BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS148G10

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630370.1|  PREDICTED: kinesin-like protein NACK2 isofor...    285   6e-86   
ref|XP_009630368.1|  PREDICTED: kinesin-like protein NACK1 isofor...    285   7e-86   Nicotiana tomentosiformis
ref|XP_009772334.1|  PREDICTED: kinesin-like protein NACK2              285   8e-86   Nicotiana sylvestris
ref|XP_006340707.1|  PREDICTED: kinesin-like protein NACK1-like         281   1e-84   Solanum tuberosum [potatoes]
ref|XP_004232466.1|  PREDICTED: kinesin-like protein NACK2              281   2e-84   Solanum lycopersicum
gb|EPS64209.1|  hypothetical protein M569_10571                         261   3e-81   Genlisea aurea
emb|CDP01925.1|  unnamed protein product                                271   5e-81   Coffea canephora [robusta coffee]
ref|XP_009791027.1|  PREDICTED: kinesin-like protein NACK1              269   3e-80   Nicotiana sylvestris
ref|XP_009597015.1|  PREDICTED: kinesin-like protein NACK1              269   3e-80   Nicotiana tomentosiformis
ref|XP_011090438.1|  PREDICTED: kinesin-like protein NACK1              269   3e-80   Sesamum indicum [beniseed]
gb|EYU31140.1|  hypothetical protein MIMGU_mgv1a000697mg                268   1e-79   Erythranthe guttata [common monkey flower]
gb|KDO71124.1|  hypothetical protein CISIN_1g001693mg                   266   3e-79   Citrus sinensis [apfelsine]
ref|XP_006425531.1|  hypothetical protein CICLE_v10024791mg             266   3e-79   Citrus clementina [clementine]
ref|XP_006466914.1|  PREDICTED: kinesin-like protein NACK1-like i...    266   4e-79   
gb|KDP46700.1|  hypothetical protein JCGZ_06488                         265   1e-78   Jatropha curcas
ref|XP_009378198.1|  PREDICTED: kinesin-like protein NACK2 isofor...    263   3e-78   Pyrus x bretschneideri [bai li]
gb|KEH20389.1|  ATP-binding microtubule motor family protein            263   4e-78   Medicago truncatula
ref|XP_009378197.1|  PREDICTED: kinesin-like protein NACK1 isofor...    263   4e-78   
ref|XP_008372766.1|  PREDICTED: kinesin-like protein NACK1              262   9e-78   
ref|XP_004289095.1|  PREDICTED: kinesin-like protein NACK2              262   1e-77   Fragaria vesca subsp. vesca
ref|XP_009338641.1|  PREDICTED: kinesin-like protein NACK2 isofor...    261   1e-77   Pyrus x bretschneideri [bai li]
gb|AET03829.2|  ATP-binding microtubule motor family protein            262   1e-77   Medicago truncatula
gb|KEH20388.1|  ATP-binding microtubule motor family protein            262   1e-77   Medicago truncatula
ref|XP_009338640.1|  PREDICTED: kinesin-like protein NACK2 isofor...    261   1e-77   
ref|XP_011025920.1|  PREDICTED: kinesin-like protein NACK2              261   3e-77   Populus euphratica
ref|XP_007203241.1|  hypothetical protein PRUPE_ppa001146mg             259   5e-77   
ref|XP_004512117.1|  PREDICTED: kinesin-related protein 4-like is...    259   5e-77   Cicer arietinum [garbanzo]
ref|XP_004512118.1|  PREDICTED: kinesin-related protein 4-like is...    259   5e-77   
ref|XP_007046742.1|  ATP binding microtubule motor family protein...    259   8e-77   
ref|XP_002531511.1|  conserved hypothetical protein                     259   8e-77   Ricinus communis
ref|XP_008241798.1|  PREDICTED: kinesin-like protein NACK1              259   1e-76   Prunus mume [ume]
ref|XP_006380794.1|  hypothetical protein POPTR_0007s13860g             259   1e-76   
gb|AAK50070.1|AF372930_1  AT5g66310/K1L20_9                             247   4e-76   Arabidopsis thaliana [mouse-ear cress]
gb|KCW53110.1|  hypothetical protein EUGRSUZ_J02401                     256   4e-76   Eucalyptus grandis [rose gum]
ref|XP_007157943.1|  hypothetical protein PHAVU_002G111200g             257   4e-76   Phaseolus vulgaris [French bean]
gb|KJB48330.1|  hypothetical protein B456_008G063800                    257   6e-76   Gossypium raimondii
ref|XP_010113382.1|  Kinesin-related protein 4                          257   7e-76   Morus notabilis
ref|XP_006383133.1|  kinesin motor family protein                       256   8e-76   
ref|XP_010033468.1|  PREDICTED: kinesin-like protein NACK1              256   1e-75   Eucalyptus grandis [rose gum]
gb|KHN41676.1|  Kinesin-related protein 4                               256   1e-75   Glycine soja [wild soybean]
gb|KHF98716.1|  Kinesin-related 11                                      256   1e-75   Gossypium arboreum [tree cotton]
gb|AES95091.2|  ATP-binding microtubule motor family protein            256   1e-75   Medicago truncatula
ref|XP_003538873.1|  PREDICTED: kinesin-like protein NACK1-like i...    255   2e-75   Glycine max [soybeans]
ref|XP_010317234.1|  PREDICTED: kinesin-like protein NACK1 isofor...    254   6e-75   Solanum lycopersicum
ref|XP_006599340.1|  PREDICTED: kinesin-like protein NACK1-like i...    254   6e-75   Glycine max [soybeans]
ref|XP_007156119.1|  hypothetical protein PHAVU_003G260200g             252   3e-74   Phaseolus vulgaris [French bean]
ref|XP_008452056.1|  PREDICTED: kinesin-like protein NACK1 isofor...    251   3e-74   Cucumis melo [Oriental melon]
ref|XP_003516550.1|  PREDICTED: kinesin-like protein NACK2-like i...    252   4e-74   
ref|XP_003519876.1|  PREDICTED: kinesin-like protein NACK1-like         251   5e-74   Glycine max [soybeans]
gb|KJB43376.1|  hypothetical protein B456_007G196800                    251   5e-74   Gossypium raimondii
ref|XP_006854867.1|  hypothetical protein AMTR_s00182p00038530          251   5e-74   Amborella trichopoda
ref|XP_008452051.1|  PREDICTED: kinesin-like protein NACK1 isofor...    251   6e-74   
ref|XP_010649060.1|  PREDICTED: kinesin-like protein NACK1              251   7e-74   Vitis vinifera
gb|KJB43375.1|  hypothetical protein B456_007G196800                    251   8e-74   Gossypium raimondii
gb|KHN36049.1|  Kinesin-related protein 4                               250   9e-74   Glycine soja [wild soybean]
ref|XP_010647602.1|  PREDICTED: kinesin-like protein NACK1              250   2e-73   Vitis vinifera
ref|XP_002876073.1|  kinesin motor family protein                       250   2e-73   
gb|KGN53326.1|  hypothetical protein Csa_4G047870                       249   2e-73   Cucumis sativus [cucumbers]
ref|XP_004160983.1|  PREDICTED: uncharacterized LOC101218717            249   2e-73   
ref|XP_004509341.1|  PREDICTED: kinesin-related protein 4-like is...    249   3e-73   Cicer arietinum [garbanzo]
ref|XP_003612133.1|  Kinesin-related protein                            249   4e-73   
ref|XP_010426656.1|  PREDICTED: kinesin-like protein NACK1 isofor...    249   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010271468.1|  PREDICTED: kinesin-like protein NACK2              248   6e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010515505.1|  PREDICTED: kinesin-like protein NACK1 isofor...    248   2e-72   Camelina sativa [gold-of-pleasure]
gb|EYU24075.1|  hypothetical protein MIMGU_mgv1a001308mg                246   2e-72   Erythranthe guttata [common monkey flower]
ref|NP_001190049.1|  ATP binding microtubule motor family protein       247   2e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CAB62637.1|  putative protein                                       247   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190684.3|  ATP binding microtubule motor family protein          247   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403945.1|  hypothetical protein EUTSA_v10010086mg             247   3e-72   
gb|KDO84748.1|  hypothetical protein CISIN_1g001290mg                   247   3e-72   Citrus sinensis [apfelsine]
gb|KDO84747.1|  hypothetical protein CISIN_1g001290mg                   247   3e-72   Citrus sinensis [apfelsine]
ref|XP_006473601.1|  PREDICTED: kinesin-like protein NACK1-like i...    247   3e-72   Citrus sinensis [apfelsine]
ref|XP_010550452.1|  PREDICTED: kinesin-like protein NACK1 isofor...    247   3e-72   Tarenaya hassleriana [spider flower]
ref|XP_006473600.1|  PREDICTED: kinesin-like protein NACK1-like i...    247   3e-72   Citrus sinensis [apfelsine]
ref|XP_006473602.1|  PREDICTED: kinesin-like protein NACK1-like i...    247   4e-72   
ref|XP_009386558.1|  PREDICTED: kinesin-like protein NACK1              246   4e-72   
ref|XP_010263901.1|  PREDICTED: kinesin-like protein NACK1 isofor...    245   4e-72   Nelumbo nucifera [Indian lotus]
ref|XP_003629353.1|  Kinesin heavy chain DNA binding protein-like...    247   4e-72   
ref|XP_010263900.1|  PREDICTED: kinesin-like protein NACK1 isofor...    246   5e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010919401.1|  PREDICTED: kinesin-like protein NACK2 isofor...    246   6e-72   Elaeis guineensis
dbj|BAB10710.1|  kinesin heavy chain DNA binding protein-like           246   7e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201432.2|  ATP binding microtubule motor family protein          246   8e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009587868.1|  PREDICTED: kinesin-like protein NACK2              244   1e-71   
ref|XP_011100938.1|  PREDICTED: kinesin-like protein NACK1              245   1e-71   
ref|XP_008791672.1|  PREDICTED: kinesin-like protein NACK1 isofor...    243   2e-71   
ref|XP_008775732.1|  PREDICTED: kinesin-like protein NACK1 isofor...    244   2e-71   Phoenix dactylifera
ref|XP_009407965.1|  PREDICTED: kinesin-like protein NACK2              244   2e-71   
ref|XP_002865077.1|  kinesin motor family protein                       244   2e-71   
ref|XP_008775730.1|  PREDICTED: kinesin-like protein NACK1 isofor...    244   3e-71   Phoenix dactylifera
emb|CDO96988.1|  unnamed protein product                                243   3e-71   Coffea canephora [robusta coffee]
ref|XP_002280678.2|  PREDICTED: kinesin-like protein NACK1              243   4e-71   Vitis vinifera
ref|XP_008791670.1|  PREDICTED: kinesin-like protein NACK2 isofor...    243   4e-71   
ref|XP_006435104.1|  hypothetical protein CICLE_v10000097mg             244   4e-71   Citrus clementina [clementine]
ref|XP_009767346.1|  PREDICTED: kinesin-like protein NACK2 isofor...    243   5e-71   Nicotiana sylvestris
ref|XP_009767348.1|  PREDICTED: kinesin-like protein NACK2 isofor...    243   5e-71   Nicotiana sylvestris
emb|CDX77978.1|  BnaA09g31730D                                          243   6e-71   
ref|XP_004146557.1|  PREDICTED: uncharacterized protein LOC101218717    243   6e-71   
emb|CBI19799.3|  unnamed protein product                                243   6e-71   Vitis vinifera
ref|XP_010465682.1|  PREDICTED: kinesin-like protein NACK1              243   8e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010444813.1|  PREDICTED: kinesin-like protein NACK2              243   9e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010484662.1|  PREDICTED: kinesin-like protein NACK1 isofor...    243   9e-71   Camelina sativa [gold-of-pleasure]
emb|CDY30779.1|  BnaC07g16790D                                          242   1e-70   Brassica napus [oilseed rape]
emb|CDY29004.1|  BnaC07g32100D                                          242   1e-70   Brassica napus [oilseed rape]
gb|ABB45845.1|  hypothetical protein                                    242   1e-70   Eutrema halophilum
emb|CDY45220.1|  BnaA07g12700D                                          242   2e-70   Brassica napus [oilseed rape]
ref|XP_011092849.1|  PREDICTED: kinesin-like protein NACK1 isofor...    241   2e-70   Sesamum indicum [beniseed]
ref|XP_009115792.1|  PREDICTED: kinesin-like protein NACK1 isofor...    241   2e-70   
ref|XP_002301999.2|  kinesin motor family protein                       241   2e-70   
gb|EYU38855.1|  hypothetical protein MIMGU_mgv1a000996mg                240   3e-70   Erythranthe guttata [common monkey flower]
emb|CDX73746.1|  BnaC08g22570D                                          240   4e-70   
ref|XP_009393646.1|  PREDICTED: kinesin-like protein NACK1              240   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007017694.1|  ATP binding microtubule motor family protein...    241   4e-70   
gb|KDP27640.1|  hypothetical protein JCGZ_19645                         240   5e-70   Jatropha curcas
ref|XP_002510482.1|  ATP binding protein, putative                      239   7e-70   
ref|XP_008388154.1|  PREDICTED: kinesin-like protein NACK1              229   7e-70   
ref|XP_010690757.1|  PREDICTED: kinesin-like protein NACK1              239   1e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006281818.1|  hypothetical protein CARUB_v10028003mg             239   1e-69   Capsella rubella
ref|XP_010933747.1|  PREDICTED: kinesin-like protein NACK1              238   2e-69   Elaeis guineensis
ref|XP_011028953.1|  PREDICTED: kinesin-like protein NACK1 isofor...    238   3e-69   Populus euphratica
ref|XP_011028954.1|  PREDICTED: kinesin-like protein NACK1 isofor...    238   3e-69   Populus euphratica
ref|XP_009386197.1|  PREDICTED: kinesin-like protein NACK1              238   3e-69   
ref|XP_009617690.1|  PREDICTED: kinesin-like protein NACK2              237   6e-69   Nicotiana tomentosiformis
gb|EYU35751.1|  hypothetical protein MIMGU_mgv1a020956mg                224   8e-69   Erythranthe guttata [common monkey flower]
ref|XP_009760421.1|  PREDICTED: kinesin-like protein NACK2              236   9e-69   Nicotiana sylvestris
ref|XP_004238322.1|  PREDICTED: kinesin-like protein NACK2              236   1e-68   Solanum lycopersicum
ref|XP_011083601.1|  PREDICTED: kinesin-like protein NACK1              236   1e-68   Sesamum indicum [beniseed]
ref|XP_006342008.1|  PREDICTED: kinesin-like protein NACK2-like i...    236   2e-68   
ref|XP_006342006.1|  PREDICTED: kinesin-like protein NACK2-like i...    236   2e-68   
ref|XP_004509338.1|  PREDICTED: kinesin-related protein 4-like is...    236   2e-68   
ref|XP_009136598.1|  PREDICTED: kinesin-like protein NACK1 isofor...    236   3e-68   Brassica rapa
ref|XP_011458294.1|  PREDICTED: kinesin-like protein NACK1              235   3e-68   Fragaria vesca subsp. vesca
emb|CDX90660.1|  BnaA03g41210D                                          235   3e-68   
ref|XP_008796871.1|  PREDICTED: kinesin-like protein NACK1              235   4e-68   Phoenix dactylifera
ref|XP_010315333.1|  PREDICTED: kinesin-like protein NACK2 isofor...    234   4e-68   Solanum lycopersicum
ref|XP_010315335.1|  PREDICTED: kinesin-like protein NACK2 isofor...    234   5e-68   Solanum lycopersicum
ref|XP_009777060.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    234   6e-68   Nicotiana sylvestris
ref|XP_007201806.1|  hypothetical protein PRUPE_ppa001038mg             234   7e-68   
ref|XP_002512997.1|  ATP binding protein, putative                      233   8e-68   
ref|XP_007226270.1|  hypothetical protein PRUPE_ppa019074mg             234   8e-68   
ref|XP_009398104.1|  PREDICTED: kinesin-like protein NACK1              234   8e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007131749.1|  hypothetical protein PHAVU_011G038800g             233   1e-67   Phaseolus vulgaris [French bean]
ref|XP_007131750.1|  hypothetical protein PHAVU_011G038800g             233   2e-67   Phaseolus vulgaris [French bean]
ref|XP_011074638.1|  PREDICTED: kinesin-like protein NACK1 isofor...    233   2e-67   
emb|CDP07439.1|  unnamed protein product                                233   2e-67   Coffea canephora [robusta coffee]
ref|XP_010503800.1|  PREDICTED: kinesin-like protein NACK1              233   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_011074636.1|  PREDICTED: kinesin-like protein NACK2 isofor...    233   2e-67   
ref|XP_006423481.1|  hypothetical protein CICLE_v10027758mg             233   2e-67   
ref|XP_006423482.1|  hypothetical protein CICLE_v10027758mg             233   2e-67   
ref|XP_002313758.2|  kinesin motor family protein                       233   2e-67   
gb|EYU37862.1|  hypothetical protein MIMGU_mgv1a001175mg                232   2e-67   Erythranthe guttata [common monkey flower]
gb|KJB63570.1|  hypothetical protein B456_010G006400                    232   3e-67   Gossypium raimondii
ref|XP_007042026.1|  ATP binding microtubule motor family protein...    232   3e-67   
gb|KHN25430.1|  Centromere-associated protein E                         232   4e-67   Glycine soja [wild soybean]
ref|XP_007135918.1|  hypothetical protein PHAVU_009G003000g             231   4e-67   Phaseolus vulgaris [French bean]
ref|XP_010535298.1|  PREDICTED: kinesin-like protein NACK1              233   4e-67   
ref|XP_006661465.1|  PREDICTED: kinesin-like protein NACK2-like         231   5e-67   Oryza brachyantha
gb|EYU40392.1|  hypothetical protein MIMGU_mgv1a001117mg                231   5e-67   Erythranthe guttata [common monkey flower]
gb|KJB32589.1|  hypothetical protein B456_005G248400                    231   5e-67   Gossypium raimondii
ref|XP_010672217.1|  PREDICTED: kinesin-like protein NACK2              232   5e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008448048.1|  PREDICTED: kinesin-like protein NACK2              231   6e-67   
ref|XP_008221318.1|  PREDICTED: kinesin-like protein NACK1              232   6e-67   Prunus mume [ume]
ref|XP_011088489.1|  PREDICTED: kinesin-like protein NACK1              231   6e-67   Sesamum indicum [beniseed]
ref|NP_001063734.2|  Os09g0528000                                       231   7e-67   
gb|EPS66111.1|  hypothetical protein M569_08665                         230   9e-67   Genlisea aurea
ref|XP_004958729.1|  PREDICTED: kinesin-like protein NACK1-like         231   9e-67   Setaria italica
ref|XP_009389113.1|  PREDICTED: kinesin-like protein NACK1              231   9e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE70089.1|  hypothetical protein OsJ_30085                          230   1e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008236841.1|  PREDICTED: kinesin-like protein NACK2              231   1e-66   Prunus mume [ume]
gb|KCW53111.1|  hypothetical protein EUGRSUZ_J02403                     230   1e-66   Eucalyptus grandis [rose gum]
ref|XP_009336756.1|  PREDICTED: kinesin-like protein NACK1              231   1e-66   
gb|EMT22069.1|  Kinesin-related protein 4                               231   1e-66   
ref|XP_010526582.1|  PREDICTED: kinesin-like protein NACK1 isofor...    229   1e-66   
gb|KDO49885.1|  hypothetical protein CISIN_1g002139mg                   229   1e-66   Citrus sinensis [apfelsine]
ref|XP_011047311.1|  PREDICTED: kinesin-like protein NACK2 isofor...    230   1e-66   Populus euphratica
gb|AAD23678.1|  putative kinesin heavy chain                            225   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011047336.1|  PREDICTED: kinesin-like protein NACK2 isofor...    230   2e-66   Populus euphratica
ref|XP_010526578.1|  PREDICTED: kinesin-like protein NACK1 isofor...    229   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_004148539.1|  PREDICTED: kinesin-like protein KIN12B-like        230   2e-66   Cucumis sativus [cucumbers]
ref|XP_009378441.1|  PREDICTED: kinesin-like protein NACK1              230   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_008382370.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    229   3e-66   
ref|XP_004974129.1|  PREDICTED: kinesin-like protein NACK1-like i...    230   3e-66   Setaria italica
ref|XP_004974127.1|  PREDICTED: kinesin-like protein NACK1-like i...    230   3e-66   
ref|XP_008388149.1|  PREDICTED: kinesin-like protein NACK2              230   4e-66   
ref|XP_004974128.1|  PREDICTED: kinesin-like protein NACK1-like i...    229   4e-66   Setaria italica
ref|XP_006404570.1|  hypothetical protein EUTSA_v10000043mg             229   4e-66   Eutrema salsugineum [saltwater cress]
gb|EPS66399.1|  hypothetical protein M569_08373                         221   4e-66   Genlisea aurea
gb|KDO49879.1|  hypothetical protein CISIN_1g002139mg                   229   6e-66   Citrus sinensis [apfelsine]
ref|XP_006487377.1|  PREDICTED: kinesin-like protein NACK1-like i...    229   6e-66   Citrus sinensis [apfelsine]
ref|XP_006487385.1|  PREDICTED: kinesin-like protein NACK1-like i...    228   6e-66   Citrus sinensis [apfelsine]
gb|KGN43176.1|  hypothetical protein Csa_7G006260                       229   7e-66   Cucumis sativus [cucumbers]
ref|XP_009117419.1|  PREDICTED: kinesin-like protein NACK1              228   1e-65   Brassica rapa
ref|XP_009336747.1|  PREDICTED: kinesin-like protein NACK1              229   1e-65   
emb|CDY13822.1|  BnaA09g43240D                                          228   1e-65   Brassica napus [oilseed rape]
ref|XP_008388151.1|  PREDICTED: kinesin-like protein NACK1              229   1e-65   
gb|KHG01762.1|  Kinesin-related 11                                      228   1e-65   Gossypium arboreum [tree cotton]
ref|XP_010091188.1|  Kinesin-related protein 11                         228   1e-65   Morus notabilis
gb|KHG01461.1|  Kinesin-related 11                                      228   2e-65   Gossypium arboreum [tree cotton]
ref|XP_010547436.1|  PREDICTED: kinesin-like protein NACK1 isofor...    228   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_010547438.1|  PREDICTED: kinesin-like protein NACK1 isofor...    228   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_010547437.1|  PREDICTED: kinesin-like protein NACK1 isofor...    228   2e-65   Tarenaya hassleriana [spider flower]
gb|ADQ43205.1|  kinesin motor family protein                            228   2e-65   Schrenkiella parvula
ref|XP_010235379.1|  PREDICTED: kinesin-like protein NACK2 isofor...    228   2e-65   
ref|XP_010235378.1|  PREDICTED: kinesin-like protein NACK2 isofor...    228   2e-65   
ref|XP_008668212.1|  PREDICTED: uncharacterized protein LOC100304...    227   2e-65   
ref|XP_008668211.1|  PREDICTED: uncharacterized protein LOC100304...    227   2e-65   
ref|XP_010547439.1|  PREDICTED: kinesin-like protein NACK2 isofor...    228   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_010547440.1|  PREDICTED: kinesin-like protein NACK2 isofor...    227   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_010531480.1|  PREDICTED: kinesin-like protein NACK1              226   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_010547442.1|  PREDICTED: kinesin-like protein NACK2 isofor...    227   2e-65   Tarenaya hassleriana [spider flower]
gb|EYU19439.1|  hypothetical protein MIMGU_mgv1a021560mg                212   2e-65   Erythranthe guttata [common monkey flower]
ref|XP_010547441.1|  PREDICTED: kinesin-like protein NACK2 isofor...    227   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_003607070.1|  Kinesin-related protein                            226   3e-65   
ref|XP_006659658.1|  PREDICTED: kinesin-like protein NACK2-like         226   4e-65   Oryza brachyantha
ref|XP_006296345.1|  hypothetical protein CARUB_v10025517mg             226   4e-65   Capsella rubella
gb|EEC83991.1|  hypothetical protein OsI_30145                          226   4e-65   Oryza sativa Indica Group [Indian rice]
emb|CDX82016.1|  BnaC08g35850D                                          226   5e-65   
gb|EEE69110.1|  hypothetical protein OsJ_28179                          226   5e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009345268.1|  PREDICTED: kinesin-like protein NACK1              226   5e-65   Pyrus x bretschneideri [bai li]
ref|NP_001062429.1|  Os08g0547500                                       226   5e-65   
gb|EMS48622.1|  Kinesin-related protein 4                               228   5e-65   Triticum urartu
gb|KHN39844.1|  Centromere-associated protein E                         226   5e-65   Glycine soja [wild soybean]
ref|XP_002880373.1|  kinesin motor family protein                       225   6e-65   
dbj|BAD09937.1|  putative kinesin heavy chain                           226   6e-65   Oryza sativa Japonica Group [Japonica rice]
ref|NP_179726.2|  ATP binding microtubule motor family protein          225   9e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98979.1|  Kinesin-related 11                                      225   1e-64   Gossypium arboreum [tree cotton]
ref|XP_011037209.1|  PREDICTED: kinesin-like protein NACK1              225   1e-64   Populus euphratica
gb|KDP38590.1|  hypothetical protein JCGZ_04515                         225   1e-64   Jatropha curcas
ref|XP_008652981.1|  PREDICTED: kinesin-like protein NACK1 isofor...    224   1e-64   
ref|XP_008652983.1|  PREDICTED: kinesin-like protein NACK1 isofor...    224   1e-64   
ref|XP_010028651.1|  PREDICTED: kinesin-like protein NACK1 isofor...    224   2e-64   Eucalyptus grandis [rose gum]
