BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS149D04

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011085831.1|  PREDICTED: uncharacterized protein LOC105167710    171   5e-45   Sesamum indicum [beniseed]
ref|XP_009757332.1|  PREDICTED: uncharacterized protein LOC104210199    161   1e-42   Nicotiana sylvestris
ref|XP_009607185.1|  PREDICTED: uncharacterized protein LOC104101...    162   8e-42   Nicotiana tomentosiformis
gb|EYU38293.1|  hypothetical protein MIMGU_mgv1a000507mg                158   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_010327355.1|  PREDICTED: uncharacterized protein LOC101244034    149   3e-37   
ref|XP_007010860.1|  Uncharacterized protein TCM_044838                 149   4e-37   
ref|XP_009122394.1|  PREDICTED: uncharacterized protein LOC103847103    147   9e-37   Brassica rapa
ref|XP_006347850.1|  PREDICTED: uncharacterized protein LOC102587911    143   4e-35   
ref|XP_011000612.1|  PREDICTED: uncharacterized protein LOC105108123    142   6e-35   Populus euphratica
emb|CDP19070.1|  unnamed protein product                                142   7e-35   Coffea canephora [robusta coffee]
ref|XP_002297735.2|  hypothetical protein POPTR_0001s06740g             142   7e-35   
ref|XP_011469346.1|  PREDICTED: uncharacterized protein LOC101297291    140   2e-34   Fragaria vesca subsp. vesca
ref|XP_002873288.1|  hypothetical protein ARALYDRAFT_487516             139   5e-34   
gb|KDP40553.1|  hypothetical protein JCGZ_24552                         139   6e-34   Jatropha curcas
ref|XP_010271764.1|  PREDICTED: uncharacterized protein LOC104607768    139   6e-34   Nelumbo nucifera [Indian lotus]
ref|XP_002262850.2|  PREDICTED: uncharacterized protein LOC100248...    139   9e-34   Vitis vinifera
ref|XP_006289500.1|  hypothetical protein CARUB_v10003033mg             138   1e-33   Capsella rubella
ref|XP_008231635.1|  PREDICTED: uncharacterized protein LOC103330800    138   1e-33   Prunus mume [ume]
ref|XP_010031019.1|  PREDICTED: uncharacterized protein LOC104420940    138   2e-33   Eucalyptus grandis [rose gum]
gb|KCW50282.1|  hypothetical protein EUGRSUZ_J00067                     137   3e-33   Eucalyptus grandis [rose gum]
ref|XP_008347916.1|  PREDICTED: uncharacterized protein LOC103411044    137   3e-33   
ref|XP_010423269.1|  PREDICTED: uncharacterized protein LOC104708406    137   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010491294.1|  PREDICTED: uncharacterized protein LOC104768901    137   3e-33   
ref|XP_010452646.1|  PREDICTED: uncharacterized protein LOC104734710    137   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006432420.1|  hypothetical protein CICLE_v10003518mg             134   4e-33   
ref|XP_009372788.1|  PREDICTED: uncharacterized protein LOC103961...    137   5e-33   
emb|CBI35103.3|  unnamed protein product                                137   5e-33   Vitis vinifera
ref|XP_009372787.1|  PREDICTED: uncharacterized protein LOC103961...    136   6e-33   Pyrus x bretschneideri [bai li]
dbj|BAB11155.1|  unnamed protein product                                136   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196314.2|  Munc13-like protein PATROL1                           136   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006465766.1|  PREDICTED: uncharacterized protein LOC102609518    135   2e-32   Citrus sinensis [apfelsine]
gb|KJB60292.1|  hypothetical protein B456_009G298800                    134   4e-32   Gossypium raimondii
gb|KJB60295.1|  hypothetical protein B456_009G298800                    134   4e-32   Gossypium raimondii
gb|KJB60290.1|  hypothetical protein B456_009G298800                    134   5e-32   Gossypium raimondii
gb|KJB60291.1|  hypothetical protein B456_009G298800                    134   5e-32   Gossypium raimondii
ref|XP_007220320.1|  hypothetical protein PRUPE_ppa000533m1g            133   9e-32   
gb|KHG28626.1|  Error-prone DNA polymerase 2                            132   1e-31   Gossypium arboreum [tree cotton]
ref|XP_008447022.1|  PREDICTED: uncharacterized protein LOC103489571    131   3e-31   Cucumis melo [Oriental melon]
gb|KGN52336.1|  hypothetical protein Csa_5G625960                       129   3e-31   Cucumis sativus [cucumbers]
ref|XP_007133697.1|  hypothetical protein PHAVU_011G201400g             131   4e-31   Phaseolus vulgaris [French bean]
gb|EPS69825.1|  hypothetical protein M569_04933                         131   4e-31   Genlisea aurea
ref|XP_002513024.1|  conserved hypothetical protein                     131   5e-31   
ref|XP_004142381.1|  PREDICTED: uncharacterized protein LOC101216236    130   9e-31   Cucumis sativus [cucumbers]
ref|XP_004157545.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   1e-30   
ref|XP_006598088.1|  PREDICTED: uncharacterized protein LOC100780...    130   1e-30   Glycine max [soybeans]
ref|XP_003627933.1|  hypothetical protein MTR_8g040190                  130   1e-30   Medicago truncatula
ref|XP_010923482.1|  PREDICTED: uncharacterized protein LOC105046...    127   7e-30   
ref|XP_010923473.1|  PREDICTED: uncharacterized protein LOC105046...    127   1e-29   Elaeis guineensis
ref|XP_010923464.1|  PREDICTED: uncharacterized protein LOC105046...    127   1e-29   Elaeis guineensis
ref|XP_008791229.1|  PREDICTED: uncharacterized protein LOC103708...    126   2e-29   Phoenix dactylifera
ref|XP_008791232.1|  PREDICTED: uncharacterized protein LOC103708...    126   2e-29   
ref|XP_010670525.1|  PREDICTED: uncharacterized protein LOC104887...    125   3e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010520076.1|  PREDICTED: uncharacterized protein LOC104799...    125   3e-29   
ref|XP_010520074.1|  PREDICTED: uncharacterized protein LOC104799...    125   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_009380582.1|  PREDICTED: uncharacterized protein LOC103968937    125   6e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004511052.1|  PREDICTED: uncharacterized protein LOC101495068    123   3e-28   Cicer arietinum [garbanzo]
ref|NP_001050913.1|  Os03g0683700                                       121   1e-27   
ref|XP_006660850.1|  PREDICTED: uncharacterized protein LOC102711458    121   1e-27   Oryza brachyantha
ref|XP_004957372.1|  PREDICTED: uncharacterized protein LOC101769141    119   5e-27   Setaria italica
ref|XP_002440996.1|  hypothetical protein SORBIDRAFT_09g018670          119   5e-27   Sorghum bicolor [broomcorn]
ref|XP_006594370.1|  PREDICTED: uncharacterized protein LOC100813299    118   1e-26   Glycine max [soybeans]
gb|AFW77581.1|  hypothetical protein ZEAMMB73_404536                    117   2e-26   
gb|AFW77583.1|  hypothetical protein ZEAMMB73_404536                    117   2e-26   
gb|AFW77582.1|  hypothetical protein ZEAMMB73_404536                    117   2e-26   
ref|XP_008649491.1|  PREDICTED: uncharacterized protein LOC103630192    117   2e-26   Zea mays [maize]
gb|EEE59706.1|  hypothetical protein OsJ_12133                          117   3e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75950.1|  hypothetical protein OsI_13051                          116   5e-26   Oryza sativa Indica Group [Indian rice]
dbj|BAJ99465.1|  predicted protein                                      115   9e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN37720.1|  hypothetical protein glysoja_007423                     112   1e-24   Glycine soja [wild soybean]
gb|EMT16861.1|  hypothetical protein F775_17073                         110   2e-24   
ref|XP_003562639.1|  PREDICTED: uncharacterized protein LOC100836004    109   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_006399173.1|  hypothetical protein EUTSA_v10012512mg             107   8e-23   
ref|XP_009361890.1|  PREDICTED: uncharacterized protein LOC103952085    104   8e-22   Pyrus x bretschneideri [bai li]
ref|XP_008375352.1|  PREDICTED: uncharacterized protein LOC103438600    104   8e-22   
emb|CDX69997.1|  BnaA10g23460D                                        96.3    5e-19   
emb|CDX99020.1|  BnaC09g48150D                                        96.3    5e-19   
ref|XP_002969734.1|  hypothetical protein SELMODRAFT_92955            93.2    5e-18   
ref|XP_002981341.1|  hypothetical protein SELMODRAFT_114286           93.2    5e-18   
ref|XP_001784497.1|  predicted protein                                88.6    2e-16   
gb|AAK14418.1|AC087851_10  unknown protein                            83.6    7e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAP68377.1|  unknown protein                                       83.6    9e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097919.1|  hypothetical protein L484_009353                 80.5    4e-14   
gb|KDO58841.1|  hypothetical protein CISIN_1g0427012mg                72.4    3e-13   Citrus sinensis [apfelsine]
ref|XP_010659085.1|  PREDICTED: uncharacterized protein LOC100248...  74.3    8e-12   Vitis vinifera
ref|XP_006857850.1|  hypothetical protein AMTR_s00069p00066350        72.4    4e-11   
gb|KHG00578.1|  DNA topoisomerase 4 subunit B                         72.0    5e-11   Gossypium arboreum [tree cotton]
gb|KJB20716.1|  hypothetical protein B456_003G160900                  70.5    1e-10   Gossypium raimondii
ref|XP_006832844.1|  hypothetical protein AMTR_s00095p00045160        68.9    5e-10   
gb|KDO63534.1|  hypothetical protein CISIN_1g037655mg                 67.4    1e-09   Citrus sinensis [apfelsine]
ref|XP_006440565.1|  hypothetical protein CICLE_v10023740mg           67.4    1e-09   
ref|XP_006477424.1|  PREDICTED: uncharacterized protein LOC102618...  66.6    2e-09   
ref|XP_006477423.1|  PREDICTED: uncharacterized protein LOC102618...  67.0    2e-09   Citrus sinensis [apfelsine]
ref|XP_006358878.1|  PREDICTED: uncharacterized protein LOC102581574  66.2    3e-09   Solanum tuberosum [potatoes]
ref|XP_007211313.1|  hypothetical protein PRUPE_ppa000534mg           65.9    4e-09   
ref|XP_011029216.1|  PREDICTED: uncharacterized protein LOC105129...  65.9    4e-09   Populus euphratica
ref|XP_011029211.1|  PREDICTED: uncharacterized protein LOC105129...  65.9    4e-09   Populus euphratica
gb|KDO58842.1|  hypothetical protein CISIN_1g0427013mg                65.1    5e-09   Citrus sinensis [apfelsine]
ref|XP_008238821.1|  PREDICTED: uncharacterized protein LOC103337442  63.5    2e-08   Prunus mume [ume]
ref|XP_009770723.1|  PREDICTED: uncharacterized protein LOC104221...  63.2    3e-08   Nicotiana sylvestris
ref|XP_009770724.1|  PREDICTED: uncharacterized protein LOC104221...  63.2    3e-08   Nicotiana sylvestris
ref|XP_010325425.1|  PREDICTED: uncharacterized protein LOC101264...  62.8    4e-08   
ref|XP_010325424.1|  PREDICTED: uncharacterized protein LOC101264...  62.8    4e-08   Solanum lycopersicum
ref|XP_009621421.1|  PREDICTED: uncharacterized protein LOC104113...  62.4    5e-08   Nicotiana tomentosiformis
ref|XP_011029209.1|  PREDICTED: uncharacterized protein LOC105129...  62.0    8e-08   Populus euphratica
ref|XP_007040146.1|  Uncharacterized protein isoform 1                61.2    1e-07   
ref|XP_011029210.1|  PREDICTED: uncharacterized protein LOC105129...  61.2    1e-07   Populus euphratica
gb|EMS65553.1|  hypothetical protein TRIUR3_20845                     61.2    1e-07   Triticum urartu
ref|XP_010670526.1|  PREDICTED: uncharacterized protein LOC104887...  59.7    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008392392.1|  PREDICTED: uncharacterized protein LOC103454...  59.7    4e-07   
ref|XP_008392393.1|  PREDICTED: uncharacterized protein LOC103454...  59.3    5e-07   
emb|CDP09793.1|  unnamed protein product                              59.3    6e-07   Coffea canephora [robusta coffee]
ref|XP_009369020.1|  PREDICTED: uncharacterized protein LOC103958485  59.3    6e-07   Pyrus x bretschneideri [bai li]
ref|XP_011081012.1|  PREDICTED: uncharacterized protein LOC105164...  57.8    2e-06   Sesamum indicum [beniseed]
ref|XP_011081013.1|  PREDICTED: uncharacterized protein LOC105164...  57.8    2e-06   Sesamum indicum [beniseed]
ref|XP_004159523.1|  PREDICTED: uncharacterized LOC101213131          57.0    2e-06   
ref|XP_011029208.1|  PREDICTED: uncharacterized protein LOC105129...  57.4    2e-06   Populus euphratica
ref|XP_011029212.1|  PREDICTED: uncharacterized protein LOC105129...  57.4    2e-06   Populus euphratica
ref|XP_010278592.1|  PREDICTED: uncharacterized protein LOC104612733  57.0    3e-06   
gb|KFK31929.1|  hypothetical protein AALP_AA6G177300                  57.0    3e-06   Arabis alpina [alpine rockcress]
gb|KFK31928.1|  hypothetical protein AALP_AA6G177300                  56.6    3e-06   Arabis alpina [alpine rockcress]
ref|XP_004147987.1|  PREDICTED: uncharacterized protein LOC101213131  56.6    4e-06   Cucumis sativus [cucumbers]
ref|XP_002509741.1|  conserved hypothetical protein                   55.5    8e-06   
ref|XP_008448959.1|  PREDICTED: uncharacterized protein LOC103490971  55.5    9e-06   Cucumis melo [Oriental melon]
ref|XP_006286936.1|  hypothetical protein CARUB_v10000081mg           55.5    1e-05   Capsella rubella
ref|NP_192904.5|  uncharacterized protein                             53.9    3e-05   
ref|XP_002276624.2|  PREDICTED: uncharacterized protein LOC100259...  51.6    2e-04   Vitis vinifera
emb|CAN82269.1|  hypothetical protein VITISV_009287                   50.8    2e-04   Vitis vinifera
ref|XP_009124796.1|  PREDICTED: uncharacterized protein LOC103849...  51.2    3e-04   Brassica rapa
emb|CBI34727.3|  unnamed protein product                              51.2    3e-04   Vitis vinifera
emb|CDX86760.1|  BnaA09g21500D                                        51.2    3e-04   
ref|XP_006396866.1|  hypothetical protein EUTSA_v100283711mg          50.1    5e-04   
emb|CDY70879.1|  BnaCnng70160D                                        49.7    5e-04   Brassica napus [oilseed rape]



