
Sbjct  1    MATIQDIGLSAAINILGAVVFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGTFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++FL+W+P AL+MPE ELI H+GLDSAVYLRIYL+GLKIF P+++L++
Sbjct  61   FVNLDMRSYLKFLSWMPAALKMPEDELISHSGLDSAVYLRIYLVGLKIFAPISVLAF  117



>gb|AAM74515.1| hv711N16.16 [Hordeum vulgare subsp. vulgare]
Length=234

 Score =   144 bits (363),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIGL A  NIL A IFL+ FA +RLQP+NDR++FPKWYLKG+RDSP+ +GA + +
Sbjct  1    MATIYDIGLGAGFNILMATIFLLIFAFLRLQPINDRIFFPKWYLKGMRDSPSSAGAAVTK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            +VNL+ R+Y++FL+W+P AL+MPE ELIEHAGLDS VYLRIYL GLKIFVP+ +L++
Sbjct  61   YVNLNVRSYLKFLSWMPAALKMPEEELIEHAGLDSVVYLRIYLTGLKIFVPITILAF  117



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG+AAAINIL+A  F +AFAI+R+QPVNDRVYFPKWYLKGLR SP  +GA + +
Sbjct  1    MATLNDIGVAAAINILSAFAFFLAFAILRIQPVNDRVYFPKWYLKGLRSSPLANGAFVSK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+YVRFLNW+P AL+MPEPELI+HAGLDSAVYLRIY+LGLKIF P+A L++
Sbjct  61   FVNLDLRSYVRFLNWMPAALQMPEPELIDHAGLDSAVYLRIYMLGLKIFGPIAFLAF  117



>emb|CDX90914.1| BnaA03g25940D [Brassica napus]
Length=769

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQP+NDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P ALRMPEPE
Sbjct  27   MLRLQPLNDRVYFPKWYLKGIRGSPTRSRGVMNRFVNLDWTTYVKFLNWMPAALRMPEPE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LIEHAGLDSAVY+RIYLLGLK+FVP+ + ++
Sbjct  87   LIEHAGLDSAVYIRIYLLGLKMFVPITVFAF  117



>ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group]
 gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group]
 gb|AIU34628.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Oryza sativa]
Length=768

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++AAINIL+A+ FL+AFA +RLQP+NDRVYFPKWYLKG R+SP+H GA +++
Sbjct  1    MATIQDIGVSAAINILSAITFLLAFAFLRLQPINDRVYFPKWYLKGARESPSHGGAFVRK  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD R+Y++ L+W+P AL+MPE ELI HAGLDSAVYLRIYL+GLKIF P+ +L++
Sbjct  61   FVNLDMRSYLKVLSWMPAALKMPEDELISHAGLDSAVYLRIYLIGLKIFAPITVLAF  117



>ref|XP_009108550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
 ref|XP_009108551.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
Length=774

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A IF + FAI+RLQP NDRVYF KWYLKGLR SPT  GA ++R
Sbjct  1    MATLQDIGVSAGINILSAFIFFIIFAILRLQPFNDRVYFSKWYLKGLRSSPTRGGAFVQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD+RAY++FLNW+P AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDFRAYLKFLNWMPQALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAW  117



>ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  310  IRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPEL  489
            +R+QPVNDRVYFPKWYLKGLR SP   GA + +FVNLD+R+YVRFLNW+P AL+MPEPEL
Sbjct  28   LRIQPVNDRVYFPKWYLKGLRFSPLRGGAFINKFVNLDFRSYVRFLNWMPAALQMPEPEL  87

Query  490  IEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            I+HAGLDSAVYLRIYL GLKIF P+A LS+
Sbjct  88   IDHAGLDSAVYLRIYLTGLKIFTPIAFLSF  117



>emb|CDX76386.1| BnaA08g10140D [Brassica napus]
Length=699

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +1

Query  229  MATFADiglaaainiltaliflVAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKR  408
            MAT  DIG++A INIL+A IF + FAI+RLQP NDRVYF KWYLKGLR SPT  GA ++R
Sbjct  1    MATLQDIGVSAGINILSAFIFFIIFAILRLQPFNDRVYFSKWYLKGLRSSPTRGGAFVQR  60

Query  409  FVNLDWRAYVRFLNWVPDALRMPEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            FVNLD RAY++FLNW+P AL+MPEPELI+HAGLDS VYLRIY LGLKIF P+A+L+W
Sbjct  61   FVNLDLRAYLKFLNWMPQALKMPEPELIDHAGLDSVVYLRIYWLGLKIFAPIAVLAW  117