gb|KHN33713.1|  Centromere-associated protein E                         223   3e-64   Glycine soja [wild soybean]
ref|XP_010472110.1|  PREDICTED: kinesin-like protein NACK1              223   5e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002305465.1|  kinesin motor family protein                       223   5e-64   
ref|XP_010429028.1|  PREDICTED: kinesin-like protein NACK1              223   5e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006411686.1|  hypothetical protein EUTSA_v10024409mg             223   5e-64   
gb|EEC84919.1|  hypothetical protein OsI_32119                          224   6e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_010416871.1|  PREDICTED: kinesin-like protein NACK1              222   8e-64   
ref|XP_004293191.1|  PREDICTED: kinesin-like protein NACK2              223   1e-63   Fragaria vesca subsp. vesca
ref|XP_010679851.1|  PREDICTED: kinesin-like protein NACK1 isofor...    223   1e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006279726.1|  hypothetical protein CARUB_v10027496mg             223   1e-63   
ref|XP_010679850.1|  PREDICTED: kinesin-like protein NACK1 isofor...    223   2e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002868873.1|  kinesin motor family protein                       221   2e-63   
ref|XP_008444776.1|  PREDICTED: kinesin-like protein NACK1              221   2e-63   Cucumis melo [Oriental melon]
gb|KHN20030.1|  Kinesin-related protein 4                               221   3e-63   Glycine soja [wild soybean]
ref|XP_002444630.1|  hypothetical protein SORBIDRAFT_07g025040          221   3e-63   
ref|XP_009140272.1|  PREDICTED: kinesin-like protein NACK1              220   3e-63   Brassica rapa
gb|EYU34880.1|  hypothetical protein MIMGU_mgv1a024217mg                208   3e-63   Erythranthe guttata [common monkey flower]
ref|XP_003527612.1|  PREDICTED: kinesin-like protein NACK1-like i...    221   3e-63   Glycine max [soybeans]
ref|XP_003578490.1|  PREDICTED: kinesin-like protein NACK1              220   4e-63   
emb|CDY15900.1|  BnaA04g12110D                                          220   4e-63   Brassica napus [oilseed rape]
ref|XP_010436987.1|  PREDICTED: kinesin-like protein NACK1              220   5e-63   Camelina sativa [gold-of-pleasure]
ref|NP_195606.2|  ATP binding microtubule motor family protein          220   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446407.1|  PREDICTED: kinesin-like protein NACK1 isofor...    219   6e-63   Camelina sativa [gold-of-pleasure]
emb|CAB38815.1|  kinesin like protein                                   219   6e-63   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01464.1|  Kinesin-related 4                                       220   7e-63   Gossypium arboreum [tree cotton]
ref|XP_010431843.1|  PREDICTED: kinesin-like protein NACK1              219   8e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006283113.1|  hypothetical protein CARUB_v10004132mg             219   1e-62   
emb|CDX99601.1|  BnaC04g33580D                                          218   1e-62   
dbj|BAF02000.1|  kinesin like protein                                   218   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EEC77720.1|  hypothetical protein OsI_16807                          219   2e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_004167109.1|  PREDICTED: uncharacterized LOC101212680            219   2e-62   
ref|XP_004152764.1|  PREDICTED: uncharacterized protein LOC101212680    218   2e-62   Cucumis sativus [cucumbers]
gb|KJB58155.1|  hypothetical protein B456_009G196700                    218   2e-62   Gossypium raimondii
ref|NP_001053433.1|  Os04g0538800                                       218   2e-62   
ref|XP_009101918.1|  PREDICTED: kinesin-like protein NACK1              217   3e-62   Brassica rapa
dbj|BAK06679.1|  predicted protein                                      217   5e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006652585.1|  PREDICTED: kinesin-like protein NACK1-like         217   8e-62   Oryza brachyantha
ref|XP_010240186.1|  PREDICTED: kinesin-like protein NACK1 isofor...    217   8e-62   
ref|XP_010240185.1|  PREDICTED: kinesin-like protein NACK1 isofor...    217   1e-61   
ref|NP_199064.1|  ATP binding microtubule motor family protein          218   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004953277.1|  PREDICTED: kinesin-like protein NACK1-like i...    216   1e-61   Setaria italica
gb|AFW63202.1|  hypothetical protein ZEAMMB73_949881                    215   1e-61   
ref|XP_008678882.1|  PREDICTED: kinesin-like protein NACK1 isofor...    216   2e-61   Zea mays [maize]
gb|EEC73693.1|  hypothetical protein OsI_08272                          215   3e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001047571.1|  Os02g0645100                                       214   5e-61   
gb|EEE57470.1|  hypothetical protein OsJ_07710                          214   9e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KHN45902.1|  Kinesin-related protein 11                              213   2e-60   Glycine soja [wild soybean]
ref|XP_006647603.1|  PREDICTED: kinesin-like protein NACK1-like         213   2e-60   Oryza brachyantha
ref|XP_008663419.1|  PREDICTED: kinesin-like protein NACK1 isofor...    213   2e-60   
ref|XP_008663418.1|  PREDICTED: kinesin-like protein NACK1 isofor...    213   2e-60   
ref|XP_007136058.1|  hypothetical protein PHAVU_009G014400g             213   2e-60   
ref|XP_008669084.1|  PREDICTED: kinesin-like protein NACK1 isofor...    213   2e-60   
ref|XP_008669081.1|  PREDICTED: kinesin-like protein NACK1 isofor...    213   3e-60   
ref|XP_002448243.1|  hypothetical protein SORBIDRAFT_06g023880          213   3e-60   
ref|XP_008669085.1|  PREDICTED: kinesin-like protein NACK1 isofor...    212   3e-60   
tpg|DAA36661.1|  TPA: hypothetical protein ZEAMMB73_386599              213   3e-60   
ref|XP_003569980.1|  PREDICTED: kinesin-like protein NACK2              212   4e-60   
gb|AES73979.2|  ATP-binding microtubule motor family protein            215   4e-60   
ref|XP_003603728.1|  Kinesin-related protein                            215   4e-60   
ref|XP_010494185.1|  PREDICTED: kinesin-like protein NACK2              213   7e-60   
ref|XP_004976382.1|  PREDICTED: kinesin-like protein NACK1-like i...    210   2e-59   
ref|XP_010481985.1|  PREDICTED: kinesin-like protein NACK1              212   2e-59   
dbj|BAJ95863.1|  predicted protein                                      210   2e-59   
gb|EMS48860.1|  Kinesin-related protein 4                               209   4e-59   
gb|EMT03608.1|  Kinesin-related protein 4                               209   4e-59   
gb|EMT18151.1|  Kinesin-related protein 4                               208   7e-59   
gb|KHN09110.1|  Kinesin-related protein 4                               209   1e-58   
ref|XP_009123681.1|  PREDICTED: kinesin-like protein NACK1              209   1e-58   
ref|XP_006582466.1|  PREDICTED: kinesin-like protein NACK1-like         208   1e-58   
emb|CDY22404.1|  BnaA06g37260D                                          207   2e-58   
ref|XP_006403375.1|  hypothetical protein EUTSA_v10003349mg             208   4e-58   
ref|XP_002863777.1|  kinesin motor family protein                       207   1e-57   
ref|XP_006413467.1|  hypothetical protein EUTSA_v10026976mg             205   2e-57   
emb|CDY42594.1|  BnaC01g00060D                                          204   2e-57   
ref|XP_010433806.1|  PREDICTED: kinesin-like protein NACK1              205   3e-57   
ref|XP_009140424.1|  PREDICTED: kinesin-like protein NACK1              203   3e-57   
ref|XP_010448602.1|  PREDICTED: kinesin-like protein NACK1              205   4e-57   
gb|AAK91822.1|AF272759_1  kinesin heavy chain                           203   5e-57   
ref|NP_567695.1|  ATP binding microtubule motor family protein          204   6e-57   
ref|XP_006285338.1|  hypothetical protein CARUB_v10006728mg             202   2e-56   
gb|KHN00495.1|  Kinesin-related protein 11                              202   2e-56   
emb|CAB51660.1|  putative protein                                       204   2e-56   
emb|CDY03482.1|  BnaC01g16000D                                          201   5e-56   
emb|CDY03483.1|  BnaC01g15990D                                          186   9e-56   
emb|CDY34261.1|  BnaA01g13640D                                          199   1e-55   
ref|XP_009137750.1|  PREDICTED: kinesin-like protein NACK2              200   4e-55   
ref|XP_001779285.1|  predicted protein                                  195   6e-54   
ref|XP_009407329.1|  PREDICTED: kinesin-like protein NACK1              195   8e-54   
emb|CDY41952.1|  BnaA01g05240D                                          194   9e-54   
gb|AAB63609.1|  kinesin heavy chain isolog                              194   2e-53   
ref|XP_010051345.1|  PREDICTED: kinesin-like protein NACK2              192   7e-53   
gb|KCW81847.1|  hypothetical protein EUGRSUZ_C03198                     192   9e-53   
ref|XP_008775906.1|  PREDICTED: kinesin-like protein NACK1              191   1e-52   
ref|XP_010922342.1|  PREDICTED: kinesin-like protein NACK1              191   2e-52   
ref|XP_002462712.1|  hypothetical protein SORBIDRAFT_02g030680          190   3e-52   
gb|KGN51423.1|  hypothetical protein Csa_5G537000                       191   3e-52   
ref|XP_010906990.1|  PREDICTED: kinesin-like protein NACK1              190   6e-52   
ref|XP_004508036.1|  PREDICTED: centromere-associated protein E-l...    189   9e-52   
gb|EYU35741.1|  hypothetical protein MIMGU_mgv1a019603mg                176   1e-51   
ref|XP_008460563.1|  PREDICTED: kinesin-like protein NACK2 isofor...    189   1e-51   
ref|XP_008460562.1|  PREDICTED: kinesin-like protein NACK2 isofor...    189   1e-51   
ref|XP_002992286.1|  hypothetical protein SELMODRAFT_135047             188   1e-51   
ref|XP_002987833.1|  hypothetical protein SELMODRAFT_126650             188   1e-51   
ref|XP_010535794.1|  PREDICTED: kinesin-like protein NACK2 isofor...    188   3e-51   
ref|XP_010535793.1|  PREDICTED: kinesin-like protein NACK2 isofor...    187   3e-51   
emb|CBI27754.3|  unnamed protein product                                186   7e-51   
gb|KHG14242.1|  Kinesin-related 4                                       186   8e-51   
ref|XP_002275046.2|  PREDICTED: kinesin-like protein NACK2              186   8e-51   
ref|XP_010107075.1|  Kinesin-related protein 4                          187   8e-51   
ref|XP_006452892.1|  hypothetical protein CICLE_v10007377mg             186   8e-51   
ref|XP_009418072.1|  PREDICTED: kinesin-like protein NACK1              186   1e-50   
ref|XP_003528955.1|  PREDICTED: kinesin-like protein NACK1-like i...    186   2e-50   
gb|KHN20772.1|  Kinesin-related protein 4                               186   2e-50   
gb|KHN45051.1|  Kinesin-related protein 4                               184   3e-50   
ref|XP_006842375.1|  hypothetical protein AMTR_s00079p00190770          185   4e-50   
ref|XP_003541319.1|  PREDICTED: kinesin-like protein NACK2-like i...    184   4e-50   
ref|XP_008792831.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    184   5e-50   
gb|KJB82960.1|  hypothetical protein B456_013G222300                    184   6e-50   
ref|XP_007210400.1|  hypothetical protein PRUPE_ppa000865mg             184   6e-50   
gb|KJB82961.1|  hypothetical protein B456_013G222300                    184   6e-50   
gb|KJB82959.1|  hypothetical protein B456_013G222300                    184   6e-50   
ref|XP_006290553.1|  hypothetical protein CARUB_v10016639mg             184   6e-50   
ref|XP_008240232.1|  PREDICTED: kinesin-like protein NACK1              184   7e-50   
ref|XP_011072914.1|  PREDICTED: kinesin-like protein NACK1              184   8e-50   
ref|XP_008242294.1|  PREDICTED: kinesin-like protein NACK2              184   9e-50   
ref|XP_007203229.1|  hypothetical protein PRUPE_ppa000925mg             183   1e-49   
ref|XP_002516209.1|  microtubule motor, putative                        183   1e-49   
gb|KHN23757.1|  Kinesin-related protein 4                               183   1e-49   
ref|XP_003534160.1|  PREDICTED: kinesin-like protein NACK1-like i...    183   1e-49   
ref|XP_006477781.1|  PREDICTED: kinesin-like protein NACK1-like         183   2e-49   
gb|KDO49802.1|  hypothetical protein CISIN_1g002128mg                   183   2e-49   
ref|XP_006442593.1|  hypothetical protein CICLE_v10018724mg             182   2e-49   
ref|XP_010261715.1|  PREDICTED: kinesin-like protein NACK2              182   3e-49   
ref|XP_011078149.1|  PREDICTED: kinesin-like protein NACK2              182   4e-49   
ref|XP_010498223.1|  PREDICTED: kinesin-like protein NACK1              181   7e-49   
ref|XP_011045825.1|  PREDICTED: kinesin-like protein NACK1 isofor...    181   1e-48   
ref|XP_009149278.1|  PREDICTED: kinesin-like protein NACK1              181   1e-48   
emb|CDY26167.1|  BnaA06g12500D                                          181   1e-48   
ref|XP_011008305.1|  PREDICTED: kinesin-like protein NACK1              180   1e-48   
ref|XP_006474579.1|  PREDICTED: kinesin-like protein NACK2-like         180   1e-48   
gb|EYU28300.1|  hypothetical protein MIMGU_mgv1a001029mg                180   2e-48   
ref|XP_010909958.1|  PREDICTED: kinesin-like protein NACK1              180   2e-48   
emb|CDY21709.1|  BnaA09g44600D                                          180   2e-48   
ref|XP_009117616.1|  PREDICTED: kinesin-like protein NACK1              180   2e-48   
gb|KDP33977.1|  hypothetical protein JCGZ_07548                         179   2e-48   
ref|XP_006341574.1|  PREDICTED: kinesin-like protein NACK1-like i...    180   2e-48   
emb|CDX81870.1|  BnaC08g37310D                                          179   3e-48   
ref|XP_010477014.1|  PREDICTED: kinesin-like protein NACK1              180   3e-48   
ref|XP_006303901.1|  hypothetical protein CARUB_v10008207mg             179   3e-48   
ref|XP_004512893.1|  PREDICTED: kinesin-II 95 kDa subunit-like is...    179   3e-48   
ref|XP_006599344.1|  PREDICTED: kinesin-like protein NACK1-like i...    179   3e-48   
ref|XP_010540004.1|  PREDICTED: kinesin-like protein NACK1              179   3e-48   
ref|XP_004235748.1|  PREDICTED: kinesin-like protein NACK1              179   3e-48   
ref|NP_173273.2|  kinesin HINKEL                                        179   3e-48   
gb|AFW86156.1|  LOW QUALITY PROTEIN: kinesin heavy chain                179   3e-48   
ref|XP_008659376.1|  PREDICTED: kinesin-like protein NACK1              179   3e-48   
ref|XP_002893000.1|  hypothetical protein ARALYDRAFT_472057             179   4e-48   
ref|XP_007154542.1|  hypothetical protein PHAVU_003G127400g             179   4e-48   
ref|XP_007012545.1|  ATP binding microtubule motor family protein...    179   4e-48   
ref|XP_007012544.1|  ATP binding microtubule motor family protein...    179   5e-48   
ref|XP_009360131.1|  PREDICTED: kinesin-like protein NACK1              179   5e-48   
ref|XP_008393328.1|  PREDICTED: kinesin-like protein NACK1              179   5e-48   
emb|CDY19208.1|  BnaC05g14090D                                          179   6e-48   
ref|XP_002321490.2|  nodulin-25 precursor family protein                178   7e-48   
ref|XP_010459448.1|  PREDICTED: kinesin-like protein NACK1              178   8e-48   
ref|XP_009124539.1|  PREDICTED: kinesin-like protein NACK1              164   9e-48   
ref|XP_007036598.1|  ATP binding microtubule motor family protein...    176   9e-48   
ref|XP_011461059.1|  PREDICTED: kinesin-like protein NACK2              178   1e-47   
gb|KDP35186.1|  hypothetical protein JCGZ_10720                         178   1e-47   
ref|XP_006416611.1|  hypothetical protein EUTSA_v10006702mg             178   1e-47   
ref|XP_008337807.1|  PREDICTED: kinesin-like protein NACK2 isofor...    177   2e-47   
ref|XP_010227940.1|  PREDICTED: kinesin-like protein NACK1              177   2e-47   
ref|XP_008337808.1|  PREDICTED: kinesin-like protein NACK2 isofor...    177   2e-47   
gb|AES92142.2|  ATP-binding microtubule motor family protein            177   2e-47   
ref|XP_009359691.1|  PREDICTED: kinesin-like protein NACK2              177   3e-47   
ref|XP_002318539.1|  hypothetical protein POPTR_0012s05060g             177   3e-47   
emb|CAB89042.1|  kinesin-like protein                                   176   3e-47   
ref|NP_189907.2|  kinesin TETRASPORE                                    176   3e-47   
emb|CAD42234.1|  kinesin-like protein                                   176   3e-47   
emb|CAD42658.1|  kinesin-like protein                                   176   3e-47   
ref|XP_003620405.1|  Kinesin-like protein KIF3A                         176   3e-47   
ref|XP_009589619.1|  PREDICTED: kinesin-like protein NACK1              176   4e-47   
ref|XP_003609945.1|  Kinesin-like protein                               177   4e-47   
ref|XP_009804137.1|  PREDICTED: kinesin-like protein NACK1              176   4e-47   
ref|XP_004968822.1|  PREDICTED: kinesin-like protein NACK1-like i...    176   4e-47   
ref|XP_009625447.1|  PREDICTED: kinesin-like protein NACK2              176   4e-47   
ref|XP_009786270.1|  PREDICTED: kinesin-like protein NACK2 isofor...    176   5e-47   
ref|XP_009786271.1|  PREDICTED: kinesin-like protein NACK2 isofor...    176   5e-47   
dbj|BAK03253.1|  predicted protein                                      176   5e-47   
ref|XP_009786272.1|  PREDICTED: kinesin-like protein NACK2 isofor...    176   5e-47   
ref|XP_009786269.1|  PREDICTED: kinesin-like protein NACK2 isofor...    176   5e-47   
emb|CDP03034.1|  unnamed protein product                                176   6e-47   
ref|XP_007036597.1|  ATP binding microtubule motor family protein...    176   7e-47   
gb|KDO49883.1|  hypothetical protein CISIN_1g002139mg                   175   1e-46   
ref|XP_010323978.1|  PREDICTED: kinesin-like protein NACK2              175   1e-46   
gb|EMT03728.1|  Kinesin-related protein 4                               175   1e-46   
sp|Q8S949.1|NACK2_TOBAC  RecName: Full=Kinesin-like protein NACK2...    175   1e-46   
ref|XP_003568740.1|  PREDICTED: kinesin-like protein NACK1              175   1e-46   
ref|XP_006353764.1|  PREDICTED: kinesin-like protein NACK2-like         175   1e-46   
ref|XP_010110084.1|  Kinesin-related protein 4                          174   2e-46   
ref|XP_010693857.1|  PREDICTED: kinesin-like protein NACK1              174   2e-46   
ref|XP_010687583.1|  PREDICTED: kinesin-like protein NACK2              174   2e-46   
gb|KHG01962.1|  Kinesin-related 4                                       174   3e-46   
gb|EMS46463.1|  Kinesin-related protein 11                              173   3e-46   
ref|XP_002875601.1|  hypothetical protein ARALYDRAFT_323079             173   4e-46   
ref|XP_010430934.1|  PREDICTED: kinesin-like protein NACK2              173   5e-46   
gb|KJB52996.1|  hypothetical protein B456_008G287600                    173   6e-46   
ref|XP_006290563.1|  hypothetical protein CARUB_v10016650mg             173   6e-46   
ref|XP_002437695.1|  hypothetical protein SORBIDRAFT_10g001010          173   6e-46   
ref|XP_010537459.1|  PREDICTED: kinesin-like protein NACK1 isofor...    172   9e-46   
ref|XP_007152726.1|  hypothetical protein PHAVU_004G154300g             172   1e-45   
ref|XP_008460891.1|  PREDICTED: kinesin-like protein NACK1              172   2e-45   
ref|XP_006644227.1|  PREDICTED: kinesin-like protein NACK1-like         172   2e-45   
ref|XP_004300503.1|  PREDICTED: kinesin-like protein NACK1              171   2e-45   
ref|XP_011039916.1|  PREDICTED: kinesin-like protein NACK2              171   2e-45   
ref|XP_010250094.1|  PREDICTED: kinesin-like protein NACK1              171   3e-45   
gb|EPS71432.1|  hypothetical protein M569_03327                         171   3e-45   
ref|NP_001043186.1|  Os01g0513900                                       171   3e-45   
ref|XP_008356658.1|  PREDICTED: kinesin-like protein NACK1              171   4e-45   
gb|AES76623.2|  ATP-binding microtubule motor family protein            171   4e-45   
ref|XP_006381563.1|  TETRASPORE family protein                          171   5e-45   
gb|EMS62599.1|  Kinesin-related protein 4                               171   6e-45   
gb|EEC70753.1|  hypothetical protein OsI_02166                          170   6e-45   
ref|XP_004166306.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    170   7e-45   
gb|KGN64145.1|  hypothetical protein Csa_1G042550                       170   7e-45   
ref|XP_004137483.1|  PREDICTED: uncharacterized protein LOC101215425    170   7e-45   
gb|KJB08288.1|  hypothetical protein B456_001G075200                    170   8e-45   
gb|KHG07572.1|  kif4                                                    169   9e-45   
ref|XP_009347467.1|  PREDICTED: kinesin-like protein NACK1              170   9e-45   
gb|KJB08290.1|  hypothetical protein B456_001G075200                    170   9e-45   
ref|XP_010036903.1|  PREDICTED: kinesin-like protein NACK1              170   9e-45   
emb|CDY30956.1|  BnaA06g19570D                                          169   1e-44   
gb|KHG07573.1|  kif4                                                    169   1e-44   
emb|CDY44836.1|  BnaCnng11920D                                          169   1e-44   
ref|XP_009150293.1|  PREDICTED: kinesin-like protein NACK2              169   2e-44   
ref|XP_006419132.1|  hypothetical protein EUTSA_v10002392mg             168   2e-44   
ref|XP_002279228.1|  PREDICTED: kinesin-like protein NACK1              168   3e-44   
gb|KJB14919.1|  hypothetical protein B456_002G148900                    167   3e-44   
ref|XP_010514712.1|  PREDICTED: kinesin-like protein NACK2              168   4e-44   
gb|EYU21085.1|  hypothetical protein MIMGU_mgv1a000841mg                167   9e-44   
ref|XP_002452842.1|  hypothetical protein SORBIDRAFT_04g033453          154   1e-43   
dbj|BAJ94998.1|  predicted protein                                      165   3e-43   
emb|CDO98410.1|  unnamed protein product                                165   4e-43   
ref|XP_010279346.1|  PREDICTED: kinesin-like protein NACK1              164   1e-42   
gb|AAF25984.1|AC013354_3  F15H18.12                                     163   2e-42   
emb|CBI15491.3|  unnamed protein product                                162   2e-42   
ref|XP_010503028.1|  PREDICTED: kinesin-like protein NACK2              162   3e-42   
gb|EMS53749.1|  Kinesin-related protein 4                               162   4e-42   
ref|XP_010436197.1|  PREDICTED: kinesin-like protein NACK1              148   2e-41   
emb|CAE03025.3|  OSJNBa0091D06.23                                       159   7e-41   
ref|XP_010436196.1|  PREDICTED: kinesin-like protein NACK1              146   7e-41   
ref|XP_008367780.1|  PREDICTED: kinesin-like protein NACK1              152   1e-39   
ref|XP_009365403.1|  PREDICTED: uncharacterized protein LOC103955247    155   2e-39   
ref|XP_008678883.1|  PREDICTED: kinesin-like protein NACK1 isofor...    152   7e-39   
ref|XP_008361127.1|  PREDICTED: kinesin-like protein NACK1              152   2e-38   
gb|EMS68002.1|  Kinesin-related protein 11                              149   1e-37   
ref|XP_011028784.1|  PREDICTED: kinesin-like protein NACK1              136   7e-37   
gb|EMT24668.1|  Kinesin-related protein 11                              147   8e-37   
dbj|BAB40703.1|  kinesin-like polypeptides 4                            127   2e-33   
gb|KHN07313.1|  Kinesin heavy chain isoform 5C                          126   9e-33   
ref|XP_002524897.1|  conserved hypothetical protein                     124   6e-32   
ref|XP_011045826.1|  PREDICTED: kinesin-like protein NACK1 isofor...    124   8e-29   
ref|XP_001698555.1|  predicted protein                                  120   9e-29   
ref|XP_008508805.1|  PREDICTED: centromere-associated protein E-like    118   1e-28   
gb|EEC70757.1|  hypothetical protein OsI_02172                          117   6e-28   
ref|XP_007515497.1|  predicted protein                                  120   2e-27   
ref|XP_002951630.1|  CENPE type kinesin-like protein                    116   4e-27   
ref|XP_002501782.1|  predicted protein                                  116   4e-27   
gb|KJB46225.1|  hypothetical protein B456_007G3531001                   114   1e-26   
ref|XP_005648192.1|  kinesin-domain-containing protein                  114   1e-26   