>ref|XP_011085831.1| PREDICTED: uncharacterized protein LOC105167710 [Sesamum indicum]
Length=1108

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDRRVLL+F+LSGSL+KKVVMPPGAVSLDDVDLDQVSVDYVLNC K
Sbjct  1    MDEENEVELLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVSLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGGMLEL+EAIRDYHD+TLFPSVNNAG+T EFFL T+P +SGSPPRRAPP VPV  P PI
Sbjct  61   KGGMLELSEAIRDYHDATLFPSVNNAGSTDEFFLVTDPTASGSPPRRAPPSVPVVVPTPI  120

Query  500  lptLSTEEPLDSMSVEEQSPLSKSQSL-TSQVRELTV  607
            L +LS  EPL+S  +EE   L KSQSL +SQV+ELTV
Sbjct  121  LSSLSISEPLESEQLEESPSLLKSQSLNSSQVKELTV  157



>ref|XP_009757332.1| PREDICTED: uncharacterized protein LOC104210199 [Nicotiana sylvestris]
 ref|XP_009757333.1| PREDICTED: uncharacterized protein LOC104210199 [Nicotiana sylvestris]
 ref|XP_009757334.1| PREDICTED: uncharacterized protein LOC104210199 [Nicotiana sylvestris]
Length=611

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN  EL+QR+RRDRR+LLNF+LSGSL+KKVVMPPGAVSLDDVDLDQVSVD+VLNC +
Sbjct  1    MEEENDTELLQRFRRDRRILLNFILSGSLIKKVVMPPGAVSLDDVDLDQVSVDFVLNCAR  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGG+LEL+EAIRDYHDSTLFP ++NAG+T EFFLATNPE SGSPPRR PP VPVATPLP 
Sbjct  61   KGGLLELSEAIRDYHDSTLFPHMSNAGSTDEFFLATNPELSGSPPRRLPPLVPVATPLPN  120

Query  500  lptLSTEEPLDSMSVEEQSPLSKSQSLTS-QVRELT  604
            L TLST E +D+   EE S LSKS SL S Q +ELT
Sbjct  121  LATLSTSESVDTEPFEEPSSLSKSMSLNSTQQQELT  156



>ref|XP_009607185.1| PREDICTED: uncharacterized protein LOC104101449 isoform X1 [Nicotiana 
tomentosiformis]
Length=1109

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN  EL+QR+RRDRR+LLNF+LSGSL+KKVVMPPGAVSLDDVDLDQVSVD+VLNC +
Sbjct  1    MEEENDTELLQRFRRDRRILLNFILSGSLIKKVVMPPGAVSLDDVDLDQVSVDFVLNCAR  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGG+LEL+EAIRDYHDSTLFP ++NAG+T EFFLATNPE SGSPPRR PP VPVATPLP 
Sbjct  61   KGGLLELSEAIRDYHDSTLFPHMSNAGSTDEFFLATNPELSGSPPRRLPPLVPVATPLPN  120

Query  500  lptLSTEEPLDSMSVEEQSPLSKSQSLTS-QVRELT  604
            L TLST E +D+   EE S LSKS SL S Q +ELT
Sbjct  121  LATLSTSESVDTEPFEEPSSLSKSMSLNSTQQQELT  156



>gb|EYU38293.1| hypothetical protein MIMGU_mgv1a000507mg [Erythranthe guttata]
Length=1108

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN +EL+QR+RRDRRVL++F+LS SL+KKVVMPPGAVSLDDVDLDQVSVDYVLNC K
Sbjct  1    MDEENEIELLQRFRRDRRVLIDFILSSSLIKKVVMPPGAVSLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KG MLEL+EAIRDYHD T FP+VN+AG++ EFFL TNPESSGSPPRRAPPPV V  P  I
Sbjct  61   KGDMLELSEAIRDYHDGTCFPTVNSAGSSDEFFLVTNPESSGSPPRRAPPPVSVGIPTTI  120

Query  500  lptLSTEEPLDSMSVEEQSPLSKSQSLTS-QVRELTV  607
              +LS  EP++S  V+E +  SKSQSL S QV ELTV
Sbjct  121  FSSLSASEPMESEQVDESASFSKSQSLKSAQVNELTV  157



>ref|XP_010327355.1| PREDICTED: uncharacterized protein LOC101244034 [Solanum lycopersicum]
 ref|XP_010327359.1| PREDICTED: uncharacterized protein LOC101244034 [Solanum lycopersicum]
Length=1110

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QR+RRDRR+LLNF+LSGSL+KKV MPPGAVSL+DVDLDQVSVD+VLNC +
Sbjct  1    MEEENSIELLQRFRRDRRILLNFILSGSLIKKVAMPPGAVSLEDVDLDQVSVDFVLNCAR  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGG+LEL+EAIRDYHDSTLFP ++NAG+T EFFLATNPE SG PPRR PPPVP++TP PI
Sbjct  61   KGGLLELSEAIRDYHDSTLFPHMSNAGSTDEFFLATNPEQSGLPPRRLPPPVPISTPSPI  120

Query  500  lptLSTEEPLDSMSVEE  550
            LPTLST E +D+   EE
Sbjct  121  LPTLSTSESIDTEPFEE  137



>ref|XP_007010860.1| Uncharacterized protein TCM_044838 [Theobroma cacao]
 gb|EOY19670.1| Uncharacterized protein TCM_044838 [Theobroma cacao]
Length=1095

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 122/168 (73%), Gaps = 15/168 (9%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EE  VEL+QRYRRDR++LL+F+LSGSLVKKVVMPPGAV+LDDVDLDQVSVDYVL+CIK
Sbjct  1    MDEETAVELLQRYRRDRQILLDFILSGSLVKKVVMPPGAVTLDDVDLDQVSVDYVLSCIK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGGMLEL+EAIRDYHD T  P +N+AG+  EFFL TN ESSGS               P 
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNSAGSAGEFFLVTNTESSGS----------PPRRAPP  110

Query  500  lptLSTEEPLDSMSVEEQSP----LSKSQSLTS-QVRELTVDDIDDFD  628
               +S   P  S  V   SP    +S+S+S  S QV+ELTVDDI+DF+
Sbjct  111  PIPVSVSIPTPSAPVFAPSPVLPTVSRSESFDSEQVQELTVDDIEDFE  158



>ref|XP_009122394.1| PREDICTED: uncharacterized protein LOC103847103 [Brassica rapa]
Length=1100

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ VE++QRYRRDRR LL+FML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEESAVEILQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGGMLEL+EAIRDYHD +  P +N+ G   +FFLAT PESSGSPP+RAPPP+P+ T    
Sbjct  61   KGGMLELSEAIRDYHDHSGLPYMNSVGTADDFFLATTPESSGSPPKRAPPPIPILTSASS  120

Query  500  lptLSTEEPLDSMSVEEQSPLSKSQSLTS-QVRELTVDDIDDFDD  631
                +  E  +S S     PL +S+S+ S   +ELTVDDI+DF+D
Sbjct  121  SSIPTNPEWCESPSA---PPLMRSESIDSPHAQELTVDDIEDFED  162



>ref|XP_006347850.1| PREDICTED: uncharacterized protein LOC102587911, partial [Solanum 
tuberosum]
Length=1122

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGG  328
            EN +EL+QR+RRDRR+LLNF+LSGSL+KKVVMPPGAVSL+DVDLDQVSVD+VLNC +KGG
Sbjct  16   ENSIELLQRFRRDRRILLNFILSGSLIKKVVMPPGAVSLEDVDLDQVSVDFVLNCARKGG  75

Query  329  MLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpilpt  508
            +LEL+EAIRDYHDSTLFP ++NAG+T EFFLATNPE SG PPRR PPPVP++T  PILPT
Sbjct  76   LLELSEAIRDYHDSTLFPHMSNAGSTDEFFLATNPEQSGLPPRRLPPPVPISTLSPILPT  135

Query  509  LSTEEPLD  532
            LST E +D
Sbjct  136  LSTSESID  143



>ref|XP_011000612.1| PREDICTED: uncharacterized protein LOC105108123 [Populus euphratica]
Length=1105

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDRRVLL++MLSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC+K
Sbjct  1    MEEENALELLQRYRRDRRVLLDYMLSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCVK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD+T  P +NN G+  EFFL T PE+SGS
Sbjct  61   KGGMLELSEAIRDYHDNTGLPHMNNTGSVDEFFLVTKPETSGS  103



>emb|CDP19070.1| unnamed protein product [Coffea canephora]
Length=1110

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE  V ++QRYRRDRRVLL+F+LSGSL+KKVVMPPGAVSLDDVDLDQVSVD++LNC K
Sbjct  1    MEEEGVVGVLQRYRRDRRVLLSFILSGSLIKKVVMPPGAVSLDDVDLDQVSVDHILNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KG ML+L+EAIR YHDSTLFP++N AG   EFFL T+P SSGSPPRR PP +    P PI
Sbjct  61   KGEMLDLSEAIRVYHDSTLFPNMNKAGPADEFFLVTDPISSGSPPRREPPLLHSIMPSPI  120

Query  500  lptLSTEEPLDSMSVEEQSPLSKSQSLTS-QVRELTV  607
            LP+L+T + LDS   E    LSKSQSL S QV+ELT+
Sbjct  121  LPSLATPKTLDSAEDENLLNLSKSQSLNSTQVQELTI  157



>ref|XP_002297735.2| hypothetical protein POPTR_0001s06740g [Populus trichocarpa]
 gb|EEE82540.2| hypothetical protein POPTR_0001s06740g [Populus trichocarpa]
Length=1074