>gb|AFW78070.1| hypothetical protein ZEAMMB73_829601 [Zea mays]
Length=748

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFA++R+QP+NDRVYFPKWYLKG R SP   G +  +FVN D+  Y+RFLNW+P AL+M
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRQLGNVFLKFVNADFSTYIRFLNWMPAALKM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLDSAVY+RIYLLGLKIFVP+ALL++
Sbjct  83   PEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAF  117



>ref|XP_002441130.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
 gb|EES19560.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
Length=768

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFA++R+QP+NDRVYFPKWYLKG R SP   G    +FVN D   Y+RFLNW+P AL+M
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRQLGTAFSKFVNADLSTYIRFLNWMPAALKM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLDSAVY+RIYLLGLKIFVP+ALL++
Sbjct  83   PEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAF  117



>gb|EMT11783.1| Putative membrane protein [Aegilops tauschii]
Length=792

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  301  FAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPE  480
            FA++R+QP+NDRVYFPKWYLKG R SP H G +L +FVN D   Y+RFLNW+P AL+MPE
Sbjct  25   FAVVRIQPINDRVYFPKWYLKGTRSSPRHIGNVLSKFVNADVSTYLRFLNWMPAALKMPE  84

Query  481  PELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PELIEHAGLDSAVY+RIYLLGLKIFVP+ +L++
Sbjct  85   PELIEHAGLDSAVYVRIYLLGLKIFVPITVLAF  117



>gb|EMS63788.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=792

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +1

Query  301  FAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPE  480
            FA++R+QP+NDRVYFPKWYLKG R SP H G +L +FVN D   Y+RFLNW+P AL+MPE
Sbjct  25   FAVVRIQPINDRVYFPKWYLKGTRSSPRHIGNVLSKFVNADVSTYLRFLNWMPAALKMPE  84

Query  481  PELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PELIEHAGLDSAVY+RIYLLGLKIFVP+ +L++
Sbjct  85   PELIEHAGLDSAVYVRIYLLGLKIFVPITVLAF  117



>ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group]
 gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group]
 dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34630.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Oryza sativa]
Length=767

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFA++R+QP+NDRVYFPKWYLKG R SP   G +  +FVN D   Y+RFLNW+P AL+M
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRSMGTVFSKFVNADLSTYIRFLNWMPAALQM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLDSAVY+RIYLLGLKIFVP+A+L++
Sbjct  83   PEPELIEHAGLDSAVYVRIYLLGLKIFVPIAVLAF  117



>ref|XP_008649660.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Zea mays]
Length=768

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFA++R+QP+NDRVYFPKWYLKG R SP   G +  +FVN D+  Y+RFLNW+P AL+M
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRQLGNVFLKFVNADFSTYIRFLNWMPAALKM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLDSAVY+RIYLLGLKIFVP+ALL++
Sbjct  83   PEPELIEHAGLDSAVYVRIYLLGLKIFVPIALLAF  117



>gb|EAY97938.1| hypothetical protein OsI_19855 [Oryza sativa Indica Group]
 gb|EEE63624.1| hypothetical protein OsJ_18441 [Oryza sativa Japonica Group]
Length=783

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  295  VAFAIIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRM  474
            +AFA++R+QP+NDRVYFPKWYLKG R SP   G +  +FVN D   Y+RFLNW+P AL+M
Sbjct  23   LAFAVLRIQPINDRVYFPKWYLKGTRSSPRSMGTVFSKFVNADLSTYIRFLNWMPAALQM  82

Query  475  PEPELIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            PEPELIEHAGLDSAVY+RIYLLGLKIFVP+A+L++
Sbjct  83   PEPELIEHAGLDSAVYVRIYLLGLKIFVPIAVLAF  117



>ref|XP_010455942.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Camelina sativa]
Length=770

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  307  IIRLQPVNDRVYFPKWYLKGLRDSPTHSGALLKRFVNLDWRAYVRFLNWVPDALRMPEPE  486
            ++RLQPVNDRVYFPKWYLKG+R SPT S  ++ RFVNLDW  YV+FLNW+P AL+MPE E
Sbjct  27   MLRLQPVNDRVYFPKWYLKGIRGSPTRSRGIMNRFVNLDWTTYVKFLNWMPAALQMPELE  86

Query  487  LIEHAGLDSAVYLRIYLLGLKIFVPLALLSW  579
            LIEHAGLDSAVY+RIYLLGLK+FVP+ LL++
Sbjct  87   LIEHAGLDSAVYIRIYLLGLKMFVPITLLAF  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220