>ref|XP_009630370.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana tomentosiformis]
Length=1023

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN+KEI RNDVSDW C+N TTI+Y+NV+LS SERSMYPS Y FDRVF  +C
Sbjct  18   ILVSVRLRPLNNKEIFRNDVSDWECINDTTIIYKNVNLSVSERSMYPSAYSFDRVFRPNC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK+VALSVV+GFNSSVFAYGQTSSGKT+TMTGITEYAI+DIYD+IQKH ER
Sbjct  78   STRQVYEEAAKDVALSVVSGFNSSVFAYGQTSSGKTFTMTGITEYAIADIYDYIQKHAER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAMEIYNESVRDLLS+D TPLRLLDDPERGT+V
Sbjct  138  DFILKFSAMEIYNESVRDLLSADSTPLRLLDDPERGTIV  176



>ref|XP_009630368.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nicotiana tomentosiformis]
Length=1028

 Score =   285 bits (728),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN+KEI RNDVSDW C+N TTI+Y+NV+LS SERSMYPS Y FDRVF  +C
Sbjct  18   ILVSVRLRPLNNKEIFRNDVSDWECINDTTIIYKNVNLSVSERSMYPSAYSFDRVFRPNC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK+VALSVV+GFNSSVFAYGQTSSGKT+TMTGITEYAI+DIYD+IQKH ER
Sbjct  78   STRQVYEEAAKDVALSVVSGFNSSVFAYGQTSSGKTFTMTGITEYAIADIYDYIQKHAER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAMEIYNESVRDLLS+D TPLRLLDDPERGT+V
Sbjct  138  DFILKFSAMEIYNESVRDLLSADSTPLRLLDDPERGTIV  176



>ref|XP_009772334.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=1027

 Score =   285 bits (728),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN+KEI RNDVSDW C+N TTI+Y+NV+LS SERSMYPS Y FDRVF  +C
Sbjct  18   ILVSVRLRPLNNKEIFRNDVSDWECINDTTIIYKNVNLSVSERSMYPSAYSFDRVFRPNC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK+VALSVV+GFNSSVFAYGQTSSGKT+TMTGITEYAI+DIYD+IQKH ER
Sbjct  78   STRQVYEEAAKDVALSVVSGFNSSVFAYGQTSSGKTFTMTGITEYAIADIYDYIQKHAER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAMEIYNESVRDLLS+D TPLRLLDDPERGT+V
Sbjct  138  DFILKFSAMEIYNESVRDLLSADSTPLRLLDDPERGTIV  176



>ref|XP_006340707.1| PREDICTED: kinesin-like protein NACK1-like [Solanum tuberosum]
Length=1023

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KEILRNDVSDW C+N TTI+Y+NV+LS SERSMYPS Y FDRVF ++C
Sbjct  21   ILVSVRLRPLNDKEILRNDVSDWECINDTTIIYKNVNLSLSERSMYPSAYTFDRVFRTNC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK+VALSV++GFNSSVFAYGQTSSGKTYTMTGITEYAI+DIYD+IQKH+ER
Sbjct  81   STRQVYEETAKDVALSVLSGFNSSVFAYGQTSSGKTYTMTGITEYAIADIYDYIQKHSER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAMEIYNESVRDLLS+D T LRLLDDPERGT+V
Sbjct  141  DFILKFSAMEIYNESVRDLLSADTTLLRLLDDPERGTIV  179



>ref|XP_004232466.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=1019

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KEILRND SDW C+N TTI+Y+NV+LS SERSMYPS Y FDRVF ++C
Sbjct  17   ILVSVRLRPLNDKEILRNDASDWECINDTTIIYKNVNLSVSERSMYPSAYTFDRVFRTNC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK+VALSV+NGFNSSVFAYGQTSSGKTYTMTGITEYAI+DIY++IQKH+ER
Sbjct  77   STRQVYEEAAKDVALSVLNGFNSSVFAYGQTSSGKTYTMTGITEYAIADIYEYIQKHSER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAMEIYNESVRDLLS+D T LRLLDDPERGT+V
Sbjct  137  DFMLKFSAMEIYNESVRDLLSADSTLLRLLDDPERGTIV  175



>gb|EPS64209.1| hypothetical protein M569_10571, partial [Genlisea aurea]
Length=466

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI RNDVSDW C++  T+V+RNV LSAS+RSMYP+VY FDRVF SDC
Sbjct  2    IFVSVRLRPLNVKEIYRNDVSDWECIDDNTVVFRNVCLSASDRSMYPTVYTFDRVFKSDC  61

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AKEVA+SV+ G NS+VFAYGQT+SGKTYTMTG+TE+A++DIYD+I+K+ +R
Sbjct  62   STREVYEKGAKEVAISVLQGINSTVFAYGQTNSGKTYTMTGVTEFALADIYDYIRKNPDR  121

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS D TPLRLLDDPERGT+V
Sbjct  122  EFVLKFSAMEIYNESVRDLLSMDTTPLRLLDDPERGTIV  160