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDRRVLL++MLSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC+K
Sbjct  1    MEEENALELLQRYRRDRRVLLDYMLSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCVK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD+T  P +NN G+  EFFL T PE+SGS
Sbjct  61   KGGMLELSEAIRDYHDNTGLPHMNNTGSVDEFFLVTKPETSGS  103



>ref|XP_011469346.1| PREDICTED: uncharacterized protein LOC101297291 [Fragaria vesca 
subsp. vesca]
Length=1111

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 127/161 (79%), Gaps = 7/161 (4%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VEL+QR+RRDRR+LL+F+L+GSL+KKV+MPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAVELLQRFRRDRRILLDFVLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGGMLEL+EAIRDYHD T  P +NN+G+  EFFL TNPES GSPP+RAPPP+P  TP  I
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNNSGSAGEFFLVTNPESYGSPPKRAPPPLPDYTPPAI  120

Query  500  lptLSTEEP----LDSMSVEEQSPLSKSQSLTS-QVRELTV  607
            L       P    LD+  V   S +S+S+S  S QVRELTV
Sbjct  121  LAPPPVITPSIPDLDTSPV--ASSISQSESFNSTQVRELTV  159



>ref|XP_002873288.1| hypothetical protein ARALYDRAFT_487516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49547.1| hypothetical protein ARALYDRAFT_487516 [Arabidopsis lyrata subsp. 
lyrata]
Length=1101

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+FML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLELAEAIRDYHD    P +N+ G   EFFLATNPESSGS
Sbjct  61   KGGMLELAEAIRDYHDHIGLPYMNSVGTADEFFLATNPESSGS  103



>gb|KDP40553.1| hypothetical protein JCGZ_24552 [Jatropha curcas]
Length=1104

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN   L+QRYRRDRR+LL+F+LSG+L+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAAMLLQRYRRDRRILLDFILSGTLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD+T  P +NN G+  EFFL TNPESSGS
Sbjct  61   KGGMLELSEAIRDYHDNTDLPHMNNGGSADEFFLVTNPESSGS  103



>ref|XP_010271764.1| PREDICTED: uncharacterized protein LOC104607768 [Nelumbo nucifera]
Length=1098

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDRRVLLNF+LSGSL+KKV+MPPGAVSLDDVDLDQ+S+DYVLNC +
Sbjct  4    MEEENALELLQRYRRDRRVLLNFILSGSLIKKVIMPPGAVSLDDVDLDQISIDYVLNCAR  63

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KG  LEL+EAIRDYHDS  FPS NN G+T EFFL TNP+ SGSPPRRAPPP+P+ TP PI
Sbjct  64   KGETLELSEAIRDYHDSIGFPSTNNTGSTDEFFLVTNPDYSGSPPRRAPPPIPIYTPSPI  123

Query  500  lptLSTEEPLDSMSVEEQS  556
            + +LS  + L S  ++E S
Sbjct  124  MSSLSKSQSLHSTHLQELS  142



>ref|XP_002262850.2| PREDICTED: uncharacterized protein LOC100248009 isoform X1 [Vitis 
vinifera]
Length=1126

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VEL+QRYRRDRRVLL+++LSGSL+KKV+MPPGAVSLDDVDLDQVSVDYVL+C K
Sbjct  1    MEEENAVELLQRYRRDRRVLLDYILSGSLIKKVLMPPGAVSLDDVDLDQVSVDYVLSCSK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KG M+EL+EAIR+YHDST FP++NN G+  EFFL TNPESSGS
Sbjct  61   KGAMVELSEAIREYHDSTEFPNMNNTGSANEFFLVTNPESSGS  103



>ref|XP_006289500.1| hypothetical protein CARUB_v10003033mg [Capsella rubella]
 gb|EOA22398.1| hypothetical protein CARUB_v10003033mg [Capsella rubella]
Length=1101

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+FML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVEVLQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD +  P +N+ G   EFFLATNPESSGS
Sbjct  61   KGGMLELSEAIRDYHDHSGLPYMNSVGTADEFFLATNPESSGS  103



>ref|XP_008231635.1| PREDICTED: uncharacterized protein LOC103330800 [Prunus mume]
Length=1111

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VEL+QRYRRDRR+LL+F+L+GSL+KKV+MPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAVELLQRYRRDRRILLDFILAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD T  P +N+ G+  EFFL TNPE SGS
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNSTGSAGEFFLVTNPEFSGS  103



>ref|XP_010031019.1| PREDICTED: uncharacterized protein LOC104420940 [Eucalyptus grandis]
 gb|KCW50281.1| hypothetical protein EUGRSUZ_J00067 [Eucalyptus grandis]
Length=1110

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDRR+LL+F+LSGSL+KKV MPPGAVSLDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENALELLQRYRRDRRILLSFILSGSLIKKVTMPPGAVSLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +G MLEL+EAIRDYHD T  P +NN G++ EFFL TNPESSGS
Sbjct  61   RGEMLELSEAIRDYHDHTALPHMNNTGSSDEFFLVTNPESSGS  103



>gb|KCW50282.1| hypothetical protein EUGRSUZ_J00067 [Eucalyptus grandis]
Length=1064

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDRR+LL+F+LSGSL+KKV MPPGAVSLDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENALELLQRYRRDRRILLSFILSGSLIKKVTMPPGAVSLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +G MLEL+EAIRDYHD T  P +NN G++ EFFL TNPESSGS
Sbjct  61   RGEMLELSEAIRDYHDHTALPHMNNTGSSDEFFLVTNPESSGS  103



>ref|XP_008347916.1| PREDICTED: uncharacterized protein LOC103411044 [Malus domestica]
 ref|XP_008347925.1| PREDICTED: uncharacterized protein LOC103411044 [Malus domestica]
Length=1111

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VEL+QR+RRDRR+LL+F+L+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVELLQRFRRDRRILLDFILAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD T  P +NN G+  EFFL TNP+ SGS
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNNTGSAGEFFLVTNPDFSGS  103



>ref|XP_010423269.1| PREDICTED: uncharacterized protein LOC104708406 [Camelina sativa]
Length=1102

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+FML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRD+HD +  P +N+ G   EFFLATNPESSGS
Sbjct  61   KGGMLELSEAIRDFHDHSGLPYMNSVGTADEFFLATNPESSGS  103



>ref|XP_010491294.1| PREDICTED: uncharacterized protein LOC104768901 [Camelina sativa]
Length=1103

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+FML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRD+HD +  P +N+ G   EFFLATNPESSGS
Sbjct  61   KGGMLELSEAIRDFHDHSGLPYMNSVGTADEFFLATNPESSGS  103



>ref|XP_010452646.1| PREDICTED: uncharacterized protein LOC104734710 [Camelina sativa]
Length=1102

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+FML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRD+HD +  P +N+ G   EFFLATNPESSGS
Sbjct  61   KGGMLELSEAIRDFHDHSGLPYMNSVGTADEFFLATNPESSGS  103



>ref|XP_006432420.1| hypothetical protein CICLE_v10003518mg, partial [Citrus clementina]
 gb|ESR45660.1| hypothetical protein CICLE_v10003518mg, partial [Citrus clementina]
Length=608

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ +EL+QRYRRDRR+LL+F+LSGSL+KKV+MPPGA++LDDVDLDQVSVDYVL C K
Sbjct  1    MEEEDALELLQRYRRDRRILLDFILSGSLIKKVIMPPGAITLDDVDLDQVSVDYVLGCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRD+HD T  P +NN G+  EFFL TNP+SSGS
Sbjct  61   KGGMLELSEAIRDFHDHTDLPQMNNGGSADEFFLVTNPQSSGS  103



>ref|XP_009372788.1| PREDICTED: uncharacterized protein LOC103961872 isoform X2 [Pyrus 
x bretschneideri]
Length=998

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VEL+QR+RRDRR+LL+F+L+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVELLQRFRRDRRMLLDFILAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD T  P +NN G+  EFFL TNP+ SGS
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNNTGSAGEFFLVTNPDFSGS  103



>emb|CBI35103.3| unnamed protein product [Vitis vinifera]
Length=1079

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VEL+QRYRRDRRVLL+++LSGSL+KKV+MPPGAVSLDDVDLDQVSVDYVL+C K
Sbjct  1    MEEENAVELLQRYRRDRRVLLDYILSGSLIKKVLMPPGAVSLDDVDLDQVSVDYVLSCSK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KG M+EL+EAIR+YHDST FP++NN G+  EFFL TNPESS S
Sbjct  61   KGAMVELSEAIREYHDSTEFPNMNNTGSANEFFLVTNPESSAS  103



>ref|XP_009372787.1| PREDICTED: uncharacterized protein LOC103961872 isoform X1 [Pyrus 
x bretschneideri]
Length=1111

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VEL+QR+RRDRR+LL+F+L+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVELLQRFRRDRRMLLDFILAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD T  P +NN G+  EFFL TNP+ SGS
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNNTGSAGEFFLVTNPDFSGS  103



>dbj|BAB11155.1| unnamed protein product [Arabidopsis thaliana]
Length=1105

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+FML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLELAEAIRDYHD    P +N+ G   EFFLAT PESSGS
Sbjct  61   KGGMLELAEAIRDYHDHIGLPYMNSVGTADEFFLATIPESSGS  103



>ref|NP_196314.2| Munc13-like protein PATROL1 [Arabidopsis thaliana]
 gb|AAL91294.1| AT5g06970/MOJ9_14 [Arabidopsis thaliana]
 gb|AAO11640.1| At5g06970/MOJ9_14 [Arabidopsis thaliana]
 gb|AED91091.1| uncharacterized protein AT5G06970 [Arabidopsis thaliana]
Length=1101

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+FML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFMLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLELAEAIRDYHD    P +N+ G   EFFLAT PESSGS
Sbjct  61   KGGMLELAEAIRDYHDHIGLPYMNSVGTADEFFLATIPESSGS  103



>ref|XP_006465766.1| PREDICTED: uncharacterized protein LOC102609518 [Citrus sinensis]
Length=1105

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ +EL+QRYRRDRR+LL+F+LSGSL+KKV+MPPGA++LDDVDLDQVSVDYVL C K
Sbjct  1    MEEEDALELLQRYRRDRRILLDFILSGSLIKKVIMPPGAITLDDVDLDQVSVDYVLGCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRD+HD T  P +NN G+  EFFL TNP+SSGS
Sbjct  61   KGGMLELSEAIRDFHDHTDLPQMNNGGSADEFFLVTNPQSSGS  103



>gb|KJB60292.1| hypothetical protein B456_009G298800 [Gossypium raimondii]
Length=1009

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 15/161 (9%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ VEL+QRYRRDRR+LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVS+DYVL+CIK
Sbjct  1    MEEESAVELLQRYRRDRRILLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLSCIK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGGML+L+EAIRDYHD T  P +N+  +  EFFL TNPE SGSPPRRAPPP+P       
Sbjct  61   KGGMLDLSEAIRDYHDHTGLPQMNSGDSAGEFFLVTNPEFSGSPPRRAPPPIPD------  114

Query  500  lptLSTEEPLDSMSVEEQSP----LSKSQSL-TSQVRELTV  607
                S   P  S  V   SP    +S+S+S  ++QV+ELTV
Sbjct  115  ----SISMPTPSAPVFAPSPVVSTVSRSESFDSTQVQELTV  151



>gb|KJB60295.1| hypothetical protein B456_009G298800 [Gossypium raimondii]
Length=1094

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 15/161 (9%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ VEL+QRYRRDRR+LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVS+DYVL+CIK
Sbjct  1    MEEESAVELLQRYRRDRRILLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLSCIK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGGML+L+EAIRDYHD T  P +N+  +  EFFL TNPE SGSPPRRAPPP+P       
Sbjct  61   KGGMLDLSEAIRDYHDHTGLPQMNSGDSAGEFFLVTNPEFSGSPPRRAPPPIPD------  114

Query  500  lptLSTEEPLDSMSVEEQSP----LSKSQSL-TSQVRELTV  607
                S   P  S  V   SP    +S+S+S  ++QV+ELTV
Sbjct  115  ----SISMPTPSAPVFAPSPVVSTVSRSESFDSTQVQELTV  151



>gb|KJB60290.1| hypothetical protein B456_009G298800 [Gossypium raimondii]
 gb|KJB60293.1| hypothetical protein B456_009G298800 [Gossypium raimondii]
Length=1096

 Score =   134 bits (337),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 15/161 (9%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ VEL+QRYRRDRR+LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVS+DYVL+CIK
Sbjct  1    MEEESAVELLQRYRRDRRILLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLSCIK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGGML+L+EAIRDYHD T  P +N+  +  EFFL TNPE SGSPPRRAPPP+P       
Sbjct  61   KGGMLDLSEAIRDYHDHTGLPQMNSGDSAGEFFLVTNPEFSGSPPRRAPPPIPD------  114

Query  500  lptLSTEEPLDSMSVEEQSP----LSKSQSL-TSQVRELTV  607
                S   P  S  V   SP    +S+S+S  ++QV+ELTV
Sbjct  115  ----SISMPTPSAPVFAPSPVVSTVSRSESFDSTQVQELTV  151



>gb|KJB60291.1| hypothetical protein B456_009G298800 [Gossypium raimondii]
Length=1086

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 15/161 (9%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ VEL+QRYRRDRR+LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVS+DYVL+CIK
Sbjct  1    MEEESAVELLQRYRRDRRILLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLSCIK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGGML+L+EAIRDYHD T  P +N+  +  EFFL TNPE SGSPPRRAPPP+P       
Sbjct  61   KGGMLDLSEAIRDYHDHTGLPQMNSGDSAGEFFLVTNPEFSGSPPRRAPPPIPD------  114

Query  500  lptLSTEEPLDSMSVEEQSP----LSKSQSL-TSQVRELTV  607
                S   P  S  V   SP    +S+S+S  ++QV+ELTV
Sbjct  115  ----SISMPTPSAPVFAPSPVVSTVSRSESFDSTQVQELTV  151



>ref|XP_007220320.1| hypothetical protein PRUPE_ppa000533m1g, partial [Prunus persica]
 gb|EMJ21519.1| hypothetical protein PRUPE_ppa000533m1g, partial [Prunus persica]
Length=1022

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M  +N VEL+QRYRRDRR+LL+F+L+GSL+KKV+MPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MARKNAVELLQRYRRDRRILLDFILAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD T  P +N+ G+  EFFL TNPE SGS
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNSTGSAGEFFLVTNPEFSGS  103



>gb|KHG28626.1| Error-prone DNA polymerase 2 [Gossypium arboreum]
Length=1028

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 122/161 (76%), Gaps = 15/161 (9%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ VEL+QRYRRDRR+LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVS+DYVL+CIK
Sbjct  1    MEEESAVELLQRYRRDRRILLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLSCIK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpi  499
            KGG LEL+EAIRDYHD T  P +N+  +  EFFL TNPE SGSPPRRAPPP+P       
Sbjct  61   KGGTLELSEAIRDYHDHTGLPQMNSGDSAGEFFLVTNPEFSGSPPRRAPPPIPD------  114

Query  500  lptLSTEEPLDSMSVEEQSP----LSKSQSL-TSQVRELTV  607
                S   P  S  V   SP    +S+S+S  ++QV+ELTV
Sbjct  115  ----SISMPTPSAPVFAPSPVVSTVSRSESFDSTQVQELTV  151



>ref|XP_008447022.1| PREDICTED: uncharacterized protein LOC103489571 [Cucumis melo]
Length=1132

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDR+ LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAIELLQRYRRDRQTLLDFVLSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KG MLEL+EAIRDYHD T FP +NN+G   EFFL T+ +SSGS
Sbjct  61   KGAMLELSEAIRDYHDLTGFPQMNNSGCGDEFFLVTDLDSSGS  103



>gb|KGN52336.1| hypothetical protein Csa_5G625960 [Cucumis sativus]
Length=622

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDR+ LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAIELLQRYRRDRQTLLDFVLSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KG MLEL++AIRDYHD T FP +NN+G+  EFFL T+ +SSGS
Sbjct  61   KGAMLELSDAIRDYHDLTGFPQMNNSGSGDEFFLVTDLDSSGS  103



>ref|XP_007133697.1| hypothetical protein PHAVU_011G201400g [Phaseolus vulgaris]
 gb|ESW05691.1| hypothetical protein PHAVU_011G201400g [Phaseolus vulgaris]
Length=1101

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDRRVLL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAIELLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            K  MLEL+EAIRDYHD T  P +++ G+  EF+L T+PESSGS
Sbjct  61   KSTMLELSEAIRDYHDHTGLPQMSDTGSVGEFYLVTDPESSGS  103



>gb|EPS69825.1| hypothetical protein M569_04933, partial [Genlisea aurea]
Length=1100

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = +2

Query  152  NGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGM  331
            N V  +QRYRRDR VLL+F+LSGSL+KKVV+PPGAVSL+DVDLDQVSVD+VLNC KKGGM
Sbjct  1    NEVVFLQRYRRDRHVLLDFILSGSLIKKVVLPPGAVSLNDVDLDQVSVDHVLNCAKKGGM  60

Query  332  LELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpilptL  511
            L+L+EAIR +HD +LFPSVN AG++ EFFLAT  ESSGSPPRRAPPPVP+    PIL  L
Sbjct  61   LDLSEAIRHFHDVSLFPSVNGAGSSDEFFLATEAESSGSPPRRAPPPVPLLVSTPILSNL  120

Query  512  STEEPLDSMSVEEQSPL-SKSQSLTSQVRELT  604
            S  EP+++ +VEE S L +     +SQ +ELT
Sbjct  121  SISEPVETENVEESSFLSTSISHSSSQPKELT  152



>ref|XP_002513024.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49527.1| conserved hypothetical protein [Ricinus communis]
Length=1520

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 113/160 (71%), Gaps = 17/160 (11%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGG  328
            E  V+L+QRYRRDRR+L++F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC KKGG
Sbjct  429  ETAVQLLQRYRRDRRILVDFILSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAKKGG  488

Query  329  MLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpvatplpilpt  508
            MLEL++AIRDYHD+T  P +NN  +  EFFL TNP+SSGS               P    
Sbjct  489  MLELSDAIRDYHDNTDLPHMNNGSSAAEFFLVTNPDSSGS----------PPKRAPPPIP  538

Query  509  LSTEEPLDSMSVEEQSPLS------KSQSLTS-QVRELTV  607
            +ST  P+ +  +   SP++      KS+S  S +VRELTV
Sbjct  539  VSTPAPVHTPPIIVSSPVASFSSIGKSESFNSTEVRELTV  578



>ref|XP_004142381.1| PREDICTED: uncharacterized protein LOC101216236 [Cucumis sativus]
Length=1107

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDR+ LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAIELLQRYRRDRQTLLDFVLSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KG MLEL++AIRDYHD T FP +NN+G+  EFFL T+ +SSGS
Sbjct  61   KGAMLELSDAIRDYHDLTGFPQMNNSGSGDEFFLVTDLDSSGS  103



>ref|XP_004157545.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101216236 
[Cucumis sativus]
Length=1078

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 92/103 (89%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDR+ LL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAIELLQRYRRDRQTLLDFVLSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KG MLEL++AIRDYHD T FP +NN+G+  EFFL T+ +SSGS
Sbjct  61   KGAMLELSDAIRDYHDLTGFPQMNNSGSGDEFFLVTDLDSSGS  103



>ref|XP_006598088.1| PREDICTED: uncharacterized protein LOC100780877 isoform X1 [Glycine 
max]
 ref|XP_006598089.1| PREDICTED: uncharacterized protein LOC100780877 isoform X2 [Glycine 
max]
 gb|KHN32000.1| hypothetical protein glysoja_044959 [Glycine soja]
Length=1104

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDRRVLL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAIELLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            K  +LEL+EAIRDYHD T  P +++ G+  EF+L T+PESSGS
Sbjct  61   KSTLLELSEAIRDYHDHTGLPQMSDTGSVGEFYLVTDPESSGS  103



>ref|XP_003627933.1| hypothetical protein MTR_8g040190 [Medicago truncatula]
 gb|AET02409.1| plant/MOJ9-14 protein [Medicago truncatula]
Length=1102

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN ++L+QRYRRDRRVLL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVS+DYVLNC K
Sbjct  1    MEEENAIDLLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            K  MLEL+EAIRDYHD T  P +++ G+  EF+L T+PESSGS
Sbjct  61   KSEMLELSEAIRDYHDHTGLPQMSDTGSVGEFYLVTDPESSGS  103



>ref|XP_010923482.1| PREDICTED: uncharacterized protein LOC105046546 isoform X3 [Elaeis 
guineensis]
Length=881

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN ++L+QRYRRDR VLLNF+LSGSL+KKVVMPPGAVSLDDVD+DQVS+DYVLNC K
Sbjct  1    MEEENILDLLQRYRRDRHVLLNFILSGSLIKKVVMPPGAVSLDDVDIDQVSIDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L+EAIR YHDS  +PS++N G+  EFFLAT PESSG
Sbjct  61   KGDTLDLSEAIRLYHDSLDYPSMSNTGSIEEFFLATKPESSG  102



>ref|XP_010923473.1| PREDICTED: uncharacterized protein LOC105046546 isoform X2 [Elaeis 
guineensis]
Length=1082

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN ++L+QRYRRDR VLLNF+LSGSL+KKVVMPPGAVSLDDVD+DQVS+DYVLNC K
Sbjct  1    MEEENILDLLQRYRRDRHVLLNFILSGSLIKKVVMPPGAVSLDDVDIDQVSIDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L+EAIR YHDS  +PS++N G+  EFFLAT PESSG
Sbjct  61   KGDTLDLSEAIRLYHDSLDYPSMSNTGSIEEFFLATKPESSG  102



>ref|XP_010923464.1| PREDICTED: uncharacterized protein LOC105046546 isoform X1 [Elaeis 
guineensis]
Length=1085

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN ++L+QRYRRDR VLLNF+LSGSL+KKVVMPPGAVSLDDVD+DQVS+DYVLNC K
Sbjct  1    MEEENILDLLQRYRRDRHVLLNFILSGSLIKKVVMPPGAVSLDDVDIDQVSIDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L+EAIR YHDS  +PS++N G+  EFFLAT PESSG
Sbjct  61   KGDTLDLSEAIRLYHDSLDYPSMSNTGSIEEFFLATKPESSG  102



>ref|XP_008791229.1| PREDICTED: uncharacterized protein LOC103708188 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008791230.1| PREDICTED: uncharacterized protein LOC103708188 isoform X1 [Phoenix 
dactylifera]
Length=1083

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN ++L+QRYRRDR VLLNF+LSGSL+KKVVMPPGAVSLDDVD+DQVS+DYVLNC K
Sbjct  1    MEEENILDLLQRYRRDRHVLLNFILSGSLIKKVVMPPGAVSLDDVDIDQVSIDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L+EAIR YHDS  +PS++N G+  EFFLAT PESSG
Sbjct  61   KGETLDLSEAIRLYHDSLDYPSMSNTGSIEEFFLATKPESSG  102



>ref|XP_008791232.1| PREDICTED: uncharacterized protein LOC103708188 isoform X2 [Phoenix 
dactylifera]
Length=968

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN ++L+QRYRRDR VLLNF+LSGSL+KKVVMPPGAVSLDDVD+DQVS+DYVLNC K
Sbjct  1    MEEENILDLLQRYRRDRHVLLNFILSGSLIKKVVMPPGAVSLDDVDIDQVSIDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L+EAIR YHDS  +PS++N G+  EFFLAT PESSG
Sbjct  61   KGETLDLSEAIRLYHDSLDYPSMSNTGSIEEFFLATKPESSG  102



>ref|XP_010670525.1| PREDICTED: uncharacterized protein LOC104887567 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1124

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            ME E+ +EL+QRYRRDRRVLL++MLSGSL+KKV++PPGAVSLDDVDLDQ+SVDYVL+C+K
Sbjct  1    MEGESELELLQRYRRDRRVLLDYMLSGSLIKKVILPPGAVSLDDVDLDQISVDYVLSCVK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG MLEL+EAIRDYHD + FP +NN G+  EFFL TN E SG
Sbjct  61   KGEMLELSEAIRDYHDGSEFPYMNNGGSNDEFFLVTNHERSG  102