>emb|CDP01925.1| unnamed protein product [Coffea canephora]
Length=959

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEIL+NDVSDW C+N TTI+Y+N +LSASERSMYP+ Y FDR F SDC
Sbjct  16   IFVSVRLRPLNEKEILKNDVSDWECINDTTIIYKNANLSASERSMYPTAYTFDRAFRSDC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEE A+EVALSVV G N+++FAYGQTSSGKT+TMTGITEY I DIYD+IQKH ER
Sbjct  76   TTRQVYEEGAREVALSVVGGINATLFAYGQTSSGKTFTMTGITEYTIGDIYDYIQKHRER  135

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNE VRDLLS+D TPLRLLDDPERGT+V
Sbjct  136  EFILKFSALEIYNECVRDLLSTDTTPLRLLDDPERGTIV  174



>ref|XP_009791027.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana sylvestris]
Length=1028

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE  RNDVSDW CVN TTI+Y+N+ LS SER +YPS Y FDRVF+SDC
Sbjct  18   IFVSVRLRPLNEKE-ERNDVSDWECVNDTTIIYKNISLSPSERLIYPSAYTFDRVFSSDC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEVALSVV G+NSS+FAYGQTSSGKTYTMTGITEYAI+DIY+++QKH ER
Sbjct  77   CTRQVYEEAAKEVALSVVKGYNSSIFAYGQTSSGKTYTMTGITEYAIADIYEYVQKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAME+YNESVRDLLS D TPLRLLDDPERGTVV
Sbjct  137  DFILKFSAMEMYNESVRDLLSEDSTPLRLLDDPERGTVV  175



>ref|XP_009597015.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana tomentosiformis]
Length=1007

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE  RNDVSDW CVN TTI+Y+NV LS SE  +YPS Y FDRVF+SDC
Sbjct  21   IFVSVRLRPLNEKE--RNDVSDWECVNDTTIIYKNVSLSPSEGLIYPSAYTFDRVFSSDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAKEVA+SVV GFNSS+FAYGQTSSGKTYTMTGITEYAI+DIY+++QKH ER
Sbjct  79   STRQVYEEAAKEVAISVVKGFNSSIFAYGQTSSGKTYTMTGITEYAIADIYEYVQKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAMEIYNESVRDLLS D  PLRLLDDPERGTVV
Sbjct  139  DFILKFSAMEIYNESVRDLLSEDSAPLRLLDDPERGTVV  177



>ref|XP_011090438.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=991

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEILRNDVSDW C+N  T+VY+NV LSAS+RSMYP+ Y FDRVF +DC
Sbjct  18   IHVSVRLRPLNAKEILRNDVSDWECINDDTVVYKNVSLSASDRSMYPTAYTFDRVFRTDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AK+VA+SV++G NSSVFAYGQTSSGKTYTMTG+TEYAI+DIY+++QKH ER
Sbjct  78   STREVYEKGAKDVAVSVLSGLNSSVFAYGQTSSGKTYTMTGVTEYAIADIYEYVQKHPER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS D TPLRLLDDPERGT+V
Sbjct  138  EFVLKFSAMEIYNESVRDLLSVDSTPLRLLDDPERGTIV  176



>gb|EYU31140.1| hypothetical protein MIMGU_mgv1a000697mg [Erythranthe guttata]
Length=1015

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEILRNDVSDW C+N  TI+Y+N  LSASERSMYP+ Y FDRVF S C
Sbjct  9    IYVSVRLRPLNGKEILRNDVSDWECINNETIIYKNSALSASERSMYPTSYTFDRVFRSGC  68

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AK+VA+SV++G NSSVFAYGQTSSGKTYTMTGITEYA++DIY +IQKH ER
Sbjct  69   STREVYEQGAKDVAISVISGINSSVFAYGQTSSGKTYTMTGITEYALADIYGYIQKHQER  128

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D+VLK SAMEIYNESVRDLLS D TPLRLLDDPERGT+V
Sbjct  129  DFVLKFSAMEIYNESVRDLLSVDNTPLRLLDDPERGTIV  167



>gb|KDO71124.1| hypothetical protein CISIN_1g001693mg [Citrus sinensis]
Length=1027

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI RNDVSDW C+N +TI+YRN +LS +ERSMYP+ Y FDRVF+ DC
Sbjct  22   IFVSVRLRPLNEKEIARNDVSDWECINDSTIIYRN-NLSVAERSMYPTSYTFDRVFSCDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TRKVYEE AKEVAL+VV+G NSSVFAYGQTSSGKTYTM GITEY +SDIYD+I+KH ER
Sbjct  81   TTRKVYEEGAKEVALAVVSGINSSVFAYGQTSSGKTYTMIGITEYTMSDIYDYIEKHKER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D +PLRLLDDPERGT+V
Sbjct  141  EFVLKFSAMEIYNESVRDLLSADTSPLRLLDDPERGTIV  179



>ref|XP_006425531.1| hypothetical protein CICLE_v10024791mg [Citrus clementina]
 gb|ESR38771.1| hypothetical protein CICLE_v10024791mg [Citrus clementina]
Length=1028

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI RNDVSDW C+N +TI+YRN +LS +ERSMYP+ Y FDRVF+ DC
Sbjct  22   IFVSVRLRPLNEKEIARNDVSDWECINDSTIIYRN-NLSVAERSMYPTSYTFDRVFSCDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TRKVYEE AKEVAL+VV+G NSSVFAYGQTSSGKTYTM GITEY +SDIYD+I+KH ER
Sbjct  81   TTRKVYEEGAKEVALAVVSGINSSVFAYGQTSSGKTYTMIGITEYTMSDIYDYIEKHKER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D +PLRLLDDPERGT+V
Sbjct  141  EFVLKFSAMEIYNESVRDLLSADTSPLRLLDDPERGTIV  179



>ref|XP_006466914.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466915.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1028

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI RNDVSDW C+N +TI+YRN +LS +ERSMYP+ Y FDRVF+ DC
Sbjct  22   IFVSVRLRPLNEKEIARNDVSDWECINDSTIIYRN-NLSVAERSMYPTSYTFDRVFSCDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TRKVYEE AKEVAL+VV+G NSSVFAYGQTSSGKTYTM GITEY +SDIYD+I+KH ER
Sbjct  81   TTRKVYEEGAKEVALAVVSGINSSVFAYGQTSSGKTYTMIGITEYTMSDIYDYIEKHKER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D +PLRLLDDPERGT+V
Sbjct  141  EFVLKFSAMEIYNESVRDLLSADTSPLRLLDDPERGTIV  179



>gb|KDP46700.1| hypothetical protein JCGZ_06488 [Jatropha curcas]
Length=1012

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  RNDVSDW C+N+ TI+YRN +LS SERSMYP+ Y FDRVF  DC
Sbjct  16   ILVSVRLRPLNEKETARNDVSDWECINENTIIYRN-NLSVSERSMYPTAYTFDRVFRPDC  74

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVAL+VV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD+  KH ER
Sbjct  75   STRQVYEEGAKEVALAVVSGINSSIFAYGQTSSGKTYTMSGITEYTVADIYDYANKHKER  134

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS D TPLRLLDDPERGTVV
Sbjct  135  EFILKFSAMEIYNESVRDLLSVDTTPLRLLDDPERGTVV  173



>ref|XP_009378198.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL  KE  RNDVSDW C+N TTI+YRN +LS SERSMYP+ Y FDRVF +DC
Sbjct  20   ILVSVRLRPLVEKETARNDVSDWECINDTTIIYRN-NLSVSERSMYPTAYSFDRVFGTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK VA+SVV+G NSS+FAYGQTSSGKTYTM+GIT+YA++DIYD+I+KHTER
Sbjct  79   STRRVYEEGAKRVAISVVSGINSSIFAYGQTSSGKTYTMSGITDYAVADIYDYIEKHTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESV+DLLS+D TPLRLLDDPERGT+V
Sbjct  139  EFNLKFSAMEIYNESVKDLLSADTTPLRLLDDPERGTIV  177



>gb|KEH20389.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=954

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE+ +ND+S+W C+N TTI+YR+ +LSASERS+YP+ Y FDRVF +DC
Sbjct  20   ILVSVRVRPLNEKELWKNDLSEWECINDTTIMYRS-NLSASERSLYPTTYSFDRVFRTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEVALSV+NG NSS+FAYGQTSSGKTYTM+GITEYA++DI+++I+KH ER
Sbjct  79   PTRQVYEEAAKEVALSVLNGINSSIFAYGQTSSGKTYTMSGITEYAVADIFNYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  139  EFVLKFSAMEIYNESVRDLLSNDTTPLRLLDDPEKGTVV  177



>ref|XP_009378197.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score =   263 bits (671),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL  KE  RNDVSDW C+N TTI+YRN +LS SERSMYP+ Y FDRVF +DC
Sbjct  20   ILVSVRLRPLVEKETARNDVSDWECINDTTIIYRN-NLSVSERSMYPTAYSFDRVFGTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK VA+SVV+G NSS+FAYGQTSSGKTYTM+GIT+YA++DIYD+I+KHTER
Sbjct  79   STRRVYEEGAKRVAISVVSGINSSIFAYGQTSSGKTYTMSGITDYAVADIYDYIEKHTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESV+DLLS+D TPLRLLDDPERGT+V
Sbjct  139  EFNLKFSAMEIYNESVKDLLSADTTPLRLLDDPERGTIV  177



>ref|XP_008372766.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
 ref|XP_008372767.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=963

 Score =   262 bits (669),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL  KE  RNDVSDW C+N  TI+YRN +LS SERSMYP+ Y FDRVF +DC
Sbjct  20   ILVSVRLRPLVEKETARNDVSDWECINDATIIYRN-NLSVSERSMYPTAYSFDRVFATDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK VA+SVV+G NSS+FAYGQTSSGKTYTM+GIT+YA++DIYD+I+KHTER
Sbjct  79   STRRVYEEGAKRVAISVVSGINSSIFAYGQTSSGKTYTMSGITDYAVADIYDYIEKHTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLLS+D TPLRLLDDPERGT+V
Sbjct  139  EFNLKFSAMEIYNESVRDLLSADTTPLRLLDDPERGTIV  177



>ref|XP_004289095.1| PREDICTED: kinesin-like protein NACK2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011462410.1| PREDICTED: kinesin-like protein NACK2 [Fragaria vesca subsp. 
vesca]
Length=1040

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL+ KE  RNDVSDW C+N  TI+YRN +LS SERSMYP+ Y FDRVF++DC
Sbjct  19   ILVSVRLRPLSEKETARNDVSDWECINDNTIIYRN-NLSISERSMYPTAYTFDRVFSNDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AK+VALSV +G NSS+FAYGQTSSGKTYTM+GITEYA++DIYD+I KH ER
Sbjct  78   STRRVYEDGAKKVALSVASGINSSIFAYGQTSSGKTYTMSGITEYAVADIYDYIDKHQER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SA+EIYNESVRDLLS+D TPLRLLDDPERGT+V
Sbjct  138  EFVLKFSALEIYNESVRDLLSADTTPLRLLDDPERGTIV  176



>ref|XP_009338641.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL  KE  RNDVSDW C+N +TI+YRN +LS SERSMYP+ Y FDRVF +DC
Sbjct  20   ILVSVRLRPLVEKETARNDVSDWECINDSTIIYRN-NLSVSERSMYPTAYSFDRVFGTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK VA+SVV+G NSS+FAYGQTSSGKTYTM+GIT+YA++DIYD+I+KHTER
Sbjct  79   STRRVYEEGAKRVAISVVSGINSSIFAYGQTSSGKTYTMSGITDYAVADIYDYIEKHTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESV+DLLS+D TPLRLLDDPERGT+V
Sbjct  139  EFNLKFSAMEIYNESVKDLLSADTTPLRLLDDPERGTIV  177



>gb|AET03829.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1139

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE+ +ND+S+W C+N TTI+YR+ +LSASERS+YP+ Y FDRVF +DC
Sbjct  20   ILVSVRVRPLNEKELWKNDLSEWECINDTTIMYRS-NLSASERSLYPTTYSFDRVFRTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEVALSV+NG NSS+FAYGQTSSGKTYTM+GITEYA++DI+++I+KH ER
Sbjct  79   PTRQVYEEAAKEVALSVLNGINSSIFAYGQTSSGKTYTMSGITEYAVADIFNYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  139  EFVLKFSAMEIYNESVRDLLSNDTTPLRLLDDPEKGTVV  177



>gb|KEH20388.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1146

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE+ +ND+S+W C+N TTI+YR+ +LSASERS+YP+ Y FDRVF +DC
Sbjct  20   ILVSVRVRPLNEKELWKNDLSEWECINDTTIMYRS-NLSASERSLYPTTYSFDRVFRTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEVALSV+NG NSS+FAYGQTSSGKTYTM+GITEYA++DI+++I+KH ER
Sbjct  79   PTRQVYEEAAKEVALSVLNGINSSIFAYGQTSSGKTYTMSGITEYAVADIFNYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  139  EFVLKFSAMEIYNESVRDLLSNDTTPLRLLDDPEKGTVV  177



>ref|XP_009338640.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score =   261 bits (668),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL  KE  RNDVSDW C+N +TI+YRN +LS SERSMYP+ Y FDRVF +DC
Sbjct  20   ILVSVRLRPLVEKETARNDVSDWECINDSTIIYRN-NLSVSERSMYPTAYSFDRVFGTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK VA+SVV+G NSS+FAYGQTSSGKTYTM+GIT+YA++DIYD+I+KHTER
Sbjct  79   STRRVYEEGAKRVAISVVSGINSSIFAYGQTSSGKTYTMSGITDYAVADIYDYIEKHTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESV+DLLS+D TPLRLLDDPERGT+V
Sbjct  139  EFNLKFSAMEIYNESVKDLLSADTTPLRLLDDPERGTIV  177



>ref|XP_011025920.1| PREDICTED: kinesin-like protein NACK2 [Populus euphratica]
Length=998

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KEI +NDVSDW C+N  T++YRN  LS SERSMYP+ Y FDRVF   C
Sbjct  25   ILVSVRLRPLNEKEIAKNDVSDWECINDDTVIYRN-SLSVSERSMYPTAYKFDRVFGPGC  83

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY E AKEVALSVV+G NSSVFAYGQTSSGKTYTM+GITEY ++DIYD+++KH ER
Sbjct  84   STRQVYGEGAKEVALSVVSGINSSVFAYGQTSSGKTYTMSGITEYTVADIYDYVEKHKER  143

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLLS+D TPLRLLDDPERGTVV
Sbjct  144  EFTLKFSAMEIYNESVRDLLSTDTTPLRLLDDPERGTVV  182



>ref|XP_007203241.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
 gb|EMJ04440.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
Length=896

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KE  RNDVSDW C+N +T++YRN +LS SERSMYP+ Y FDRVF +DC
Sbjct  20   IFVSVRLRPLSEKETARNDVSDWECINDSTVIYRN-NLSVSERSMYPTAYTFDRVFGTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST +VYEE AK+VALSVV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD+I+KH ER
Sbjct  79   STMRVYEEGAKKVALSVVSGINSSIFAYGQTSSGKTYTMSGITEYTVTDIYDYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLLS+D TPLRLLDDPERGT+V
Sbjct  139  EFHLKFSAMEIYNESVRDLLSADTTPLRLLDDPERGTIV  177



>ref|XP_004512117.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
Length=948

 Score =   259 bits (663),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KEI RNDVSDW C+N TTI+YRN ++SASERS+YP+ Y FDRVF SDC
Sbjct  21   ILVSVRLRPLNDKEISRNDVSDWECINDTTIIYRN-NISASERSLYPTAYSFDRVFRSDC  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+EAAK+VALSVV+G NSS+FAYGQTSSGKTYTM+GITE  ++DI+++I KH ER
Sbjct  80   STREVYDEAAKDVALSVVSGINSSIFAYGQTSSGKTYTMSGITECTVADIFNYIDKHKER  139

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS D TPLRLLDDPERGTVV
Sbjct  140  EFILKFSAIEIYNESVRDLLSPDCTPLRLLDDPERGTVV  178



>ref|XP_004512118.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
Length=937

 Score =   259 bits (662),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KEI RNDVSDW C+N TTI+YRN ++SASERS+YP+ Y FDRVF SDC
Sbjct  10   ILVSVRLRPLNDKEISRNDVSDWECINDTTIIYRN-NISASERSLYPTAYSFDRVFRSDC  68

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+EAAK+VALSVV+G NSS+FAYGQTSSGKTYTM+GITE  ++DI+++I KH ER
Sbjct  69   STREVYDEAAKDVALSVVSGINSSIFAYGQTSSGKTYTMSGITECTVADIFNYIDKHKER  128

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS D TPLRLLDDPERGTVV
Sbjct  129  EFILKFSAIEIYNESVRDLLSPDCTPLRLLDDPERGTVV  167



>ref|XP_007046742.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
 gb|EOX90899.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
Length=982

 Score =   259 bits (662),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN +EI R DVSDW C++  TI+YRN  LS SERSMYP+ Y FDRVF+SDC
Sbjct  20   IFVSVRLRPLNEREIARRDVSDWECISDNTIIYRN-SLSVSERSMYPTAYTFDRVFSSDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
              R+VYE  AKEVALSVV+G NSSVFAYGQTSSGKTYTM GITEYA++DIYD+IQ+H ER
Sbjct  79   PNRQVYEAGAKEVALSVVSGINSSVFAYGQTSSGKTYTMIGITEYAMADIYDYIQRHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRLLDDPERGTVV
Sbjct  139  EFILKFSAMEIYNESVRDLLSADSTPLRLLDDPERGTVV  177



>ref|XP_002531511.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30865.1| conserved hypothetical protein [Ricinus communis]
Length=959

 Score =   259 bits (662),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  RNDVSDW C+N  T++YRN +LS SERSMYP+ Y FDRVF  DC
Sbjct  16   ILVSVRLRPLNEKETARNDVSDWECINDNTVIYRN-NLSVSERSMYPTAYAFDRVFRPDC  74

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +T +VYEE AKEVALSVV+G NSSVFAYGQTSSGKTYTM+GITEY ++DIYD++ KH ER
Sbjct  75   TTGQVYEEGAKEVALSVVSGINSSVFAYGQTSSGKTYTMSGITEYTVADIYDYMDKHKER  134

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLL  D TPLRLLDDPERGTVV
Sbjct  135  EFVLKFSAMEIYNESVRDLLIMDTTPLRLLDDPERGTVV  173



>ref|XP_008241798.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=960

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KE  RNDVSDW C+N +T++YRN +LS SERSMYP+ Y FDRVF +DC
Sbjct  20   IFVSVRLRPLSEKETARNDVSDWECINDSTVIYRN-NLSVSERSMYPTAYTFDRVFGTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST +VYEE AK+VALSVV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD+I+KH ER
Sbjct  79   STTRVYEEGAKKVALSVVSGINSSIFAYGQTSSGKTYTMSGITEYTVTDIYDYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLLS+D TPLRLLDDPERGT+V
Sbjct  139  EFQLKFSAMEIYNESVRDLLSADTTPLRLLDDPERGTIV  177