>ref|XP_010520076.1| PREDICTED: uncharacterized protein LOC104799323 isoform X2 [Tarenaya 
hassleriana]
Length=980

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+F++SGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFIMSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPE  436
            KGGMLEL++AIRDYHD    P +N+  +  EFFL TNPE
Sbjct  61   KGGMLELSDAIRDYHDKIGLPQMNSLASADEFFLVTNPE  99



>ref|XP_010520074.1| PREDICTED: uncharacterized protein LOC104799323 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520075.1| PREDICTED: uncharacterized protein LOC104799323 isoform X1 [Tarenaya 
hassleriana]
Length=1100

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+F++SGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFIMSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPE  436
            KGGMLEL++AIRDYHD    P +N+  +  EFFL TNPE
Sbjct  61   KGGMLELSDAIRDYHDKIGLPQMNSLASADEFFLVTNPE  99



>ref|XP_009380582.1| PREDICTED: uncharacterized protein LOC103968937 [Musa acuminata 
subsp. malaccensis]
Length=1089

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDR +LLN++LSGSL+KKVV+PPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MEEENVLELLQRYRRDRHILLNYILSGSLIKKVVLPPGAISLDDVDIDQVSVDYVLNCTK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KG  L+L+EAIR YHDS  +P+ +N G   EFFL TNPESSGS
Sbjct  61   KGETLDLSEAIRLYHDSLDYPATSNIGPEKEFFLVTNPESSGS  103



>ref|XP_004511052.1| PREDICTED: uncharacterized protein LOC101495068 [Cicer arietinum]
Length=1101

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN ++L+QRYRRDRRVLL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVS+DYVLNC K
Sbjct  1    MEEENAIDLLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSIDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPE  436
            K  MLEL+EAIRDYHD T  P +++ G+  EF+L T+PE
Sbjct  61   KSEMLELSEAIRDYHDHTGLPQMSDTGSVGEFYLVTDPE  99



>ref|NP_001050913.1| Os03g0683700 [Oryza sativa Japonica Group]
 gb|ABF98236.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12827.1| Os03g0683700 [Oryza sativa Japonica Group]
Length=1108

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR VLLN+MLSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENVVELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L +AIR +HDS  +P VNN+G   EFFL T PE SG
Sbjct  61   KGEALDLGDAIRLFHDSLDYPYVNNSGTVEEFFLLTKPEYSG  102



>ref|XP_006660850.1| PREDICTED: uncharacterized protein LOC102711458 [Oryza brachyantha]
Length=1108

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR VLLN+MLSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENVVELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L +AIR +HDS  +P VNN+G   EFFL T PE SG
Sbjct  61   KGEPLDLGDAIRLFHDSLDYPYVNNSGTVEEFFLLTKPEHSG  102



>ref|XP_004957372.1| PREDICTED: uncharacterized protein LOC101769141 [Setaria italica]
Length=1108

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR+VLLN++LSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENVVELLQRYRRDRQVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L +AIR +HDS  +P VNN GA  EF+L T PE SG
Sbjct  61   KGEPLDLGDAIRLFHDSLDYPYVNNTGAVEEFYLLTKPEYSG  102



>ref|XP_002440996.1| hypothetical protein SORBIDRAFT_09g018670 [Sorghum bicolor]
 gb|EES19426.1| hypothetical protein SORBIDRAFT_09g018670 [Sorghum bicolor]
Length=1106

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR+VLLN++LSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENVVELLQRYRRDRQVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L +AIR +HDS  +P VNN GA  EF+L T PE SG
Sbjct  61   KGEPLDLGDAIRLFHDSLDYPYVNNTGAVEEFYLLTKPEYSG  102



>ref|XP_006594370.1| PREDICTED: uncharacterized protein LOC100813299 [Glycine max]
Length=1102

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN +EL+QRYRRDRRVLL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MEEENAIELLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATN  430
            K  +LEL+EAIRDYHD T  P +++ G+  EF+L T+
Sbjct  61   KSTLLELSEAIRDYHDHTGLPQMSDTGSVGEFYLVTD  97



>gb|AFW77581.1| hypothetical protein ZEAMMB73_404536, partial [Zea mays]
Length=1014

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR+VLLN++LSG+L+KKV MPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENVVELLQRYRRDRQVLLNYILSGNLIKKVAMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L +AIR +HDS  +P VNN GA  EF+L T PE SG
Sbjct  61   KGEPLDLGDAIRLFHDSLDYPYVNNTGAVDEFYLLTKPEYSG  102



>gb|AFW77583.1| hypothetical protein ZEAMMB73_404536, partial [Zea mays]
Length=1034

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR+VLLN++LSG+L+KKV MPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENVVELLQRYRRDRQVLLNYILSGNLIKKVAMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L +AIR +HDS  +P VNN GA  EF+L T PE SG
Sbjct  61   KGEPLDLGDAIRLFHDSLDYPYVNNTGAVDEFYLLTKPEYSG  102



>gb|AFW77582.1| hypothetical protein ZEAMMB73_404536 [Zea mays]
Length=1056

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR+VLLN++LSG+L+KKV MPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENVVELLQRYRRDRQVLLNYILSGNLIKKVAMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L +AIR +HDS  +P VNN GA  EF+L T PE SG
Sbjct  61   KGEPLDLGDAIRLFHDSLDYPYVNNTGAVDEFYLLTKPEYSG  102



>ref|XP_008649491.1| PREDICTED: uncharacterized protein LOC103630192 [Zea mays]
 ref|XP_008649492.1| PREDICTED: uncharacterized protein LOC103630192 [Zea mays]
Length=1107

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR+VLLN++LSG+L+KKV MPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENVVELLQRYRRDRQVLLNYILSGNLIKKVAMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            KG  L+L +AIR +HDS  +P VNN GA  EF+L T PE SG
Sbjct  61   KGEPLDLGDAIRLFHDSLDYPYVNNTGAVDEFYLLTKPEYSG  102



>gb|EEE59706.1| hypothetical protein OsJ_12133 [Oryza sativa Japonica Group]
Length=1170

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGG  328
            EN VEL+QRYRRDR VLLN+MLSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC KKG 
Sbjct  99   ENVVELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGE  158

Query  329  MLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
             L+L +AIR +HDS  +P VNN+G   EFFL T PE SG
Sbjct  159  ALDLGDAIRLFHDSLDYPYVNNSGTVEEFFLLTKPEYSG  197



>gb|EEC75950.1| hypothetical protein OsI_13051 [Oryza sativa Indica Group]
Length=1160

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGG  328
            EN VEL+QRYRRDR VLLN+MLSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC KKG 
Sbjct  89   ENVVELLQRYRRDRHVLLNYMLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGE  148

Query  329  MLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
             L+L +AIR +HDS  +P VNN+G   EFFL T PE SG
Sbjct  149  ALDLGDAIRLFHDSLDYPYVNNSGTVEEFFLLTKPEYSG  187



>dbj|BAJ99465.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=910

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QRYRRDR VLLN++LSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDEENPVELLQRYRRDRHVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KG  L+L +AIR YHDS  +P V+N G    F+L T PE SGS
Sbjct  61   KGDPLDLGDAIRLYHDSLDYPYVDNTGDVEGFYLLTRPEYSGS  103



>gb|KHN37720.1| hypothetical protein glysoja_007423 [Glycine soja]
Length=1103

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGG  328
            EN +EL+QRYRRDRRVLL+F+LSGSL+KKVVMPPGAV+LDDVDLDQVSVDYVLNC KK  
Sbjct  5    ENAIELLQRYRRDRRVLLDFILSGSLIKKVVMPPGAVTLDDVDLDQVSVDYVLNCAKKST  64

Query  329  MLELAEAIRDYHDSTLFPSVNNAGATTEFFLATN  430
            +LEL+EAIRDYHD T  P +++ G+  EF+L T+
Sbjct  65   LLELSEAIRDYHDHTGLPQMSDTGSVGEFYLVTD  98



>gb|EMT16861.1| hypothetical protein F775_17073 [Aegilops tauschii]
Length=575

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGG  328
            EN VEL+QRYRRDR VLLN++LSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC KKG 
Sbjct  53   ENPVELLQRYRRDRHVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGD  112

Query  329  MLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
             L+L +AIR YHDS  +P V+N G    F+L T PE SGS
Sbjct  113  PLDLGDAIRLYHDSLDYPYVDNTGDVEGFYLVTRPEYSGS  152



>ref|XP_003562639.1| PREDICTED: uncharacterized protein LOC100836004 [Brachypodium 
distachyon]
Length=1109

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 118/162 (73%), Gaps = 3/162 (2%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M++EN VEL+QRYRRDR VLLN++LSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC K
Sbjct  1    MDDENAVELLQRYRRDRHVLLNYILSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGSpprrapppvpv-atplp  496
            +G  L+L +AIR +HDS  +P V+N GA  EFFL T PESSG PP R PPP P       
Sbjct  61   RGEPLDLGDAIRLFHDSIDYPYVDNTGAVEEFFLLTKPESSGPPPAREPPPAPANVPSPV  120

Query  497  ilptLSTEEPLDSM-SVEEQSPLSKSQSLTSQV-RELTVDDI  616
            ++P    E+P  ++ S    + L KS SL S   +ELT+DDI
Sbjct  121  VIPPPVVEQPQITVPSPVASATLPKSLSLDSPTEKELTIDDI  162



>ref|XP_006399173.1| hypothetical protein EUTSA_v10012512mg [Eutrema salsugineum]
 gb|ESQ40626.1| hypothetical protein EUTSA_v10012512mg [Eutrema salsugineum]
Length=1088

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 77/103 (75%), Gaps = 13/103 (13%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEEN VE++QRYRRDRR LL+FML+ +L             DDVDLDQVSVDYV+NC K
Sbjct  1    MEEENAVEILQRYRRDRRKLLDFMLAVTL-------------DDVDLDQVSVDYVINCAK  47

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLELAEAIRDYHD +  P +N  G   EFFLATNPESSGS
Sbjct  48   KGGMLELAEAIRDYHDHSGLPYMNTVGTADEFFLATNPESSGS  90



>ref|XP_009361890.1| PREDICTED: uncharacterized protein LOC103952085 [Pyrus x bretschneideri]
Length=1111

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QR+RRDRR+LL+F+L+GSL+KKV+MPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MDEENAVELLQRFRRDRRLLLDFILAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD T  P +NNAG+  EFFL TNP+ SGS
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNNAGSAGEFFLVTNPDFSGS  103



>ref|XP_008375352.1| PREDICTED: uncharacterized protein LOC103438600 [Malus domestica]
Length=1111

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+EEN VEL+QR+RRDRR+LL+F+L+GSL+KKV+MPPGAV+LDDVDLDQVSVDYVLNC K
Sbjct  1    MDEENAVELLQRFRRDRRLLLDFILAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVLNCAK  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KGGMLEL+EAIRDYHD T  P +NN G+  EFFLATNP+ SGS
Sbjct  61   KGGMLELSEAIRDYHDHTGLPQMNNTGSAGEFFLATNPDFSGS  103



>emb|CDX69997.1| BnaA10g23460D [Brassica napus]
Length=1079

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  209  MLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELAEAIRDYHDSTLFPSV  388
            ML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC KKGGMLEL+EAIRDYHD +  P +
Sbjct  1    MLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAKKGGMLELSEAIRDYHDHSGLPYM  60

Query  389  NNAGATTEFFLATNPESSGS  448
            N+ G   +FFLAT PESSGS
Sbjct  61   NSVGTADDFFLATTPESSGS  80



>emb|CDX99020.1| BnaC09g48150D [Brassica napus]
Length=1087

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  209  MLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELAEAIRDYHDSTLFPSV  388
            ML+GSL+KKV+MPPGAV+LDDVDLDQVSVDYV+NC KKGGMLEL+EAIRDYHD +  P +
Sbjct  1    MLAGSLIKKVIMPPGAVTLDDVDLDQVSVDYVINCAKKGGMLELSEAIRDYHDHSGLPYM  60

Query  389  NNAGATTEFFLATNPESSGS  448
            N+ G   +FFLAT PESSGS
Sbjct  61   NSVGTADDFFLATTPESSGS  80



>ref|XP_002969734.1| hypothetical protein SELMODRAFT_92955 [Selaginella moellendorffii]
 gb|EFJ28858.1| hypothetical protein SELMODRAFT_92955 [Selaginella moellendorffii]
Length=1091

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELA  343
            L+QRYRRDRR LL+F+LS S+ +KVVMPPGAV+LDD+DL+QVS+DY+L C KKGG+LEL+
Sbjct  2    LLQRYRRDRRELLSFILSASIFRKVVMPPGAVTLDDIDLEQVSIDYILECAKKGGILELS  61

Query  344  EAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            EAI+ +HD    P+V  +G    ++L T+P+ SG
Sbjct  62   EAIKKFHDDAHIPAVVCSGDGDIYYLVTDPQVSG  95



>ref|XP_002981341.1| hypothetical protein SELMODRAFT_114286 [Selaginella moellendorffii]
 gb|EFJ17529.1| hypothetical protein SELMODRAFT_114286 [Selaginella moellendorffii]
Length=1094

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELA  343
            L+QRYRRDRR LL+F+LS S+ +KVVMPPGAV+LDD+DL+QVS+DY+L C KKGG+LEL+
Sbjct  2    LLQRYRRDRRELLSFILSASIFRKVVMPPGAVTLDDIDLEQVSIDYILECAKKGGILELS  61

Query  344  EAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            EAI+ +HD    P+V  +G    ++L T+P+ SG
Sbjct  62   EAIKKFHDDAHIPAVVCSGDGDIYYLVTDPQVSG  95



>ref|XP_001784497.1| predicted protein [Physcomitrella patens]
 gb|EDQ50710.1| predicted protein [Physcomitrella patens]
Length=1088

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            M+  + +EL+QRYRRDRR LLNF+LS S++KKV+MPPGAVS DD+DLDQ+SVDY+L C +
Sbjct  1    MDGSSDLELLQRYRRDRRELLNFLLSASVIKKVIMPPGAVSYDDIDLDQISVDYILECAR  60

Query  320  KGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            K   L+L+EAI+ YHD    P  +       ++L TNP+ SG
Sbjct  61   KNFALDLSEAIKRYHDDLSLPPSSGTKLGEVYYLVTNPDLSG  102



>gb|AAK14418.1|AC087851_10 unknown protein [Oryza sativa Japonica Group]
Length=1049

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  209  MLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELAEAIRDYHDSTLFPSV  388
            MLSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC KKG  L+L +AIR +HDS  +P V
Sbjct  1    MLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGEALDLGDAIRLFHDSLDYPYV  60

Query  389  NNAGATTEFFLATNPESSG  445
            NN+G   EFFL T PE SG
Sbjct  61   NNSGTVEEFFLLTKPEYSG  79



>gb|AAP68377.1| unknown protein [Oryza sativa Japonica Group]
Length=1078

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  209  MLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELAEAIRDYHDSTLFPSV  388
            MLSG+L+KKVVMPPGA+SLDDVD+DQVSVDYVLNC KKG  L+L +AIR +HDS  +P V
Sbjct  1    MLSGNLIKKVVMPPGAISLDDVDIDQVSVDYVLNCAKKGEALDLGDAIRLFHDSLDYPYV  60

Query  389  NNAGATTEFFLATNPESSG  445
            NN+G   EFFL T PE SG
Sbjct  61   NNSGTVEEFFLLTKPEYSG  79



>ref|XP_010097919.1| hypothetical protein L484_009353 [Morus notabilis]
 gb|EXB73275.1| hypothetical protein L484_009353 [Morus notabilis]
Length=535

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = +2

Query  242  MPPGAvslddvdldqvsvdyvlNCIKKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFL  421
            MPPGAV+LDDVDLDQVSVD+VLNC KKGGMLELAEAIRDYHDS   P +NN G+  EFFL
Sbjct  1    MPPGAVTLDDVDLDQVSVDFVLNCAKKGGMLELAEAIRDYHDSIGLPQMNNTGSVGEFFL  60

Query  422  ATNPESSGS  448
             T+P+ SGS
Sbjct  61   VTDPKVSGS  69



>gb|KDO58841.1| hypothetical protein CISIN_1g0427012mg, partial [Citrus sinensis]
Length=61

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIK  319
            MEEE+ +EL+QRYRRDRR+LL+F+LSGSL+KKV+MPPGA++LDDVDLDQVSVDYVL C K
Sbjct  1    MEEEDALELLQRYRRDRRILLDFILSGSLIKKVIMPPGAITLDDVDLDQVSVDYVLGCAK  60

Query  320  K  322
            K
Sbjct  61   K  61



>ref|XP_010659085.1| PREDICTED: uncharacterized protein LOC100248009 isoform X2 [Vitis 
vinifera]
Length=1073

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            KKG M+EL+EAIR+YHDST FP++NN G+  EFFL TNPESSGS
Sbjct  7    KKGAMVELSEAIREYHDSTEFPNMNNTGSANEFFLVTNPESSGS  50



>ref|XP_006857850.1| hypothetical protein AMTR_s00069p00066350 [Amborella trichopoda]
 gb|ERN19317.1| hypothetical protein AMTR_s00069p00066350 [Amborella trichopoda]
Length=1149

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELA  343
            L+Q Y RDRR LL F++S SLVK V +PPGA  L+DVD D VSVD+V+ C K+G +L+L+
Sbjct  2    LLQLYHRDRRKLLEFIMSSSLVKDVRLPPGATGLNDVDWDTVSVDHVIECAKEGRLLDLS  61

Query  344  EAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            E+ + Y+    FP + N+ + + F+L ++PE SGS
Sbjct  62   ESSKRYYLEEKFPLMVNSESRSSFYLLSDPEYSGS  96



>gb|KHG00578.1| DNA topoisomerase 4 subunit B [Gossypium arboreum]
Length=1106

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = +2

Query  134  LAMEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNC  313
            + ME+++   L+QRYRRDRR LL F+LS  L+++V  P G+ SL + D D++S DY+L+C
Sbjct  8    IKMEQDS---LLQRYRRDRRKLLEFLLSSGLIEEVRTPSGSTSLSEADFDKLSADYILHC  64

Query  314  IKKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            IK GG+++++EA + YH  +  P + ++     +FL ++P+ +GS
Sbjct  65   IKSGGIVDVSEASKKYHAESAHPIMIHSKLGDSYFLTSDPDIAGS  109



>gb|KJB20716.1| hypothetical protein B456_003G160900 [Gossypium raimondii]
Length=1153

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 72/105 (69%), Gaps = 3/105 (3%)
 Frame = +2

Query  134  LAMEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNC  313
            + ME+++   L+QRYRRDRR LL F+LS  L+K+V  P G+  L D D D++S DY+L+C
Sbjct  8    IKMEQDS---LLQRYRRDRRKLLEFLLSSGLIKEVRTPSGSTPLYDADFDKLSADYILHC  64

Query  314  IKKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            IK GG+++++EA + Y+  +  P + ++     +FL ++P+ +GS
Sbjct  65   IKSGGIVDVSEASKKYYAESAHPIMIHSKLGDSYFLTSDPDIAGS  109



>ref|XP_006832844.1| hypothetical protein AMTR_s00095p00045160 [Amborella trichopoda]
 gb|ERM98122.1| hypothetical protein AMTR_s00095p00045160 [Amborella trichopoda]
Length=1078

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  212  LSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELAEAIRDYHDSTLFPSVN  391
            +S SL+KKVVMPPGAVSLDDVDLDQVS+DYV+ C KKG  LEL+EAIR Y DS  FP ++
Sbjct  1    MSSSLIKKVVMPPGAVSLDDVDLDQVSIDYVIECAKKGLPLELSEAIRMYFDSLDFPPMS  60

Query  392  NAGATTEFFLATNPESSG  445
            + G   EFFL T+ ESSG
Sbjct  61   SRGLGDEFFLVTDVESSG  78



>gb|KDO63534.1| hypothetical protein CISIN_1g037655mg [Citrus sinensis]
Length=1125

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = +2

Query  146  EENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvsld-dvdldqvsvdyvlNCIKK  322
            ++  V L++RYRRDRR L+ F+LS  L+K++  P G  +   + D D +S DY+++C+K 
Sbjct  2    DQQHVSLLERYRRDRRQLIEFLLSSGLIKELRTPSGPTTSLPNADFDSLSADYIIHCVKS  61

Query  323  GGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            GG+++++EA + Y D + +P++ ++     +FL+++P+ SGS
Sbjct  62   GGVVDVSEASKKYLDESTYPTMVHSQIGDSYFLSSDPDLSGS  103



>ref|XP_006440565.1| hypothetical protein CICLE_v10023740mg [Citrus clementina]
 gb|ESR53805.1| hypothetical protein CICLE_v10023740mg [Citrus clementina]
Length=1125

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = +2

Query  146  EENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvsld-dvdldqvsvdyvlNCIKK  322
            ++  V L++RYRRDRR L+ F+LS  L+K++  P G  +   + D D +S DY+++C+K 
Sbjct  2    DQQHVSLLERYRRDRRQLIEFLLSSGLIKELRTPSGPTTSLPNADFDSLSADYIIHCVKS  61

Query  323  GGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            GG+++++EA + Y D + +P++ ++     +FL+++P+ SGS
Sbjct  62   GGVVDVSEASKKYLDESTYPTMVHSQIGDSYFLSSDPDLSGS  103



>ref|XP_006477424.1| PREDICTED: uncharacterized protein LOC102618709 isoform X2 [Citrus 
sinensis]
Length=956

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +2

Query  146  EENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvd-yvlNCIKK  322
            ++  V L++RYRRDRR L+ F+LS  L+K +  P G  +             Y+++C+K 
Sbjct  2    DQQHVSLLERYRRDRRQLIEFLLSSGLIKVLRTPSGPTTSLSNADFDSLSADYIIHCVKS  61

Query  323  GGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            GG+++++EA + Y D + +P++ ++     +FL+++P+ SGS
Sbjct  62   GGVVDVSEASKKYLDESTYPTMVHSQIGDSYFLSSDPDLSGS  103



>ref|XP_006477423.1| PREDICTED: uncharacterized protein LOC102618709 isoform X1 [Citrus 
sinensis]
Length=1155

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = +2

Query  146  EENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvd-yvlNCIKK  322
            ++  V L++RYRRDRR L+ F+LS  L+K +  P G  +             Y+++C+K 
Sbjct  2    DQQHVSLLERYRRDRRQLIEFLLSSGLIKVLRTPSGPTTSLSNADFDSLSADYIIHCVKS  61

Query  323  GGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            GG+++++EA + Y D + +P++ ++     +FL+++P+ SGS
Sbjct  62   GGVVDVSEASKKYLDESTYPTMVHSQIGDSYFLSSDPDLSGS  103



>ref|XP_006358878.1| PREDICTED: uncharacterized protein LOC102581574 [Solanum tuberosum]
Length=1141

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYR DRR LL F+LS  L+K++  P G  +SL +++LD +S DYVL C++ GG+L++
Sbjct  7    LLQRYRNDRRNLLEFLLSCGLIKEIRTPSGPTLSLSNINLDVISADYVLECVQSGGVLDV  66

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + A + YHD    P          +FL T+PES+GS
Sbjct  67   SLAAKKYHDERRHPKTMQLHTGDAYFLVTDPESAGS  102



>ref|XP_007211313.1| hypothetical protein PRUPE_ppa000534mg [Prunus persica]
 gb|EMJ12512.1| hypothetical protein PRUPE_ppa000534mg [Prunus persica]
Length=1109

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGS-LVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLE  337
            L+QRYRRDRR LL F+LS S LV ++  P G A SL  +D D +S DYVL+C+K GG+L+
Sbjct  6    LLQRYRRDRRKLLEFLLSSSGLVTELRTPTGSAASLSHIDFDTLSADYVLDCVKSGGVLD  65

Query  338  LAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            ++EA + Y   + +P + ++     FFL ++PE SGS
Sbjct  66   ISEATKKYFHESSYPLMIHSQLGNSFFLLSDPELSGS  102



>ref|XP_011029216.1| PREDICTED: uncharacterized protein LOC105129017 isoform X7 [Populus 
euphratica]
Length=1152