>ref|XP_006380794.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380795.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380796.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58591.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58592.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58593.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
Length=998

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KEI +NDVSDW C+N  T++YRN  LS SERSMYP+ Y FDRVF   C
Sbjct  25   ILVSVRLRPLNEKEIGKNDVSDWECINDDTVIYRN-SLSVSERSMYPTAYKFDRVFGPGC  83

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY E AKEVALSVV+G NSSVFAYGQTSSGKTYTM+GITEY ++DIYD++ KH ER
Sbjct  84   STRQVYGEGAKEVALSVVSGINSSVFAYGQTSSGKTYTMSGITEYTVADIYDYVDKHKER  143

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLLS+D TPLRLLDDPERGTVV
Sbjct  144  EFTLKFSAMEIYNESVRDLLSTDTTPLRLLDDPERGTVV  182



>gb|AAK50070.1|AF372930_1 AT5g66310/K1L20_9 [Arabidopsis thaliana]
Length=425

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE  RNDV DW C+N TTI+YR+  LS SERSMYPS Y FDRVF+ +C
Sbjct  19   IYVSVRMRPLNDKEKFRNDVPDWECINNTTIIYRS-HLSISERSMYPSAYTFDRVFSPEC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVA SVV+G N+SVFAYGQTSSGKTYTM+GIT+ A+ DIY +I KH ER
Sbjct  78   CTRQVYEQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITDCALVDIYGYIDKHKER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  138  EFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVV  176



>gb|KCW53110.1| hypothetical protein EUGRSUZ_J02401 [Eucalyptus grandis]
Length=849

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V VRLRPLN KEI RNDVSDW C++  T++YRN +LS SERSMYP+ Y FDRVF  DC
Sbjct  20   IFVLVRLRPLNQKEISRNDVSDWECIDDNTVIYRN-NLSVSERSMYPAAYTFDRVFRCDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK+VALSVV+G N+SVFAYGQTSSGKTYTM+GITEY+++DIY +I+KH ER
Sbjct  79   STRQVYEEGAKKVALSVVSGINASVFAYGQTSSGKTYTMSGITEYSMADIYSYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPERGT+V
Sbjct  139  EFLLKFSAMEIYNESVRDLLSADSSPLRLLDDPERGTIV  177



>ref|XP_007157943.1| hypothetical protein PHAVU_002G111200g [Phaseolus vulgaris]
 gb|ESW29937.1| hypothetical protein PHAVU_002G111200g [Phaseolus vulgaris]
Length=963

 Score =   257 bits (656),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE+ RND+SDW C+N TTI+YR+ +LSAS+RS+YP+ Y FD VF SDC
Sbjct  20   ILVSVRLRPLNEKELARNDLSDWECINDTTIIYRS-NLSASDRSLYPTAYSFDNVFRSDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+AAKEVALSVV G NSS+FAYGQTSSGKTYTMTG+TEY ++DI+ +I+ H ER
Sbjct  79   STRQVYEKAAKEVALSVVGGINSSIFAYGQTSSGKTYTMTGVTEYTVADIFKYIENHAER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS D TPLRLLDDPERGTVV
Sbjct  139  EFILKFSAIEIYNESVRDLLSPDCTPLRLLDDPERGTVV  177



>gb|KJB48330.1| hypothetical protein B456_008G063800 [Gossypium raimondii]
 gb|KJB48331.1| hypothetical protein B456_008G063800 [Gossypium raimondii]
Length=978

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN+KEI R+DVSDW C+N  TI+YRN  LS SERSMYP+ Y FDRVF+ DC
Sbjct  20   IFVSVRLRPLNYKEIARHDVSDWECINDNTIIYRN-SLSVSERSMYPTAYTFDRVFSPDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
              ++VYE  AK VA+SVV+G NSSVFAYGQTSSGKTYTM GITEYA++DIYD+IQ+H ER
Sbjct  79   PNQQVYEAGAKAVAISVVSGINSSVFAYGQTSSGKTYTMIGITEYAMTDIYDYIQRHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRLLDDPERGTVV
Sbjct  139  EFILKFSAMEIYNESVRDLLSADSTPLRLLDDPERGTVV  177



>ref|XP_010113382.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC35389.1| Kinesin-related protein 4 [Morus notabilis]
Length=1016

 Score =   257 bits (656),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VS+RLRPLN KE  RNDVSDW C+N  TI+YRN +LS SERSMYP+ Y FDRVF+ DC
Sbjct  20   IFVSIRLRPLNEKEASRNDVSDWECINDDTIIYRN-NLSVSERSMYPTGYTFDRVFSFDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY+E AK+VALSVV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD++ KH ER
Sbjct  79   PTRQVYKEGAKDVALSVVSGINSSIFAYGQTSSGKTYTMSGITEYTVADIYDYVNKHNER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++V+K SAMEIYNESVRDLLS+D TPLRLLDDPERGTVV
Sbjct  139  EFVMKFSAMEIYNESVRDLLSADSTPLRLLDDPERGTVV  177



>ref|XP_006383133.1| kinesin motor family protein [Populus trichocarpa]
 gb|ERP60930.1| kinesin motor family protein [Populus trichocarpa]
Length=910

 Score =   256 bits (653),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI RNDVSDW  +N  T++YRN +L  SERSMYP+ Y FDRVF SDC
Sbjct  12   IFVSVRLRPLNAKEIARNDVSDWESINYDTVIYRN-NLPVSERSMYPTAYTFDRVFGSDC  70

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST+ VY E AKEVALSVV+G NSSVFAYGQTSSGKTYTM+GITEY I+DIYD+++KH ER
Sbjct  71   STKHVYGEGAKEVALSVVSGINSSVFAYGQTSSGKTYTMSGITEYTIADIYDYVEKHKER  130

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLL +D TPLRLLDDPERGTVV
Sbjct  131  EFTLKFSAMEIYNESVRDLLGADATPLRLLDDPERGTVV  169



>ref|XP_010033468.1| PREDICTED: kinesin-like protein NACK1 [Eucalyptus grandis]
 gb|KCW53109.1| hypothetical protein EUGRSUZ_J02401 [Eucalyptus grandis]
Length=952

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V VRLRPLN KEI RNDVSDW C++  T++YRN +LS SERSMYP+ Y FDRVF  DC
Sbjct  20   IFVLVRLRPLNQKEISRNDVSDWECIDDNTVIYRN-NLSVSERSMYPAAYTFDRVFRCDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK+VALSVV+G N+SVFAYGQTSSGKTYTM+GITEY+++DIY +I+KH ER
Sbjct  79   STRQVYEEGAKKVALSVVSGINASVFAYGQTSSGKTYTMSGITEYSMADIYSYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPERGT+V
Sbjct  139  EFLLKFSAMEIYNESVRDLLSADSSPLRLLDDPERGTIV  177



>gb|KHN41676.1| Kinesin-related protein 4 [Glycine soja]
Length=935

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE++RND+S+W C+N TTI+YR+ +LSA+ERS+YP+ Y FDRVF +D 
Sbjct  20   ILVSVRVRPLNEKELIRNDLSEWECINDTTIMYRS-NLSATERSLYPTAYTFDRVFRTDS  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VYEEAAKEVALSV++G NSS+FAYGQTSSGKTYTM+GIT++AI+DI+D+I+KHTER
Sbjct  79   PTKQVYEEAAKEVALSVLSGINSSIFAYGQTSSGKTYTMSGITDFAIADIFDYIEKHTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SA+EIYNESVRDLLS D TPLRLLDDPE+GTVV
Sbjct  139  EFVLKFSALEIYNESVRDLLSVDSTPLRLLDDPEKGTVV  177



>gb|KHF98716.1| Kinesin-related 11 [Gossypium arboreum]
Length=978

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN+KEI R+DVSDW C+N  TI+YRN  LS SERSMYP+ Y FDRVF+ DC
Sbjct  20   IFVSVRLRPLNYKEIARHDVSDWECINDNTIIYRN-SLSVSERSMYPTAYTFDRVFSPDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
              ++VYE  AK VA+SVV+G NSSVFAYGQTSSGKTYTM GITEYA++DIYD++Q+H ER
Sbjct  79   PNQQVYEAGAKAVAISVVSGINSSVFAYGQTSSGKTYTMIGITEYAMTDIYDYVQRHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRLLDDPERGTVV
Sbjct  139  EFILKFSAMEIYNESVRDLLSADSTPLRLLDDPERGTVV  177



>gb|AES95091.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=956

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KEI RNDVSDW C+N TTI+YRN ++SASERS+YP+ Y FDRVF SDC
Sbjct  21   IQVSVRIRPLNDKEIARNDVSDWECINDTTIIYRN-NISASERSLYPTAYSFDRVFRSDC  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+EAAKEVALSVV+G NSS+FAYGQTSSGKTYTM+GIT+  ++DI++++ KH ER
Sbjct  80   STRQVYQEAAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITDCTVADIFNYMGKHMER  139

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS+D TPLRLLDDPERGTVV
Sbjct  140  EFILKFSAIEIYNESVRDLLSADYTPLRLLDDPERGTVV  178



>ref|XP_003538873.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006590716.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
 gb|KHN41913.1| Kinesin-related protein 4 [Glycine soja]
Length=953

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE+ RNDVSDW C+N TTI+YR+ +LSA++RS+YP+ Y FD VF +D 
Sbjct  20   ILVSVRLRPLNEKELARNDVSDWECINDTTIIYRS-NLSATDRSLYPTAYSFDSVFRTDS  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+AAKEVALSVV G NSS+FAYGQTSSGKTYTM+GITEY ++DI+++I+KHTER
Sbjct  79   STRQVYEKAAKEVALSVVGGINSSIFAYGQTSSGKTYTMSGITEYTVADIFNYIEKHTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS D TPLRLLDDPERGTVV
Sbjct  139  EFMLKFSAIEIYNESVRDLLSPDCTPLRLLDDPERGTVV  177



>ref|XP_010317234.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Solanum lycopersicum]
Length=964

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 137/159 (86%), Gaps = 6/159 (4%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VS RLR LN KE  RNDV+DW CVN TTI+Y NV+ S     M+PSVY FDRVF+SDC
Sbjct  8    IYVSARLRTLNEKE--RNDVADWECVNDTTIIYNNVNSSP----MFPSVYTFDRVFSSDC  61

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAKEVALSVV GFNSSV AYGQTSSGKTYTMTGITEYAI+DIY+++ KHTER
Sbjct  62   STRQVYEEAAKEVALSVVKGFNSSVLAYGQTSSGKTYTMTGITEYAIADIYEYVHKHTER  121

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D+VLK SAMEIYNESVRDLLS D TPLRLLDDPERGTV+
Sbjct  122  DFVLKFSAMEIYNESVRDLLSEDNTPLRLLDDPERGTVI  160



>ref|XP_006599340.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006599341.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
 ref|XP_006599342.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Glycine 
max]
 ref|XP_006599343.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Glycine 
max]
Length=935

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE++RND+S+W C+N TTI+YR+ +LSA+ERS+YP+ Y FDRVF +D 
Sbjct  20   ILVSVRVRPLNEKELIRNDLSEWECINDTTIMYRS-NLSATERSLYPTAYTFDRVFRTDS  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VYEEAAKEVALSV++G NSS+FAYGQTSSGKTYTM+GIT++AI+DI+++I+KHTER
Sbjct  79   PTKQVYEEAAKEVALSVLSGINSSIFAYGQTSSGKTYTMSGITDFAIADIFNYIEKHTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SA+EIYNESVRDLLS D TPLRLLDDPE+GTVV
Sbjct  139  EFVLKFSALEIYNESVRDLLSVDSTPLRLLDDPEKGTVV  177



>ref|XP_007156119.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 ref|XP_007156120.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 gb|ESW28113.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 gb|ESW28114.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
Length=961

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RP+N KE+ RND+S+W C+N  TI+YR+ +LSA+ERS+YP+ Y FDRVF+SD 
Sbjct  20   ILVSVRVRPVNEKELARNDLSEWECINDATIMYRS-NLSATERSLYPTTYTFDRVFSSDA  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEVALSV+ G NSS+FAYGQTSSGKT+TM+G+TEYA++DI+++IQKH ER
Sbjct  79   HTRQVYEEAAKEVALSVLRGINSSIFAYGQTSSGKTHTMSGVTEYALADIFNYIQKHAER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D+VLK SA+EIYNESVRDLLS D TPLRLLDDPE+GTVV
Sbjct  139  DFVLKFSALEIYNESVRDLLSVDSTPLRLLDDPEKGTVV  177



>ref|XP_008452056.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Cucumis melo]
Length=891

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KEI RNDVS+W C+N  T++ RN  LS +ERS YPS Y FDRVF  DC
Sbjct  20   ILVSVRVRPLNEKEISRNDVSEWECINDNTVICRNA-LSVAERS-YPSAYTFDRVFGCDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STRKVYEE AKEVALSVV+G NS++FAYGQTSSGKTYTMTGITEY I DIYD+I+KHTER
Sbjct  78   STRKVYEEGAKEVALSVVSGVNSTIFAYGQTSSGKTYTMTGITEYTIEDIYDYIEKHTER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SA+EIYNESVRDLLS D +PLRLLDDPERGT V
Sbjct  138  EFFLKFSAIEIYNESVRDLLSVDSSPLRLLDDPERGTTV  176



>ref|XP_003516550.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Glycine 
max]
 ref|XP_006573564.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Glycine 
max]
Length=966

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE+ RNDVSDW C+N T I+YR+ +LSAS+RS+YP+ Y FD VF ++ 
Sbjct  20   ILVSVRLRPLNEKELARNDVSDWECINDTAIIYRS-NLSASDRSLYPTAYSFDSVFRTNS  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+AAKEVALSVV G NSS+FAYGQTSSGKTYTM+GITEY +SDI+++I+KH ER
Sbjct  79   STRQVYEKAAKEVALSVVGGINSSIFAYGQTSSGKTYTMSGITEYTVSDIFNYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS D TPLRLLDDPERGTVV
Sbjct  139  EFMLKFSAIEIYNESVRDLLSPDCTPLRLLDDPERGTVV  177



>ref|XP_003519876.1| PREDICTED: kinesin-like protein NACK1-like [Glycine max]
Length=949

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE+ RND+S+W C+N TTI+YRN +LSA+ERS+YP+ Y FDRVF +D 
Sbjct  20   ILVSVRVRPLNEKELTRNDLSEWECINDTTIMYRN-NLSATERSLYPTAYTFDRVFRNDS  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VYEEAAKEVALSV++G NSS+FAYGQTSSGKTYTM+GIT++AI+DI+++I+K TER
Sbjct  79   PTKQVYEEAAKEVALSVLSGINSSIFAYGQTSSGKTYTMSGITDFAIADIFNYIEKRTER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SA+EIYNESVRDLLS D TPLRLLDDPE+GTVV
Sbjct  139  EFVLKFSALEIYNESVRDLLSVDSTPLRLLDDPEKGTVV  177



>gb|KJB43376.1| hypothetical protein B456_007G196800 [Gossypium raimondii]
Length=918

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI+R+DVSDW C+N  TI+YR+  LS SERSMYP+ Y FD VF SDC
Sbjct  21   IFVSVRLRPLSEKEIVRHDVSDWECINDNTIIYRS-KLSVSERSMYPTAYKFDNVFGSDC  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
              R+VYE  AKEV LSVV+G NSSVFAYGQTSSGKTYTMTGITEYA++DIYD+IQ+H ER
Sbjct  80   PNRQVYETGAKEVVLSVVSGINSSVFAYGQTSSGKTYTMTGITEYAMADIYDYIQRHKER  139

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS+D +PLRLLDDPERG VV
Sbjct  140  EFILKFSAIEIYNESVRDLLSADSSPLRLLDDPERGIVV  178



>ref|XP_006854867.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
 gb|ERN16334.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
Length=969

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVS+RLRPLN KEI RND +DW C+N TTI++RN   S  ERSM P  Y FDRVF SDC
Sbjct  24   ILVSIRLRPLNAKEIARNDTTDWECINDTTIIFRN---SVPERSMAPVAYTFDRVFRSDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+AAK+VALS V+G NS++FAYGQTSSGKTYTM GITEY +SDIYD+IQ+H ER
Sbjct  81   STRQVYEDAAKQVALSAVSGINSTIFAYGQTSSGKTYTMIGITEYTVSDIYDYIQRHEER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE+VRDLLS D TPLRLLDDPERGT+V
Sbjct  141  AFVLKFSAIEIYNEAVRDLLSPDSTPLRLLDDPERGTIV  179



>ref|XP_008452051.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452052.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452053.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452054.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452055.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
Length=993

 Score =   251 bits (642),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KEI RNDVS+W C+N  T++ RN  LS +ERS YPS Y FDRVF  DC
Sbjct  20   ILVSVRVRPLNEKEISRNDVSEWECINDNTVICRNA-LSVAERS-YPSAYTFDRVFGCDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STRKVYEE AKEVALSVV+G NS++FAYGQTSSGKTYTMTGITEY I DIYD+I+KHTER
Sbjct  78   STRKVYEEGAKEVALSVVSGVNSTIFAYGQTSSGKTYTMTGITEYTIEDIYDYIEKHTER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SA+EIYNESVRDLLS D +PLRLLDDPERGT V
Sbjct  138  EFFLKFSAIEIYNESVRDLLSVDSSPLRLLDDPERGTTV  176



>ref|XP_010649060.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649061.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649062.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649063.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649064.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649065.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649066.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649067.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649068.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649069.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CBI17403.3| unnamed protein product [Vitis vinifera]
Length=973

 Score =   251 bits (641),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ++VSVRLRPLN KEI RND  DW C+N TTI+++N  L   ERSMYPS Y FDRVF SD 
Sbjct  20   VVVSVRLRPLNEKEISRNDALDWECINDTTIIFKN-HLPIPERSMYPSAYTFDRVFRSDS  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYE  AKEVALSVV+G NSS+FAYGQTSSGKT+TM+GITEY ++DIYDHI++H ER
Sbjct  79   TTREVYEAGAKEVALSVVSGINSSIFAYGQTSSGKTFTMSGITEYTMADIYDHIERHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLSSD  PLRLLDDPERGT+V
Sbjct  139  EFLLKFSAMEIYNESVRDLLSSDTAPLRLLDDPERGTIV  177



>gb|KJB43375.1| hypothetical protein B456_007G196800 [Gossypium raimondii]
Length=956

 Score =   251 bits (640),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI+R+DVSDW C+N  TI+YR+  LS SERSMYP+ Y FD VF SDC
Sbjct  21   IFVSVRLRPLSEKEIVRHDVSDWECINDNTIIYRS-KLSVSERSMYPTAYKFDNVFGSDC  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
              R+VYE  AKEV LSVV+G NSSVFAYGQTSSGKTYTMTGITEYA++DIYD+IQ+H ER
Sbjct  80   PNRQVYETGAKEVVLSVVSGINSSVFAYGQTSSGKTYTMTGITEYAMADIYDYIQRHKER  139

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS+D +PLRLLDDPERG VV
Sbjct  140  EFILKFSAIEIYNESVRDLLSADSSPLRLLDDPERGIVV  178



>gb|KHN36049.1| Kinesin-related protein 4 [Glycine soja]
Length=928

 Score =   250 bits (639),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE+ RNDVSDW C+N T I+YR+ +LSAS+RS+YP+ Y FD VF ++ 
Sbjct  20   ILVSVRLRPLNEKELARNDVSDWECINDTAIIYRS-NLSASDRSLYPTAYSFDSVFRTNS  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+AAKEVALSVV G NSS+FAYGQTSSGKTYTM+GITEY ++DI+++I+KH ER
Sbjct  79   STRQVYEKAAKEVALSVVGGINSSIFAYGQTSSGKTYTMSGITEYTVADIFNYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNESVRDLLS D TPLRLLDDPERGTVV
Sbjct  139  EFMLKFSAIEIYNESVRDLLSPDCTPLRLLDDPERGTVV  177



>ref|XP_010647602.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647606.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647611.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647615.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647617.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647621.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CAN75924.1| hypothetical protein VITISV_029516 [Vitis vinifera]
 emb|CBI37987.3| unnamed protein product [Vitis vinifera]
Length=969

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI RN+VSDW C+N+ T+++RN   S  ERSM+P+ Y FD+VF  DC
Sbjct  25   ILVLVRLRPLSEKEIARNEVSDWECINENTVLFRN---SLQERSMFPTAYSFDKVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEEAAKE+ALSVVNG NSS+FAYGQTSSGKTYTM GITEY ++DIYD+IQ H ER
Sbjct  82   TTRQVYEEAAKEIALSVVNGINSSIFAYGQTSSGKTYTMIGITEYTVADIYDYIQNHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE+VRDLLS+D  PLRLLDDPERGT+V
Sbjct  142  AFVLKFSAMEIYNEAVRDLLSTDNLPLRLLDDPERGTIV  180



>ref|XP_002876073.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52332.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=1008

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE  RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLNVKERARNDVADWECINDETVIYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I+KH ER
Sbjct  77   STREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIEKHNER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D++PLRLLDDPE+GTVV
Sbjct  137  EFILKFSAMEIYNESVRDLLSTDISPLRLLDDPEKGTVV  175



>gb|KGN53326.1| hypothetical protein Csa_4G047870 [Cucumis sativus]
Length=993

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KEI RNDVS+W C+N  T++ RN  LS +ERS YPS Y FDRVF  DC
Sbjct  20   ILVSVRVRPLNEKEISRNDVSEWECINDNTVICRNA-LSVAERS-YPSAYTFDRVFGCDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STRKVYEE AKEVALSVV+G NS++FAYGQTSSGKTYTM+GITEY I DIYD+I+KHTER
Sbjct  78   STRKVYEEGAKEVALSVVSGVNSTIFAYGQTSSGKTYTMSGITEYTIEDIYDYIKKHTER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SA+EIYNESVRDLLS D +PLRLLDDPERGT V
Sbjct  138  EFFLKFSAIEIYNESVRDLLSVDSSPLRLLDDPERGTTV  176



>ref|XP_004160983.1| PREDICTED: uncharacterized LOC101218717 [Cucumis sativus]
Length=992

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 2/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KEI RNDVS+W C+N  T++ RN  LS +ERS YPS Y FDRVF  DC
Sbjct  20   ILVSVRVRPLNEKEISRNDVSEWECINDNTVICRNA-LSVAERS-YPSAYTFDRVFGCDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STRKVYEE AKEVALSVV+G NS++FAYGQTSSGKTYTM+GITEY I DIYD+I+KHTER
Sbjct  78   STRKVYEEGAKEVALSVVSGVNSTIFAYGQTSSGKTYTMSGITEYTIEDIYDYIKKHTER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SA+EIYNESVRDLLS D +PLRLLDDPERGT V
Sbjct  138  EFFLKFSAIEIYNESVRDLLSVDSSPLRLLDDPERGTTV  176



>ref|XP_004509341.1| PREDICTED: kinesin-related protein 4-like isoform X4 [Cicer arietinum]
Length=960

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 143/159 (90%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVR+RPLN KE+ +ND+S+W C++ TTI+YR+ +LSASERS+YP+ Y FDRVF +DC
Sbjct  20   IVVSVRVRPLNDKELAKNDLSEWECIDDTTIMYRS-NLSASERSLYPTTYTFDRVFRADC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE AAKEVAL V++G NSS+FAYGQTSSGKTYTM+GIT YA++DI+++I+KH ER
Sbjct  79   PTRQVYEAAAKEVALCVLDGINSSIFAYGQTSSGKTYTMSGITGYAVADIFNYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  139  EFVLKFSAMEIYNESVRDLLSTDSTPLRLLDDPEKGTVV  177



>ref|XP_003612133.1| Kinesin-related protein [Medicago truncatula]
Length=963

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 143/166 (86%), Gaps = 8/166 (5%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KEI RNDVSDW C+N TTI+YRN ++SASERS+YP+ Y FDRVF SDC
Sbjct  21   IQVSVRIRPLNDKEIARNDVSDWECINDTTIIYRN-NISASERSLYPTAYSFDRVFRSDC  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQK----  486
            STR+VY+EAAKEVALSVV+G NSS+FAYGQTSSGKTYTM+GIT+  ++DI++++ K    
Sbjct  80   STRQVYQEAAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITDCTVADIFNYMGKVNEK  139

Query  487  ---HTERDYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
               H ER+++LK SA+EIYNESVRDLLS+D TPLRLLDDPERGTVV
Sbjct  140  HMRHMEREFILKFSAIEIYNESVRDLLSADYTPLRLLDDPERGTVV  185



>ref|XP_010426656.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426657.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426658.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426659.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1040

 Score =   249 bits (636),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KE +RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLSVKERVRNDVADWECINDETVLYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVALSVVNG ++SVFAYGQTSSGKTYTMTGIT+YA++DIYD+I+KH ER
Sbjct  77   CTREVYDQGAKEVALSVVNGVHASVFAYGQTSSGKTYTMTGITDYALADIYDYIEKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             ++LK SAMEIYNESVRDLLS+D++PLRLLDDPE+GTVV
Sbjct  137  AFILKFSAMEIYNESVRDLLSTDISPLRLLDDPEKGTVV  175



>ref|XP_010271468.1| PREDICTED: kinesin-like protein NACK2 [Nelumbo nucifera]
Length=976

 Score =   248 bits (634),  Expect = 6e-73, Method: Composition-based stats.
 Identities = 119/159 (75%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI RN+VSDW C+N  TI++RN   S  ERSMYP+ Y FDRVF  DC
Sbjct  25   IFVSVRLRPLNAKEIARNEVSDWECINDNTIIFRN---SLPERSMYPTAYTFDRVFRCDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AKEVALSVV+G NSS+FAYGQTSSGKT+TM+GITEY ++DIYD+IQ+H ER
Sbjct  82   STKQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTHTMSGITEYTVADIYDYIQRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE+VRDLLS D TPLRLLDDPERGTVV
Sbjct  142  AFVLKFSAMEIYNEAVRDLLSVDSTPLRLLDDPERGTVV  180



>ref|XP_010515505.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1032

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KE +RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLSVKERVRNDVADWECINDETVLYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVALSVVNG ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I+KH ER
Sbjct  77   CTREVYDQGAKEVALSVVNGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIEKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             ++LK SAMEIYNESVRDLLS+D++PLRLLDDPE+GTVV
Sbjct  137  AFILKFSAMEIYNESVRDLLSTDISPLRLLDDPEKGTVV  175



>gb|EYU24075.1| hypothetical protein MIMGU_mgv1a001308mg [Erythranthe guttata]
Length=843

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLNH EI   DVSDW C+N  TIVY+N+ L +SERS YP+ Y FDR+F S+C
Sbjct  15   IYVSVRLRPLNHNEISSGDVSDWECINNNTIVYKNISLVSSERSTYPNAYTFDRIFGSEC  74

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AK+VA+SV  G N+++FAYGQTSSGKTYTMTGITEYAI DIY++IQ++ ER
Sbjct  75   STREVYEKGAKDVAISVCCGINATIFAYGQTSSGKTYTMTGITEYAIQDIYNYIQEYQER  134

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAMEIYNESVRDLL+ D T LRLLDDPERGT+V
Sbjct  135  DFILKFSAMEIYNESVRDLLNVDNTSLRLLDDPERGTIV  173



>ref|NP_001190049.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE78757.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1054

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN +E  RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLNVRERARNDVADWECINDETVIYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM GIT+YA++DIYD+I+KH ER
Sbjct  77   STREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMIGITDYALADIYDYIEKHNER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D++PLR+LDDPE+GTVV
Sbjct  137  EFILKFSAMEIYNESVRDLLSTDISPLRVLDDPEKGTVV  175



>emb|CAB62637.1| putative protein [Arabidopsis thaliana]
Length=968

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN +E  RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLNVRERARNDVADWECINDETVIYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM GIT+YA++DIYD+I+KH ER
Sbjct  77   STREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMIGITDYALADIYDYIEKHNER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D++PLR+LDDPE+GTVV
Sbjct  137  EFILKFSAMEIYNESVRDLLSTDISPLRVLDDPEKGTVV  175



>ref|NP_190684.3| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE78756.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1052

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN +E  RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLNVRERARNDVADWECINDETVIYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM GIT+YA++DIYD+I+KH ER
Sbjct  77   STREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMIGITDYALADIYDYIEKHNER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D++PLR+LDDPE+GTVV
Sbjct  137  EFILKFSAMEIYNESVRDLLSTDISPLRVLDDPEKGTVV  175



>ref|XP_006403945.1| hypothetical protein EUTSA_v10010086mg [Eutrema salsugineum]
 gb|ESQ45398.1| hypothetical protein EUTSA_v10010086mg [Eutrema salsugineum]
Length=1032

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE +RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLNVKERVRNDVADWECINDETVIYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I+KH ER
Sbjct  77   CTREVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIEKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLLS+D++PLR+LDDPE+GTVV
Sbjct  137  EFFLKFSAMEIYNESVRDLLSTDISPLRVLDDPEKGTVV  175



>gb|KDO84748.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1104

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KE  RNDVSDW C+N  +IV++N  L   ERS+YP  Y FDRVF  +C
Sbjct  24   ILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLL---ERSVYPPAYTFDRVFGCEC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEV LSVVNG NS+ FAYGQTSSGKTYTM GITEYAI DIYD+I  H ER
Sbjct  81   PTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYAIQDIYDYIDTHQER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  141  EFVLKFSAMEIYNESVRDLLSTDSTPLRLLDDPEKGTVV  179



>gb|KDO84747.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1106

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KE  RNDVSDW C+N  +IV++N  L   ERS+YP  Y FDRVF  +C
Sbjct  24   ILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLL---ERSVYPPAYTFDRVFGCEC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEV LSVVNG NS+ FAYGQTSSGKTYTM GITEYAI DIYD+I  H ER
Sbjct  81   PTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYAIQDIYDYIDTHQER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  141  EFVLKFSAMEIYNESVRDLLSTDSTPLRLLDDPEKGTVV  179



>ref|XP_006473601.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1112

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KE  RNDVSDW C+N  +IV++N  L   ERS+YP  Y FDRVF  +C
Sbjct  24   ILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLL---ERSVYPPAYTFDRVFGCEC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEV LSVVNG NS+ FAYGQTSSGKTYTM GITEYAI DIYD+I  H ER
Sbjct  81   PTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYAIQDIYDYIDTHQER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  141  EFVLKFSAMEIYNESVRDLLSTDSTPLRLLDDPEKGTVV  179



>ref|XP_010550452.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550453.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=1064

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI RN VSDW C+N T I+YR+  LS SERSMYPS Y FDRVF  + 
Sbjct  20   IFVSVRLRPLNEKEIARNGVSDWECINDTMIIYRS-HLSISERSMYPSAYTFDRVFGPES  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AKEVALSVV G N+SVFAYGQTSSGKTYTM GIT+Y ++DIYD+I KH ER
Sbjct  79   STRQVYEQGAKEVALSVVGGVNASVFAYGQTSSGKTYTMIGITDYTMADIYDYIDKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++++K SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  139  EFIVKFSAMEIYNESVRDLLSTDNSPLRLLDDPEKGTVV  177



>ref|XP_006473600.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
Length=1114

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KE  RNDVSDW C+N  +IV++N  L   ERS+YP  Y FDRVF  +C
Sbjct  24   ILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLL---ERSVYPPAYTFDRVFGCEC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEV LSVVNG NS+ FAYGQTSSGKTYTM GITEYAI DIYD+I  H ER
Sbjct  81   PTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYAIQDIYDYIDTHQER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  141  EFVLKFSAMEIYNESVRDLLSTDSTPLRLLDDPEKGTVV  179



>ref|XP_006473602.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
Length=1100

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KE  RNDVSDW C+N  +IV++N  L   ERS+YP  Y FDRVF  +C
Sbjct  24   ILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLL---ERSVYPPAYTFDRVFGCEC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEV LSVVNG NS+ FAYGQTSSGKTYTM GITEYAI DIYD+I  H ER
Sbjct  81   PTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITEYAIQDIYDYIDTHQER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  141  EFVLKFSAMEIYNESVRDLLSTDSTPLRLLDDPEKGTVV  179



>ref|XP_009386558.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=933

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KEI RND SDW C N TTIV++N   + SER+MYP+ Y FD+VF  +C
Sbjct  57   ILVSVRVRPLNAKEIGRNDPSDWECRNNTTIVFKN---AHSERTMYPTAYTFDKVFGCEC  113

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR VY+E AKEVALSVV+G N+S+FAYGQTSSGKTYTMTGITEYA+ DIYD+I++H ER
Sbjct  114  DTRHVYDEGAKEVALSVVDGINASIFAYGQTSSGKTYTMTGITEYAMEDIYDYIKRHEER  173

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D+VLK SAMEIYNE VRDLLS+D +PLRLLDD ERGTVV
Sbjct  174  DFVLKFSAMEIYNELVRDLLSTDTSPLRLLDDAERGTVV  212



>ref|XP_010263901.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Nelumbo nucifera]
Length=894

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI R+D+SDW C+N  TI+ RN   + +ERSMYP+ Y FDRVF  DC
Sbjct  25   IFVSVRLRPLNAKEIARHDMSDWECINDNTIICRN---NLAERSMYPAAYTFDRVFRCDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYE  AKEVALSVV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD+I +H ER
Sbjct  82   STKEVYELGAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITEYTVADIYDYIHRHGER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLL  D TPLRLLDDPERGTVV
Sbjct  142  EFVLKFSAMEIYNEAVRDLLGFDSTPLRLLDDPERGTVV  180



>ref|XP_003629353.1| Kinesin heavy chain DNA binding protein-like protein [Medicago 
truncatula]
Length=1167

 Score =   247 bits (630),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 29/187 (16%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE+ +ND+S+W C+N TTI+YR+ +LSASERS+YP+ Y FDRVF +DC
Sbjct  20   ILVSVRVRPLNEKELWKNDLSEWECINDTTIMYRS-NLSASERSLYPTTYSFDRVFRTDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQK----  486
             TR+VYEEAAKEVALSV+NG NSS+FAYGQTSSGKTYTM+GITEYA++DI+++I+K    
Sbjct  79   PTRQVYEEAAKEVALSVLNGINSSIFAYGQTSSGKTYTMSGITEYAVADIFNYIEKVYET  138

Query  487  ------------------------HTERDYVLKLSAMEIYNESVRDLLSSDVTPLRLLDD  594
                                    H ER++VLK SAMEIYNESVRDLLS+D TPLRLLDD
Sbjct  139  EHIFASPCHFENLVLIRFFIFFLQHKEREFVLKFSAMEIYNESVRDLLSNDTTPLRLLDD  198

Query  595  PERGTVV  615
            PE+GTVV
Sbjct  199  PEKGTVV  205



>ref|XP_010263900.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nelumbo nucifera]
Length=972

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI R+D+SDW C+N  TI+ RN   + +ERSMYP+ Y FDRVF  DC
Sbjct  25   IFVSVRLRPLNAKEIARHDMSDWECINDNTIICRN---NLAERSMYPAAYTFDRVFRCDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYE  AKEVALSVV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD+I +H ER
Sbjct  82   STKEVYELGAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITEYTVADIYDYIHRHGER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLL  D TPLRLLDDPERGTVV
Sbjct  142  EFVLKFSAMEIYNEAVRDLLGFDSTPLRLLDDPERGTVV  180



>ref|XP_010919401.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
 ref|XP_010919402.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
Length=966

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL+ +EI RND  DW C+N TTI++RN   S  ERSM+P+ Y FDRVF  DC
Sbjct  39   ILVSVRLRPLSEREIARNDPCDWECINDTTIIFRN---SVPERSMFPTAYTFDRVFWCDC  95

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD+I++H ER
Sbjct  96   PTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITEYTVADIYDYIRRHEER  155

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V K SAMEIYNE+V+DLLS+D TPLRLLDDPE+GT+V
Sbjct  156  AFVQKFSAMEIYNEAVKDLLSTDSTPLRLLDDPEKGTIV  194



>dbj|BAB10710.1| kinesin heavy chain DNA binding protein-like [Arabidopsis thaliana]
Length=1037

 Score =   246 bits (627),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE  RNDV DW C+N TTI+YR+  LS SERSMYPS Y FDRVF+ +C
Sbjct  19   IYVSVRMRPLNDKEKFRNDVPDWECINNTTIIYRS-HLSISERSMYPSAYTFDRVFSPEC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVA SVV+G N+SVFAYGQTSSGKTYTM+GIT+ A+ DIY +I KH ER
Sbjct  78   CTRQVYEQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITDCALVDIYGYIDKHKER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  138  EFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVV  176



>ref|NP_201432.2| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AED98197.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1063

 Score =   246 bits (627),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE  RNDV DW C+N TTI+YR+  LS SERSMYPS Y FDRVF+ +C
Sbjct  19   IYVSVRMRPLNDKEKFRNDVPDWECINNTTIIYRS-HLSISERSMYPSAYTFDRVFSPEC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVA SVV+G N+SVFAYGQTSSGKTYTM+GIT+ A+ DIY +I KH ER
Sbjct  78   CTRQVYEQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITDCALVDIYGYIDKHKER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  138  EFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVV  176