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKG  325
            E    L+  YRRDRR L+ F+LS  L+K++  P G   SL ++D D +S DY+++C+K G
Sbjct  2    EQQATLLHHYRRDRRKLIEFLLSSGLIKELRTPSGPTNSLSNLDFDSLSADYIIHCVKSG  61

Query  326  GMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            G++++ EA   Y D + +P   ++   + +FL + PES+GS
Sbjct  62   GVVDVTEATNKYSDESAYPVTIHSQTRSSYFLVSEPESAGS  102



>ref|XP_011029211.1| PREDICTED: uncharacterized protein LOC105129017 isoform X4 [Populus 
euphratica]
Length=1156

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKG  325
            E    L+  YRRDRR L+ F+LS  L+K++  P G   SL ++D D +S DY+++C+K G
Sbjct  2    EQQATLLHHYRRDRRKLIEFLLSSGLIKELRTPSGPTNSLSNLDFDSLSADYIIHCVKSG  61

Query  326  GMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            G++++ EA   Y D + +P   ++   + +FL + PES+GS
Sbjct  62   GVVDVTEATNKYSDESAYPVTIHSQTRSSYFLVSEPESAGS  102



>gb|KDO58842.1| hypothetical protein CISIN_1g0427013mg, partial [Citrus sinensis]
Length=505

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  326  GMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            GMLEL+EAIRD+HD T  P +NN G+  EFFL TNP+SSGS
Sbjct  1    GMLELSEAIRDFHDHTDLPQMNNGGSADEFFLVTNPQSSGS  41



>ref|XP_008238821.1| PREDICTED: uncharacterized protein LOC103337442 [Prunus mume]
Length=1143

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 66/97 (68%), Gaps = 2/97 (2%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGS-LVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLE  337
            L+QRYRRDRR LL F+LS S LV ++    G A SL  +D D +S DYVL+C+K GG+++
Sbjct  6    LLQRYRRDRRKLLEFLLSSSGLVTELRTQTGSAASLSHIDFDTLSADYVLDCVKSGGVVD  65

Query  338  LAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            ++EA + Y   + +P + ++     FFL ++PESSGS
Sbjct  66   ISEATKKYFHESSYPLMIHSQLGNSFFLLSDPESSGS  102



>ref|XP_009770723.1| PREDICTED: uncharacterized protein LOC104221360 isoform X1 [Nicotiana 
sylvestris]
Length=1143

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (63%), Gaps = 3/104 (3%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCI  316
            ME  N   L+QRYR DRR LL F+LS  L+K++  P G   SL +++LD +S DYVL C+
Sbjct  1    METNNS--LLQRYRDDRRKLLEFLLSCGLIKEIRTPSGPTFSLSNINLDVISADYVLECV  58

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + GG+++++ A + YHD    P          +FL T+PE++GS
Sbjct  59   QSGGVVDVSLAAKKYHDDHRHPKTMQLHTGDVYFLVTDPEAAGS  102



>ref|XP_009770724.1| PREDICTED: uncharacterized protein LOC104221360 isoform X2 [Nicotiana 
sylvestris]
Length=1141

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 67/104 (64%), Gaps = 5/104 (5%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCI  316
            ME  N   L+QRYR DRR LL F+LS  L+K++  P G   SL +++LD +S DYVL C+
Sbjct  1    METNNS--LLQRYRDDRRKLLEFLLSCGLIKEIRTPSGPTFSLSNINLDVISADYVLECV  58

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + GG+++++ A + YHD    P   + G    +FL T+PE++GS
Sbjct  59   QSGGVVDVSLAAKKYHDDHRHPKTLHTGDV--YFLVTDPEAAGS  100



>ref|XP_010325425.1| PREDICTED: uncharacterized protein LOC101264749 isoform X2 [Solanum 
lycopersicum]
Length=1139

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYR DRR LL F+LS  L+K++  P G  +SL +++LD +S DYVL C++ GG+L++
Sbjct  6    LLQRYRNDRRNLLEFLLSCGLIKEIRTPSGPTLSLSNINLDVISADYVLECVQSGGVLDV  65

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + A + YHD    P          +FL T+ ES+GS
Sbjct  66   SLAAKKYHDERQHPKTMQLHTGDAYFLVTDSESAGS  101



>ref|XP_010325424.1| PREDICTED: uncharacterized protein LOC101264749 isoform X1 [Solanum 
lycopersicum]
Length=1140

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYR DRR LL F+LS  L+K++  P G  +SL +++LD +S DYVL C++ GG+L++
Sbjct  6    LLQRYRNDRRNLLEFLLSCGLIKEIRTPSGPTLSLSNINLDVISADYVLECVQSGGVLDV  65

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + A + YHD    P          +FL T+ ES+GS
Sbjct  66   SLAAKKYHDERQHPKTMQLHTGDAYFLVTDSESAGS  101



>ref|XP_009621421.1| PREDICTED: uncharacterized protein LOC104113044 isoform X1 [Nicotiana 
tomentosiformis]
Length=1141

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 67/104 (64%), Gaps = 5/104 (5%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCI  316
            ME  N   L+QRYR DRR LL F+LS  L++++  P G   SL +++LD +S DYVL C+
Sbjct  1    METNNS--LLQRYRDDRRKLLEFLLSCGLIREIRTPSGPTFSLSNINLDVISADYVLECV  58

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + GG+L+++ A + YHD    P   + G    +FL T+PE++GS
Sbjct  59   QFGGVLDVSLAAKKYHDEHRHPKTLHTGDV--YFLVTDPEAAGS  100



>ref|XP_011029209.1| PREDICTED: uncharacterized protein LOC105129017 isoform X2 [Populus 
euphratica]
Length=1158

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKG  325
            E    L+  YRRDRR L+ F+LS  L+K++  P G   SL ++D D +S DY+++C+K G
Sbjct  2    EQQATLLHHYRRDRRKLIEFLLSSGLIKELRTPSGPTNSLSNLDFDSLSADYIIHCVKSG  61

Query  326  GMLELAEAIRDYHDSTLFPSVNNAGATTE--FFLATNPESSGS  448
            G++++ EA   Y D + +P      + T   +FL + PES+GS
Sbjct  62   GVVDVTEATNKYSDESAYPVTLQIHSQTRSSYFLVSEPESAGS  104



>ref|XP_007040146.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24647.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1151

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAv-slddvdldqvsvdyvlNCIKKGGMLEL  340
            L+Q YRRDRR LL F+ S  L+K++  P G+  SL D D D +S DY+L+CIK GG++++
Sbjct  6    LLQCYRRDRRKLLEFLFSSGLIKEIRTPSGSTPSLSDADFDTISADYILHCIKSGGIVDV  65

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +EA + Y+  +  P + ++     +FL ++P+ +GS
Sbjct  66   SEATKKYYAESTHPIMIHSKLGDSYFLTSDPDLAGS  101



>ref|XP_011029210.1| PREDICTED: uncharacterized protein LOC105129017 isoform X3 [Populus 
euphratica]
Length=1157

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 64/102 (63%), Gaps = 2/102 (2%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIK-K  322
            E    L+  YRRDRR L+ F+LS  L+K++  P G   SL ++D D +S DY+++C+K  
Sbjct  2    EQQATLLHHYRRDRRKLIEFLLSSGLIKELRTPSGPTNSLSNLDFDSLSADYIIHCVKSA  61

Query  323  GGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            GG++++ EA   Y D + +P   ++   + +FL + PES+GS
Sbjct  62   GGVVDVTEATNKYSDESAYPVTIHSQTRSSYFLVSEPESAGS  103



>gb|EMS65553.1| hypothetical protein TRIUR3_20845 [Triticum urartu]
Length=1089

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  242  MPPGAvslddvdldqvsvdyvlNCIKKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFL  421
            MPPGA+SLDDVD+DQVSVDYVLNC KKG  L+L +AIR YHDS  +P V+N G    F+L
Sbjct  1    MPPGAISLDDVDIDQVSVDYVLNCAKKGDPLDLGDAIRLYHDSLDYPYVDNTGDVEGFYL  60

Query  422  ATNPESSGS  448
             T PE SGS
Sbjct  61   LTRPEYSGS  69



>ref|XP_010670526.1| PREDICTED: uncharacterized protein LOC104887567 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1061

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  329  MLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            MLEL+EAIRDYHD + FP +NN G+  EFFL TN E SG
Sbjct  1    MLELSEAIRDYHDGSEFPYMNNGGSNDEFFLVTNHERSG  39



>ref|XP_008392392.1| PREDICTED: uncharacterized protein LOC103454569 isoform X1 [Malus 
domestica]
Length=1146

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 4/104 (4%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdld----qvsvdyvlNCI  316
            E+   L+QRYRRDRR LL F+ S  LV+       A +            +S DYVL+C+
Sbjct  3    EHHQPLLQRYRRDRRKLLEFLFSSGLVRTXSGSDSAPASAASISHIDFDTISADYVLDCV  62

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            K GG+++++EA + Y   + +P +  +     FFL ++PESSGS
Sbjct  63   KSGGVVDISEATKKYFRESSYPLMIQSELXDSFFLVSDPESSGS  106



>ref|XP_008392393.1| PREDICTED: uncharacterized protein LOC103454569 isoform X2 [Malus 
domestica]
Length=986

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 4/104 (4%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdld----qvsvdyvlNCI  316
            E+   L+QRYRRDRR LL F+ S  LV+       A +            +S DYVL+C+
Sbjct  3    EHHQPLLQRYRRDRRKLLEFLFSSGLVRTXSGSDSAPASAASISHIDFDTISADYVLDCV  62

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            K GG+++++EA + Y   + +P +  +     FFL ++PESSGS
Sbjct  63   KSGGVVDISEATKKYFRESSYPLMIQSELXDSFFLVSDPESSGS  106



>emb|CDP09793.1| unnamed protein product [Coffea canephora]
Length=1191

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvd-yvlNCIKKGGMLEL  340
            L++RYR DRR LL F+LS  LV+++  P G+ +             YVL  IK GG+L++
Sbjct  6    LLERYRLDRRKLLEFILSSGLVREIRTPSGSSASISDVNLDFISADYVLQSIKSGGVLDV  65

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            A A + Y++ +  P + +  +   +FL T+P+SSGS
Sbjct  66   ALATKKYYEESELPIMMDLHSRDLYFLRTDPQSSGS  101



>ref|XP_009369020.1| PREDICTED: uncharacterized protein LOC103958485 [Pyrus x bretschneideri]
Length=1145

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVK----KVVMPPGAvslddvdldqvsvdyvlNCI  316
            E+   L+QRYRRDRR LL F+ S  LV+        P  A SL  +D D +S DYVL+C+
Sbjct  2    EHHQTLLQRYRRDRRKLLEFLFSSGLVRTPSGSDSAPASAASLSHIDFDTISADYVLDCV  61

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            K GG+++++EA + Y   + +P +  +     FFL ++PESSGS
Sbjct  62   KSGGVVDISEATKKYFHESSYPLMIQSELGDSFFLVSDPESSGS  105



>ref|XP_011081012.1| PREDICTED: uncharacterized protein LOC105164132 isoform X1 [Sesamum 
indicum]
Length=1152

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 67/104 (64%), Gaps = 3/104 (3%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCI  316
            ME  N   L++RYR DRR LL F++S  ++ K+  P G   S  ++D D +S+DYVL C+
Sbjct  1    MESSN--PLLRRYRSDRRKLLEFLMSSGIIGKITTPAGPTTSFSNIDFDAISIDYVLECV  58

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + GG+L+++EA + Y+  +  P + +  +   F+L ++P+++GS
Sbjct  59   ESGGVLDVSEATKRYYFDSTHPVMRHLQSGDVFYLHSDPDAAGS  102



>ref|XP_011081013.1| PREDICTED: uncharacterized protein LOC105164132 isoform X2 [Sesamum 
indicum]
Length=1146

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 67/104 (64%), Gaps = 3/104 (3%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCI  316
            ME  N   L++RYR DRR LL F++S  ++ K+  P G   S  ++D D +S+DYVL C+
Sbjct  1    MESSN--PLLRRYRSDRRKLLEFLMSSGIIGKITTPAGPTTSFSNIDFDAISIDYVLECV  58

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + GG+L+++EA + Y+  +  P + +  +   F+L ++P+++GS
Sbjct  59   ESGGVLDVSEATKRYYFDSTHPVMRHLQSGDVFYLHSDPDAAGS  102