>ref|XP_009587868.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009587869.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=907

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 137/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V+VRLRPLN +EI  NDVSDW C+N TTI+Y+N   + SERS++P+   +DRVF+S+C
Sbjct  25   IFVAVRLRPLNEREIANNDVSDWECINNTTILYKN---ALSERSLFPTACAYDRVFSSEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK VALSV++GFNSS+FAYGQTSSGKTYTM+GITEY ++DIYDHI K+ +R
Sbjct  82   STRQVYEEAAKGVALSVLSGFNSSIFAYGQTSSGKTYTMSGITEYTLADIYDHISKNDDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNE VRDLL+ D TPLRLLDDPERGTVV
Sbjct  142  EFTLKFSAMEIYNEVVRDLLTPDDTPLRLLDDPERGTVV  180



>ref|XP_011100938.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=998

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN  EI  NDVSDW  V+  TIVY+N  L ASERSM  + Y  DRVF SDC
Sbjct  18   IYVSVRLRPLNDTEISSNDVSDWESVSDDTIVYKNASLLASERSMQLTAYTVDRVFGSDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY++ AK+VALSVV+G NS++FAYGQTSSGKTYTMTGIT YAI+DIY++IQ H ER
Sbjct  78   STREVYQQGAKDVALSVVHGMNSTIFAYGQTSSGKTYTMTGITNYAIADIYEYIQTHPER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D++LK SAMEIYNESVRDLLS+D TPLRLLDDPERGT+V
Sbjct  138  DFILKFSAMEIYNESVRDLLSADSTPLRLLDDPERGTIV  176



>ref|XP_008791672.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=867

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL+ KEI R D  DW C+N TTI++R+   S  ER+M+P+ Y FDRVF  DC
Sbjct  40   ILVSVRLRPLSEKEIARKDPCDWECINDTTIIFRS---SVPERAMFPTAYTFDRVFWCDC  96

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYE+ AKEVALSVV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD+I++H ER
Sbjct  97   ATRQVYEDGAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITEYTVADIYDYIRRHEER  156

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE+V+DLLS+D TPLRLLDDPE+GT+V
Sbjct  157  AFVLKFSAMEIYNEAVKDLLSTDSTPLRLLDDPEKGTIV  195



>ref|XP_008775732.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=918

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVR+RPLN KE+ R D SDW C+N T+I+++N   S  ERSM P VY FDRVF  + 
Sbjct  55   IVVSVRVRPLNDKELERGDPSDWECINNTSIIFKN---SLPERSMLPIVYAFDRVFGCES  111

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGIT+Y+I+DIYD+I+KH ER
Sbjct  112  STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITQYSIADIYDYIEKHEER  171

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLS+D +PLRLLDDPERGT+V
Sbjct  172  EFVLKFSAMEIYNEAVRDLLSTDSSPLRLLDDPERGTIV  210



>ref|XP_009407965.1| PREDICTED: kinesin-like protein NACK2 [Musa acuminata subsp. 
malaccensis]
Length=959

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 137/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE+ RND SDW C+++TT+V++N   +  +RSMYP+ Y FDRVF S C
Sbjct  27   ILVSVRLRPLNAKELERNDTSDWECIDRTTVVFKN---NLPDRSMYPTAYTFDRVFGSKC  83

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR VYEE AKEVALSVV+G N+++FAYGQT+SGKTYTMTGITEY+++DIYDHI+++ ER
Sbjct  84   GTRDVYEEGAKEVALSVVSGINATIFAYGQTNSGKTYTMTGITEYSVADIYDHIKRNEER  143

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNE VRDLLS D +PLRLLDDPERGT+V
Sbjct  144  EFILKFSAMEIYNEVVRDLLSMDGSPLRLLDDPERGTIV  182



>ref|XP_002865077.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41336.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=1039

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE  RNDV DW C+N TTI+YR+  LS SERSMYPS Y FDRVF+ DC
Sbjct  19   IYVSVRMRPLNDKEKFRNDVPDWECINNTTIIYRS-HLSISERSMYPSAYTFDRVFSPDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVA SVV+G N+SVFAYGQTSSGKTYTM+GIT+ A+ DIY +I  H ER
Sbjct  78   CTRQVYEQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITDCALVDIYGYIDMHKER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  138  EFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVV  176



>ref|XP_008775730.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Phoenix dactylifera]
Length=1022

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVR+RPLN KE+ R D SDW C+N T+I+++N   S  ERSM P VY FDRVF  + 
Sbjct  55   IVVSVRVRPLNDKELERGDPSDWECINNTSIIFKN---SLPERSMLPIVYAFDRVFGCES  111

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGIT+Y+I+DIYD+I+KH ER
Sbjct  112  STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITQYSIADIYDYIEKHEER  171

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLS+D +PLRLLDDPERGT+V
Sbjct  172  EFVLKFSAMEIYNEAVRDLLSTDSSPLRLLDDPERGTIV  210



>emb|CDO96988.1| unnamed protein product [Coffea canephora]
Length=961

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ +EILRN+VSDW C+N+TTI+YRN   S  ERS  P+ Y FDRVF  DC
Sbjct  26   ILVLVRLRPLSDREILRNEVSDWECINETTILYRN---SLQERSGLPTAYSFDRVFRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TRKVY++  KE+ALSVV+G NS++FAYGQTSSGKTYTM GITEY ++DIYD+IQKH ER
Sbjct  83   PTRKVYDDGTKEIALSVVSGINSTIFAYGQTSSGKTYTMNGITEYTVADIYDYIQKHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK +AMEIYNE VRDLLS+D TPLRLLDDPERGT++
Sbjct  143  AFVLKFAAMEIYNEVVRDLLSTDNTPLRLLDDPERGTII  181



>ref|XP_002280678.2| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664763.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664764.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
Length=937

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL+ KE  R  VSDW C+N  TI+Y+N  LS  ERS +P+ Y FDRVF  +C
Sbjct  21   ILVSVRLRPLDVKENSRYHVSDWECINVNTIIYKN-SLSLPERSQFPTAYTFDRVFGQNC  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+E AKEVALSVVNG NSS+FAYGQTSSGKTYTMTGITEYA+SDIYD++++H +R
Sbjct  80   STREVYDEGAKEVALSVVNGINSSIFAYGQTSSGKTYTMTGITEYAVSDIYDYVERHRDR  139

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNE++RDLLSSD  PLRLLDDPERGTVV
Sbjct  140  EFKLKFSAMEIYNEALRDLLSSDSAPLRLLDDPERGTVV  178



>ref|XP_008791670.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
 ref|XP_008791671.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
Length=975

 Score =   243 bits (621),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL+ KEI R D  DW C+N TTI++R+   S  ER+M+P+ Y FDRVF  DC
Sbjct  40   ILVSVRLRPLSEKEIARKDPCDWECINDTTIIFRS---SVPERAMFPTAYTFDRVFWCDC  96

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYE+ AKEVALSVV+G NSS+FAYGQTSSGKTYTM+GITEY ++DIYD+I++H ER
Sbjct  97   ATRQVYEDGAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGITEYTVADIYDYIRRHEER  156

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE+V+DLLS+D TPLRLLDDPE+GT+V
Sbjct  157  AFVLKFSAMEIYNEAVKDLLSTDSTPLRLLDDPEKGTIV  195



>ref|XP_006435104.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
 gb|ESR48344.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
Length=1104

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KE  RNDVSDW C+N  +IV++N  L   ERS+YP  Y FDRVF  +C
Sbjct  24   ILVFVRLRPLNEKEYARNDVSDWECINNNSIVFKNSLL---ERSVYPPAYTFDRVFGCEC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAKEV LSVVNG NS+ FAYGQTSSGKTYTM GITE AI DIYD+I  H ER
Sbjct  81   PTRQVYEEAAKEVTLSVVNGINSTFFAYGQTSSGKTYTMGGITENAIQDIYDYIDTHQER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+GTVV
Sbjct  141  EFVLKFSAMEIYNESVRDLLSTDSTPLRLLDDPEKGTVV  179



>ref|XP_009767346.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009767347.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
Length=907

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V+VRLRPLN +EI  NDVSDW C+N TTI+Y+N   + SERS++P+   +DRVF+S+C
Sbjct  25   IFVAVRLRPLNEREIANNDVSDWECINNTTILYKN---ALSERSLFPTACAYDRVFSSEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK VALSV++GFNSS+FAYGQTSSGKTYTM+GITEY ++DIYDH  K+ +R
Sbjct  82   STRQVYEEAAKGVALSVLSGFNSSIFAYGQTSSGKTYTMSGITEYTLADIYDHTSKNDDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNE VRDLL+ D TPLRLLDDPERGTVV
Sbjct  142  EFTLKFSAMEIYNEVVRDLLTPDDTPLRLLDDPERGTVV  180



>ref|XP_009767348.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana sylvestris]
Length=905

 Score =   243 bits (619),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V+VRLRPLN +EI  NDVSDW C+N TTI+Y+N   + SERS++P+   +DRVF+S+C
Sbjct  25   IFVAVRLRPLNEREIANNDVSDWECINNTTILYKN---ALSERSLFPTACAYDRVFSSEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK VALSV++GFNSS+FAYGQTSSGKTYTM+GITEY ++DIYDH  K+ +R
Sbjct  82   STRQVYEEAAKGVALSVLSGFNSSIFAYGQTSSGKTYTMSGITEYTLADIYDHTSKNDDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNE VRDLL+ D TPLRLLDDPERGTVV
Sbjct  142  EFTLKFSAMEIYNEVVRDLLTPDDTPLRLLDDPERGTVV  180



>emb|CDX77978.1| BnaA09g31730D [Brassica napus]
Length=987

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ +E +RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLSVRERVRNDVADWECINDETVIYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T+ VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I+KH ER
Sbjct  77   CTKDVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIEKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D++PLR+LDDPE+GT+V
Sbjct  137  EFVLKFSAMEIYNESVRDLLSTDISPLRILDDPEKGTIV  175



>ref|XP_004146557.1| PREDICTED: uncharacterized protein LOC101218717 [Cucumis sativus]
Length=1000

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 136/166 (82%), Gaps = 9/166 (5%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KEI RNDVS+W C+N  T++ RN  LS +ERS YPS Y FDRVF  DC
Sbjct  20   ILVSVRVRPLNEKEISRNDVSEWECINDNTVICRNA-LSVAERS-YPSAYTFDRVFGCDC  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQ-----  483
            STRKVYEE AKEVALSVV+G NS++FAYGQTSSGKTYTM+GITEY I DIYD+I+     
Sbjct  78   STRKVYEEGAKEVALSVVSGVNSTIFAYGQTSSGKTYTMSGITEYTIEDIYDYIKKVSTK  137

Query  484  --KHTERDYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
              KHTER++ LK SA+EIYNESVRDLLS D +PLRLLDDPERGT V
Sbjct  138  FVKHTEREFFLKFSAIEIYNESVRDLLSVDSSPLRLLDDPERGTTV  183



>emb|CBI19799.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score =   243 bits (620),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL+ KE  R  VSDW C+N  TI+Y+N  LS  ERS +P+ Y FDRVF  +C
Sbjct  21   ILVSVRLRPLDVKENSRYHVSDWECINVNTIIYKN-SLSLPERSQFPTAYTFDRVFGQNC  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+E AKEVALSVVNG NSS+FAYGQTSSGKTYTMTGITEYA+SDIYD++++H +R
Sbjct  80   STREVYDEGAKEVALSVVNGINSSIFAYGQTSSGKTYTMTGITEYAVSDIYDYVERHRDR  139

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNE++RDLLSSD  PLRLLDDPERGTVV
Sbjct  140  EFKLKFSAMEIYNEALRDLLSSDSAPLRLLDDPERGTVV  178



>ref|XP_010465682.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1039

 Score =   243 bits (619),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE LRNDV DW C+N TTI+YR+  LS S+RSMYPS Y FDRVF  D 
Sbjct  19   IYVSVRMRPLNDKERLRNDVPDWDCINDTTIIYRS-HLSISDRSMYPSAYTFDRVFGPDS  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVA SVV G N+SVFAYGQTSSGKTYTM+GIT+ A+ DIYD+I KH ER
Sbjct  78   CTRQVYDQGAKEVAFSVVTGVNASVFAYGQTSSGKTYTMSGITDCALFDIYDYIGKHKER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  138  EFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVV  176



>ref|XP_010444813.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=1040

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE LRNDV DW C+N TTI+YR+  LS S+RSMYPS Y FDRVF  D 
Sbjct  19   IYVSVRMRPLNDKERLRNDVPDWDCINDTTIIYRS-HLSISDRSMYPSAYTFDRVFGPDS  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVA SVV G N+SVFAYGQTSSGKTYTM+GIT+ A+ DIYD+I KH ER
Sbjct  78   CTRQVYDQGAKEVAFSVVTGVNASVFAYGQTSSGKTYTMSGITDCALIDIYDYIGKHKER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  138  EFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVV  176



>ref|XP_010484662.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1040

 Score =   243 bits (619),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE LRNDV DW C+N TTI+YR+  LS S+RSMYPS Y FDRVF  D 
Sbjct  19   IYVSVRMRPLNDKERLRNDVPDWDCINDTTIIYRS-HLSISDRSMYPSAYTFDRVFGPDS  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVA SVV G N+SVFAYGQTSSGKTYTM+GIT+ A+ DIYD+I KH ER
Sbjct  78   CTRQVYDQGAKEVAFSVVTGVNASVFAYGQTSSGKTYTMSGITDCALIDIYDYIGKHKER  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  138  EFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVV  176



>emb|CDY30779.1| BnaC07g16790D [Brassica napus]
Length=989

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE+LRND  DW C+N TTI+YR+  LS S+RSMYPS Y FDRVF  +C
Sbjct  22   ISVSVRLRPLNDKEMLRNDSPDWECINSTTIMYRS-HLSISDRSMYPSAYSFDRVFGPEC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVA SVV+G N+SVFAYGQTSSGKTYTM+GIT   + DIYD+I KH ER
Sbjct  81   CTRQVYDQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITHCTLVDIYDYIDKHKER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  141  EFILKFSAMEIYNESVRDLLSTDSSPLRLLDDPEKGTVV  179



>emb|CDY29004.1| BnaC07g32100D [Brassica napus]
Length=1011

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE ++N+ +DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLNVKERVKNEEADWECINDETVIYRS-HLSLSERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I KH ER
Sbjct  77   CTKEVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIAKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D++PLRLLDDPE+GTVV
Sbjct  137  EFVLKFSAMEIYNESVRDLLSTDISPLRLLDDPEKGTVV  175



>gb|ABB45845.1| hypothetical protein [Eutrema halophilum]
Length=1061

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE LRNDV DW C+N +TI+YR+  LS SERSMYPS Y FDRVF  +C
Sbjct  18   IYVSVRLRPLNDKERLRNDVPDWECINNSTIIYRS-HLSISERSMYPSAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AK+VA SVV+G N+SVFAYGQTSSGKTYTM+GIT   + DIYD+I KH ER
Sbjct  77   CTRQVYDQGAKDVAFSVVSGVNASVFAYGQTSSGKTYTMSGITHCTLVDIYDYIDKHNER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  137  EFILKFSAMEIYNESVRDLLSTDSSPLRLLDDPEKGTVV  175



>emb|CDY45220.1| BnaA07g12700D [Brassica napus]
Length=1015

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE+LRND  DW C+N TTI+YR+  LS S+RSMYPS Y FDRVF  +C
Sbjct  22   ISVSVRLRPLNDKEMLRNDSPDWECINSTTIMYRS-HLSISDRSMYPSAYSFDRVFGPEC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVA SVV+G N+SVFAYGQTSSGKTYTM+GIT   + DIYD+I KH ER
Sbjct  81   CTRQVYDQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITHCTLVDIYDYIDKHKER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  141  EFILKFSAMEIYNESVRDLLSTDSSPLRLLDDPEKGTVV  179



>ref|XP_011092849.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
 ref|XP_011092850.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
 ref|XP_011092851.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
Length=912

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI RN+VSDW C+N TTI+YRN   S  ERS  P+ Y FDRVF  DC
Sbjct  26   ILVLVRLRPLSEKEIARNEVSDWECINSTTILYRN---SLQERSGLPTAYSFDRVFRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY+E  K++ LSVV G NS+VFAYGQTSSGKTYTM GITEYA++DIYD+IQKH ER
Sbjct  83   RTREVYDEGIKDIVLSVVGGINSTVFAYGQTSSGKTYTMNGITEYAVADIYDYIQKHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE VRDLLS+D TPLRLLDDPERGT++
Sbjct  143  AFVLKFSAMEIYNEVVRDLLSTDNTPLRLLDDPERGTII  181



>ref|XP_009115792.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
Length=1008

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ +E +RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  20   IFVSVRLRPLSVRERVRNDVADWECINDETVIYRS-HLSISERSMYPTAYTFDRVFGPEC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T+ VY++ AK+VALSVV+G ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I+KH ER
Sbjct  79   CTKDVYDQGAKDVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIEKHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D++PLR+LDDPE+GT+V
Sbjct  139  EFVLKFSAMEIYNESVRDLLSTDISPLRILDDPEKGTIV  177



>ref|XP_002301999.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE81272.2| kinesin motor family protein [Populus trichocarpa]
Length=915

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 137/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN +EI+RNDVSDW C+N +TI++++   +  ERSM+P+ Y FDRVF SDC
Sbjct  24   ILVSVRLRPLNEREIVRNDVSDWECINNSTIIFKS---NMPERSMFPTAYTFDRVFGSDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VYEE  KE+AL  V+G NS++FAYGQTSSGKTYTM GITEYA++DIY+++++H ER
Sbjct  81   LTKQVYEEGVKEIALLAVSGVNSTIFAYGQTSSGKTYTMRGITEYALADIYEYMKQHKER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLS+  +PLRLLDDPERGTVV
Sbjct  141  EFVLKFSAMEIYNEAVRDLLSTSSSPLRLLDDPERGTVV  179



>gb|EYU38855.1| hypothetical protein MIMGU_mgv1a000996mg [Erythranthe guttata]
Length=917

 Score =   240 bits (613),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V+VRLRPLN +EI +NDVSDW C+N TT++++N   S  ERS+ P+ Y FDRVF  D 
Sbjct  24   IFVAVRLRPLNEREISKNDVSDWECINSTTVIFKN---SLQERSLLPTAYTFDRVFGHDS  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAK++ALSV++G NS++FAYGQTSSGKT+TM+GITE  ++DIYD+I+KH ER
Sbjct  81   PTRQVYEEAAKKIALSVLSGMNSTIFAYGQTSSGKTFTMSGITECTVTDIYDYIKKHRER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            D+VLK SAMEIYNE+V+DLL SD TPLRLLDDPERGTVV
Sbjct  141  DFVLKFSAMEIYNEAVKDLLCSDGTPLRLLDDPERGTVV  179