>ref|XP_004159523.1| PREDICTED: uncharacterized LOC101213131 [Cucumis sativus]
Length=432

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYRRDR+ LL F+LS  L+K++  P G       VDLD +S  YVL CIK GG++++
Sbjct  6    LLQRYRRDRQKLLAFLLSSRLIKELRTPAGPVTDFSAVDLDSLSASYVLECIKSGGVIDI  65

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            + A +     + +P++  +   T +FL T+P+ SG
Sbjct  66   STASKRKLLESAYPTMIQSRFRTTYFLRTHPDLSG  100



>ref|XP_011029208.1| PREDICTED: uncharacterized protein LOC105129017 isoform X1 [Populus 
euphratica]
Length=1159

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 4/104 (4%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIK-K  322
            E    L+  YRRDRR L+ F+LS  L+K++  P G   SL ++D D +S DY+++C+K  
Sbjct  2    EQQATLLHHYRRDRRKLIEFLLSSGLIKELRTPSGPTNSLSNLDFDSLSADYIIHCVKSA  61

Query  323  GGMLELAEAIRDYHDSTLFPSVNNAGATTE--FFLATNPESSGS  448
            GG++++ EA   Y D + +P      + T   +FL + PES+GS
Sbjct  62   GGVVDVTEATNKYSDESAYPVTLQIHSQTRSSYFLVSEPESAGS  105



>ref|XP_011029212.1| PREDICTED: uncharacterized protein LOC105129017 isoform X5 [Populus 
euphratica]
Length=1155

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 63/104 (61%), Gaps = 4/104 (4%)
 Frame = +2

Query  149  ENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIK-K  322
            E    L+  YRRDRR L+ F+LS  L+K++  P G   SL ++D D +S DY+++C+K  
Sbjct  2    EQQATLLHHYRRDRRKLIEFLLSSGLIKELRTPSGPTNSLSNLDFDSLSADYIIHCVKSA  61

Query  323  GGMLELAEAIRDYHDSTLFPSVNNAGATTE--FFLATNPESSGS  448
            GG++++ EA   Y D + +P      + T   +FL + PES+GS
Sbjct  62   GGVVDVTEATNKYSDESAYPVTLQIHSQTRSSYFLVSEPESAGS  105



>ref|XP_010278592.1| PREDICTED: uncharacterized protein LOC104612733 [Nelumbo nucifera]
Length=1184

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 67/113 (59%), Gaps = 18/113 (16%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvdyvlNCIKKGGMLELA  343
            L ++YR DRR LL+F+LS  L+K+   P G V L  VDLD++SVDYVL CI  GG+L+L+
Sbjct  6    LQEKYRCDRRKLLDFILSAGLIKEFRTPSGPVGLSAVDLDKISVDYVLECIGSGGVLDLS  65

Query  344  EAIRDYHDSTLFPS------------------VNNAGATTEFFLATNPESSGS  448
            EA + Y+D   +P+                  V  + + + +FL ++PE SGS
Sbjct  66   EATKKYNDEFRYPAMVVIHFCWSNCHLLKLKNVIKSPSKSYYFLISDPEMSGS  118



>gb|KFK31929.1| hypothetical protein AALP_AA6G177300 [Arabis alpina]
Length=1092

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvsldd-vdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYR DRR LL F++S  LVK++  P G+++     DLD +S DYVL+C+K GG++++
Sbjct  4    LLQRYRNDRRKLLEFLMSSGLVKELRSPSGSITSLSPSDLDSLSADYVLDCVKSGGVVDV  63

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +     Y+  + +P    A +   +FL ++P+ +GS
Sbjct  64   SRGTEKYNFESSYPVTIQAESGDSYFLVSSPDVAGS  99



>gb|KFK31928.1| hypothetical protein AALP_AA6G177300 [Arabis alpina]
Length=1068

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvsldd-vdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYR DRR LL F++S  LVK++  P G+++     DLD +S DYVL+C+K GG++++
Sbjct  4    LLQRYRNDRRKLLEFLMSSGLVKELRSPSGSITSLSPSDLDSLSADYVLDCVKSGGVVDV  63

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +     Y+  + +P    A +   +FL ++P+ +GS
Sbjct  64   SRGTEKYNFESSYPVTIQAESGDSYFLVSSPDVAGS  99



>ref|XP_004147987.1| PREDICTED: uncharacterized protein LOC101213131 [Cucumis sativus]
Length=1096

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYRRDR+ LL F+LS  L+K++  P G       VDLD +S  YVL CIK GG++++
Sbjct  6    LLQRYRRDRQKLLAFLLSSRLIKELRTPAGPVTDFSAVDLDSLSASYVLECIKSGGVIDI  65

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            + A +     + +P++  +   T +FL T+P+ SG
Sbjct  66   STASKRKLLESAYPTMIQSRFRTTYFLRTHPDLSG  100



>ref|XP_002509741.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51128.1| conserved hypothetical protein [Ricinus communis]
Length=1146

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 67/104 (64%), Gaps = 1/104 (1%)
 Frame = +2

Query  140  MEEENGVELVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCI  316
            MEE+  V L+ RYRRDR+ LL F+LS  L++++ +      SL D+D D +S DY+L+ +
Sbjct  1    MEEQKQVALLHRYRRDRQKLLEFLLSSGLIRELRISTAPVNSLSDIDFDSLSTDYILHSL  60

Query  317  KKGGMLELAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            K GG++++ EA  +Y   + +P  +++     +FL ++P+ +GS
Sbjct  61   KSGGVIDVTEATNNYLLESAYPITSHSLVRDTYFLVSDPDIAGS  104



>ref|XP_008448959.1| PREDICTED: uncharacterized protein LOC103490971 [Cucumis melo]
Length=1093

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 62/97 (64%), Gaps = 3/97 (3%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYRRDR+ LL F+LS  L++++  P G       VDLD +S  YVL CIK GG++++
Sbjct  6    LLQRYRRDRQKLLAFLLSSRLIRELRTPTGPVTDFSVVDLDSLSASYVLECIKSGGVIDI  65

Query  341  AEA-IRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            + A  R  H+S  +P +  +   T +FL ++P+ SGS
Sbjct  66   STASKRKLHESA-YPIMIQSRFRTTYFLRSHPDLSGS  101



>ref|XP_006286936.1| hypothetical protein CARUB_v10000081mg [Capsella rubella]
 gb|EOA19834.1| hypothetical protein CARUB_v10000081mg [Capsella rubella]
Length=1135

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGA-vslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYR DRR LL F++S  LV ++  P G+  SL   DLD +S DYVL+C+K GG++++
Sbjct  4    LLQRYRNDRRKLLEFLMSSGLVTELRSPSGSPASLSPDDLDSLSADYVLDCVKSGGVVDV  63

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            ++  + Y+  + +P   ++ +   FFL ++P+ +GS
Sbjct  64   SKGTKKYNFDSSYPVTIHSESRDSFFLVSSPDIAGS  99



>ref|NP_192904.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE83037.1| uncharacterized protein AT4G11670 [Arabidopsis thaliana]
Length=1117

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGA-vslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYR DRR L+ F++S  LVK++  P G+  SL   DLD +S DYVL+C+K GG++++
Sbjct  4    LLQRYRNDRRKLMEFLMSSGLVKELRSPSGSPTSLSPADLDALSADYVLDCVKSGGVVDV  63

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            ++    Y+  + +P   ++ +   +FL ++P+ +GS
Sbjct  64   SKGREKYNFDSSYPVTIHSESGDSYFLVSSPDLAGS  99



>ref|XP_002276624.2| PREDICTED: uncharacterized protein LOC100259829 isoform X1 [Vitis 
vinifera]
Length=1141

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYRRDRR LL+F+LS + + ++        ++ D DLD VS DYVL+C+K GG++++
Sbjct  4    LLQRYRRDRRKLLDFILSSASIHQIPTSSAPTANVSDSDLDVVSADYVLDCLKSGGVVDI  63

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +EA + Y++ +  P + ++     +FL+++P+ + S
Sbjct  64   SEATKRYYEESARPVMIHSQLGDSYFLSSDPDLAES  99



>emb|CAN82269.1| hypothetical protein VITISV_009287 [Vitis vinifera]
Length=335

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvslddvdldqvsvd-yvlNCIKKGGMLEL  340
            L+QRYRRDRR LL+F+LS + + ++       +        V    YVL+C+K GG++++
Sbjct  4    LLQRYRRDRRKLLDFILSSASIHQIPTSSAPTANVSDSDLDVVSADYVLDCLKSGGVVDI  63

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +EA + Y++ +  P + ++     +FL+++P+ + S
Sbjct  64   SEATKRYYEESARPVMIHSQLGDSYFLSSDPDLAES  99



>ref|XP_009124796.1| PREDICTED: uncharacterized protein LOC103849822 isoform X1 [Brassica 
rapa]
Length=1129

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKV--VMPPGAvslddvdldqvsvdyvlNCIKKGGMLE  337
            L++RYR DRR L+ F++S  LVK++       + SL   DLD +S DYVL+C+K GG+++
Sbjct  4    LLERYRNDRRKLMEFLMSSGLVKELRSPSGSSSTSLSPADLDALSADYVLDCVKSGGVVD  63

Query  338  LAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +++A + Y+  + +P   ++ +   +FL ++P+++GS
Sbjct  64   VSKATKKYNFESSYPVTMHSESRDSYFLVSSPDAAGS  100



>emb|CBI34727.3| unnamed protein product [Vitis vinifera]
Length=1152

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPG-AvslddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYRRDRR LL+F+LS + + ++        ++ D DLD VS DYVL+C+K GG++++
Sbjct  4    LLQRYRRDRRKLLDFILSSASIHQIPTSSAPTANVSDSDLDVVSADYVLDCLKSGGVVDI  63

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +EA + Y++ +  P + ++     +FL+++P+ + S
Sbjct  64   SEATKRYYEESARPVMIHSQLGDSYFLSSDPDLAES  99



>emb|CDX86760.1| BnaA09g21500D [Brassica napus]
Length=1119

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKV--VMPPGAvslddvdldqvsvdyvlNCIKKGGMLE  337
            L++RYR DRR L+ F++S  LVK++       + SL   DLD +S DYVL+C+K GG+++
Sbjct  4    LLERYRNDRRKLMEFLMSSGLVKELRSPSGSSSTSLSPADLDALSADYVLDCVKSGGVVD  63

Query  338  LAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
            +++A + Y+  + +P   ++ +   +FL ++P+++GS
Sbjct  64   VSKATKKYNFESSYPVTMHSESRDSYFLVSSPDAAGS  100



>ref|XP_006396866.1| hypothetical protein EUTSA_v100283711mg, partial [Eutrema salsugineum]
 gb|ESQ38319.1| hypothetical protein EUTSA_v100283711mg, partial [Eutrema salsugineum]
Length=757

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKVVMPPGAvs-lddvdldqvsvdyvlNCIKKGGMLEL  340
            L+QRYR DRR LL F++S  LV+++    G+ + L   DLD +S DYVL+C+K GG++++
Sbjct  4    LLQRYRNDRRKLLEFLMSSGLVRELRSLSGSSTPLSPADLDALSADYVLDCVKSGGVVDV  63

Query  341  AEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSGS  448
             +  + ++  + +P   ++ +   FFL ++P+ +GS
Sbjct  64   FKGTKKFNFESSYPVTIHSESRDSFFLVSSPDVAGS  99



>emb|CDY70879.1| BnaCnng70160D [Brassica napus]
Length=244

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +2

Query  164  LVQRYRRDRRVLLNFMLSGSLVKKV--VMPPGAvslddvdldqvsvdyvlNCIKKGGMLE  337
            L++RYR DRR L+ F++S  LVK++       + SL   DLD +S DYVL+C+K GG+++
Sbjct  4    LLERYRNDRRKLMEFLMSSGLVKELRSHSGSSSASLSPADLDALSADYVLDCVKSGGVVD  63

Query  338  LAEAIRDYHDSTLFPSVNNAGATTEFFLATNPESSG  445
            +++A + Y+  + +P   ++ +   +FL ++P+++G
Sbjct  64   VSKATKKYNFESSYPVTIHSESRDSYFLVSSPDAAG  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500