>emb|CDX73746.1| BnaC08g22570D [Brassica napus]
Length=968

 Score =   240 bits (613),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ +E +RNDV+DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  +C
Sbjct  18   IFVSVRLRPLSVRERVRNDVADWECINDETVIYRS-HLSISERSMYPTAYTFDRVFGPEC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T+ VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I KH ER
Sbjct  77   CTKDVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIDKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D +PLR+LDDPE+GT+V
Sbjct  137  EFVLKFSAMEIYNESVRDLLSTDTSPLRILDDPEKGTIV  175



>ref|XP_009393646.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=913

 Score =   240 bits (613),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVR+RPLN KE+ ++D SDW C++ TT+V++N   S  ERS++P+ Y FDR F  DC
Sbjct  24   IVVSVRMRPLNAKEMEKSDPSDWDCIDDTTVVFKN---SLPERSVFPTAYTFDRAFGCDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VY+E AKEVALSVV+G N+S+FAYGQTSSGKTYTM GITEY + DIYD+I+KH ER
Sbjct  81   NTRRVYDEGAKEVALSVVSGINASIFAYGQTSSGKTYTMAGITEYTMEDIYDYIKKHEER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VL+ SAMEIYNE+VRDLLSSD +PLRLLDDPERGTVV
Sbjct  141  EFVLRFSAMEIYNEAVRDLLSSDGSPLRLLDDPERGTVV  179



>ref|XP_007017694.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017695.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14919.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14920.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
Length=1062

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN K+  RN VSDW C+N  TIV++N   S  ERSM+P+ Y FDRVF  D 
Sbjct  22   IFVSVRLRPLNEKDRARNSVSDWECINNDTIVFKN---SLPERSMFPAAYTFDRVFACDS  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEE AK++ALSV++G NS++FAYGQTSSGKTYTM+GITEYA++DIYD+I+ H ER
Sbjct  79   HTRQVYEEGAKQIALSVLSGINSTIFAYGQTSSGKTYTMSGITEYAVADIYDYIEMHEER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++++K SAMEIYNE+VRDLLSSD TPLRLLDDPERGTVV
Sbjct  139  EFLVKFSAMEIYNEAVRDLLSSDSTPLRLLDDPERGTVV  177



>gb|KDP27640.1| hypothetical protein JCGZ_19645 [Jatropha curcas]
Length=965

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI+ N+V+DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLNEKEIVTNEVADWECINDTTILYRN---TLREGSTFPSAYSFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTM GITEYA++DI+D++ +H ER
Sbjct  82   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMMGITEYAVADIFDYMHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLS D  PLRLLDDPE+GT+V
Sbjct  142  AFVLKFSAIEIYNEAIRDLLSRDSAPLRLLDDPEKGTIV  180



>ref|XP_002510482.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52669.1| ATP binding protein, putative [Ricinus communis]
Length=939

 Score =   239 bits (611),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN +E+ RND+ DW C+N  TI++++   +  +RSM P+ Y FDRVF S+C
Sbjct  28   IFVSVRMRPLNEREVARNDICDWECINNNTIIFKS---NMPDRSMVPTAYTFDRVFGSEC  84

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AKE+AL+ V+G NSS+FAYGQTSSGKTYTM G+TEYA++DIY+++ KH ER
Sbjct  85   STKQVYEEGAKEIALAAVSGINSSIFAYGQTSSGKTYTMDGVTEYAVADIYEYMNKHKER  144

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLSSD TPLR+LDDPE+GTVV
Sbjct  145  EFVLKFSAMEIYNEAVRDLLSSDSTPLRVLDDPEKGTVV  183



>ref|XP_008388154.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=379

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  +NDVSDW CV   T++Y N   S  +R M PS Y FDRVF  DC
Sbjct  7    ILVSVRLRPLNDKEKAKNDVSDW-CVKNNTVMYNN---SHPDRPMSPSAYGFDRVFGWDC  62

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T KVY+E AKEV LSV+NG NS++FAYGQTSSGKTYTM GIT+YA++DIYD+I+KH++R
Sbjct  63   PTTKVYDEGAKEVVLSVINGINSTIFAYGQTSSGKTYTMKGITDYAVADIYDYIEKHSDR  122

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLSS+   LRLLDDPE+GTVV
Sbjct  123  EFVLKFSAMEIYNEAVRDLLSSEGAQLRLLDDPEKGTVV  161



>ref|XP_010690757.1| PREDICTED: kinesin-like protein NACK1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690758.1| PREDICTED: kinesin-like protein NACK1 [Beta vulgaris subsp. vulgaris]
Length=894

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI +N+V+DW C+NQ+TI+YRN   S  ERS  P+ Y FDRV++ DC
Sbjct  22   ILVLVRLRPLNEKEISKNEVADWECINQSTILYRN---SLQERSGLPTAYSFDRVYSGDC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            S+++VYEE  KE+ALSVV+G NSS+FAYGQTSSGKTYTM  ITE+ ++DIYD+IQ+H ER
Sbjct  79   SSKQVYEEGTKEIALSVVSGINSSIFAYGQTSSGKTYTMNAITEFTVADIYDYIQRHEER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             + LK SAMEIYNE+VRDLLSSD TPLRL+DDPE+GT+V
Sbjct  139  AFALKFSAMEIYNENVRDLLSSDNTPLRLMDDPEKGTIV  177



>ref|XP_006281818.1| hypothetical protein CARUB_v10028003mg [Capsella rubella]
 gb|EOA14716.1| hypothetical protein CARUB_v10028003mg [Capsella rubella]
Length=1049

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE LRN+V DW C+N TTI+YR+  LS S+RSMYPS Y FDRVF  + 
Sbjct  18   IYVSVRMRPLNDKERLRNNVPDWDCINNTTIIYRS-QLSISDRSMYPSAYTFDRVFGPES  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR VY++ AKEVA SVV+G N+SVFAYGQTSSGKTYTM+GIT+ A+ DIYD+I KH ER
Sbjct  77   CTRHVYDQGAKEVAFSVVSGVNASVFAYGQTSSGKTYTMSGITDCALVDIYDYIGKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  137  EFILKFSAMEIYNESVRDLLSTDTSPLRLLDDPEKGTVV  175



>ref|XP_010933747.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=961

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPL+ KEI RND  DW C+N TTI++RN      ER+M+P+ Y FDRVF  D 
Sbjct  34   IVVSVRLRPLSEKEIARNDPCDWECINDTTIIFRNC---IPERAMFPTAYTFDRVFWCDR  90

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VY+EAAKEVALSVV+G N+S+FAYGQTSSGKTYTM+GITEY ++D+YD+I +H ER
Sbjct  91   TTRQVYQEAAKEVALSVVSGINASIFAYGQTSSGKTYTMSGITEYTVADVYDYIHRHEER  150

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE+V+DLLS+D TPLRLLDDPE+GT+V
Sbjct  151  AFVLKFSAMEIYNEAVKDLLSTDSTPLRLLDDPEKGTIV  189



>ref|XP_011028953.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Populus euphratica]
Length=915

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN +EI RNDVSDW C+N +TI++++   +  ERSM+P+ Y FDRVF SDC
Sbjct  24   ILVSVRLRPLNEREIARNDVSDWECINNSTIIFKS---NMPERSMFPTAYTFDRVFRSDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VYEE  KE+AL  V+G NS++FAYGQTSSGKTYTM GITEYA++D+Y+++++H ER
Sbjct  81   LTKQVYEEGVKEIALLAVSGVNSTIFAYGQTSSGKTYTMRGITEYALADVYEYMEQHKER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+V+DLLS+  +PLRLLDDPERGTVV
Sbjct  141  EFVLKFSAMEIYNEAVKDLLSTSSSPLRLLDDPERGTVV  179



>ref|XP_011028954.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Populus euphratica]
Length=912

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN +EI RNDVSDW C+N +TI++++   +  ERSM+P+ Y FDRVF SDC
Sbjct  24   ILVSVRLRPLNEREIARNDVSDWECINNSTIIFKS---NMPERSMFPTAYTFDRVFRSDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VYEE  KE+AL  V+G NS++FAYGQTSSGKTYTM GITEYA++D+Y+++++H ER
Sbjct  81   LTKQVYEEGVKEIALLAVSGVNSTIFAYGQTSSGKTYTMRGITEYALADVYEYMEQHKER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+V+DLLS+  +PLRLLDDPERGTVV
Sbjct  141  EFVLKFSAMEIYNEAVKDLLSTSSSPLRLLDDPERGTVV  179



>ref|XP_009386197.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=941

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KEI +ND SDW CVN TTI+++N   S  ERS +P+ Y FD+VF    
Sbjct  24   ILVSVRVRPLNAKEIEKNDPSDWECVNDTTIMFKN---SLPERSAFPTAYTFDKVFGHQS  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR VY+E AKEVALSVVNG N+S+FAYGQTSSGKTYTMT ITEY + DIYD+I++H ER
Sbjct  81   NTRHVYDEGAKEVALSVVNGINASIFAYGQTSSGKTYTMTSITEYTMEDIYDYIKRHEER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLS+D +PLRLLDDPERGTVV
Sbjct  141  EFVLKFSAMEIYNEAVRDLLSTDSSPLRLLDDPERGTVV  179



>ref|XP_009617690.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009617691.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=928

 Score =   237 bits (604),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI+R++VSDW C+N+TTI+YRN   S  ERS  P+ Y FDRV+  DC
Sbjct  26   ILVLVRLRPLSEKEIVRSEVSDWECINETTILYRN---SLQERSGLPTAYTFDRVYRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE   K++ALSVV+G NS++FAYGQTSSGKTYTM GITE+ ++DIYD++Q+H ER
Sbjct  83   STREVYEGGTKDIALSVVSGINSTIFAYGQTSSGKTYTMNGITEFTVTDIYDYMQRHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE VRDLLSSD TPLRLLDDPE+GT++
Sbjct  143  AFVLKFSAMEIYNEVVRDLLSSDSTPLRLLDDPEKGTII  181



>gb|EYU35751.1| hypothetical protein MIMGU_mgv1a020956mg, partial [Erythranthe 
guttata]
Length=311

 Score =   224 bits (571),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 124/157 (79%), Gaps = 11/157 (7%)
 Frame = +1

Query  145  VSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDCST  324
            VSVRLRP N +EILRNDVSDW C+N  TI+Y+N  LSASERS YP+ Y F+         
Sbjct  47   VSVRLRPPNGREILRNDVSDWECINNETIIYKNSALSASERSKYPTSYTFE---------  97

Query  325  RKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTERDY  504
              VYE+ AK VALSV++G NS VFAYGQTSSGKTYTMTGITEYA+ DIY +IQKH ERD+
Sbjct  98   --VYEQGAKYVALSVISGINSRVFAYGQTSSGKTYTMTGITEYALPDIYGYIQKHQERDF  155

Query  505  VLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            V K SAMEIYNESVRDLLS D TPLRLLDD ERGT+V
Sbjct  156  VFKFSAMEIYNESVRDLLSVDNTPLRLLDDTERGTIV  192



>ref|XP_009760421.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760422.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760423.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=929

 Score =   236 bits (603),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI+R++VSDW C+N+TTI+YRN   S  ERS  P+ Y FDRV+  DC
Sbjct  26   ILVLVRLRPLSEKEIVRSEVSDWECINETTILYRN---SLQERSGLPTAYTFDRVYRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE   K++ALSVV+G NS++FAYGQTSSGKTYTM GITE+ ++DIYD++Q+H ER
Sbjct  83   STREVYEGGTKDIALSVVSGINSTIFAYGQTSSGKTYTMNGITEFTVTDIYDYMQRHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE VRDLL SD TPLRLLDDPE+GT++
Sbjct  143  AFVLKFSAMEIYNEVVRDLLGSDTTPLRLLDDPEKGTII  181



>ref|XP_004238322.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
 ref|XP_010320414.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=926

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V+VRLRPLN +EI  NDVSDW C+N TTI Y+N   S SERS++P+   +DRVF  DC
Sbjct  27   IFVAVRLRPLNEREITCNDVSDWECINNTTIFYKN---SMSERSLFPTACAYDRVFGYDC  83

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK VALSV++G NSS+FAYGQTSSGKTYTM+GITEY ++DIYDHI ++ +R
Sbjct  84   STRQVYEEAAKGVALSVLSGINSSIFAYGQTSSGKTYTMSGITEYTLADIYDHICRNVDR  143

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNE VRDLL+ + TPLRLLDDPERGTVV
Sbjct  144  EFTLKFSAMEIYNEVVRDLLTPEDTPLRLLDDPERGTVV  182



>ref|XP_011083601.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011083602.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=913

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 136/159 (86%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V+VR+RPLN +E+ +NDVSDW C+N TTIV++N   S +ERS+ P+ + FDRVF ++ 
Sbjct  27   IFVAVRVRPLNERELGKNDVSDWECINSTTIVFKN---SLAERSLVPTAHTFDRVFGTEA  83

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST +VYEEAAK++ALSV++G NS++FAYGQTSSGKTYTMTGITEY ++DIYD+I KH+ER
Sbjct  84   STGQVYEEAAKKIALSVLSGMNSTIFAYGQTSSGKTYTMTGITEYTVADIYDYIHKHSER  143

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLL  D  PLRLLDDPERGTVV
Sbjct  144  EFVLKFSAMEIYNEAVRDLLWPDGGPLRLLDDPERGTVV  182



>ref|XP_006342008.1| PREDICTED: kinesin-like protein NACK2-like isoform X3 [Solanum 
tuberosum]
Length=922

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V+VRLRPLN +EI  NDVSDW C+N TTI+Y+N   S SERS++P+   +DRVF  DC
Sbjct  27   IFVAVRLRPLNEREITCNDVSDWECINNTTILYKN---SMSERSLFPTACAYDRVFGYDC  83

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK VALSV++G NSS+FAYGQTSSGKTYTM+GITEY ++DIYDHI +  +R
Sbjct  84   STRQVYEEAAKGVALSVLSGINSSIFAYGQTSSGKTYTMSGITEYTLADIYDHICRTVDR  143

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNE VRDLL+ + TPLRLLDDPERGTVV
Sbjct  144  EFTLKFSAMEIYNEVVRDLLTPEDTPLRLLDDPERGTVV  182



>ref|XP_006342006.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342007.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Solanum 
tuberosum]
Length=924

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V+VRLRPLN +EI  NDVSDW C+N TTI+Y+N   S SERS++P+   +DRVF  DC
Sbjct  27   IFVAVRLRPLNEREITCNDVSDWECINNTTILYKN---SMSERSLFPTACAYDRVFGYDC  83

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEEAAK VALSV++G NSS+FAYGQTSSGKTYTM+GITEY ++DIYDHI +  +R
Sbjct  84   STRQVYEEAAKGVALSVLSGINSSIFAYGQTSSGKTYTMSGITEYTLADIYDHICRTVDR  143

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNE VRDLL+ + TPLRLLDDPERGTVV
Sbjct  144  EFTLKFSAMEIYNEVVRDLLTPEDTPLRLLDDPERGTVV  182



>ref|XP_004509338.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
 ref|XP_004509339.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
 ref|XP_004509340.1| PREDICTED: kinesin-related protein 4-like isoform X3 [Cicer arietinum]
Length=985

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 143/184 (78%), Gaps = 26/184 (14%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVR+RPLN KE+ +ND+S+W C++ TTI+YR+ +LSASERS+YP+ Y FDRVF +DC
Sbjct  20   IVVSVRVRPLNDKELAKNDLSEWECIDDTTIMYRS-NLSASERSLYPTTYTFDRVFRADC  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQK----  486
             TR+VYE AAKEVAL V++G NSS+FAYGQTSSGKTYTM+GIT YA++DI+++I+K    
Sbjct  79   PTRQVYEAAAKEVALCVLDGINSSIFAYGQTSSGKTYTMSGITGYAVADIFNYIEKVYET  138

Query  487  ---------------------HTERDYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPER  603
                                 H ER++VLK SAMEIYNESVRDLLS+D TPLRLLDDPE+
Sbjct  139  KHVVASPCHSENLVLIRYFLQHKEREFVLKFSAMEIYNESVRDLLSTDSTPLRLLDDPEK  198

Query  604  GTVV  615
            GTVV
Sbjct  199  GTVV  202



>ref|XP_009136598.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
 ref|XP_009136599.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
Length=1026

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE ++N+ +DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  + 
Sbjct  20   IFVSVRLRPLNVKERVKNEEADWECINDETVIYRS-HLSLSERSMYPTAYTFDRVFGPER  78

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I +H ER
Sbjct  79   CTKEVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIAQHKER  138

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D++PLRLLDDPE+GTVV
Sbjct  139  EFVLKFSAMEIYNESVRDLLSTDISPLRLLDDPEKGTVV  177



>ref|XP_011458294.1| PREDICTED: kinesin-like protein NACK1 [Fragaria vesca subsp. 
vesca]
Length=914

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KE+  N+V+DW C+N TTI+YRN   +  E S +P+ Y FD+VF  DC
Sbjct  25   ILVLVRLRPLNEKELASNEVADWECINDTTILYRN---TLREGSTFPNAYSFDKVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TRKVYEE A+E+ALSVVNG NSS+FAYGQTSSGKTYTM GITE+ +++I+D+I +H ER
Sbjct  82   PTRKVYEEGAQEIALSVVNGINSSIFAYGQTSSGKTYTMNGITEFTVAEIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE+VRDLLS+D TPLRLLDDPERGT+V
Sbjct  142  AFVVKFSAIEIYNEAVRDLLSTDNTPLRLLDDPERGTIV  180



>emb|CDX90660.1| BnaA03g41210D [Brassica napus]
Length=1024

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE ++N+ +DW C+N  T++YR+  LS SERSMYP+ Y FDRVF  + 
Sbjct  18   IFVSVRLRPLNVKERVKNEEADWECINDETVIYRS-HLSLSERSMYPTAYTFDRVFGPER  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VY++ AKEVALSVV+G ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I +H ER
Sbjct  77   CTKEVYDQGAKEVALSVVSGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIAQHMER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNESVRDLLS+D++PLRLLDDPE+GTVV
Sbjct  137  EFVLKFSAMEIYNESVRDLLSTDISPLRLLDDPEKGTVV  175



>ref|XP_008796871.1| PREDICTED: kinesin-like protein NACK1 [Phoenix dactylifera]
Length=962

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPL+ KEI RND  DW C+N TTI++RN   S  ER+M+P+ Y FDRVF  +C
Sbjct  37   ILVSVRLRPLSEKEIARNDPCDWECINDTTIIFRN---SIPERAMFPTAYTFDRVFWCEC  93

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEEAAKEVALSVV+G NSS+FAYGQTSSGKTYTM+G+TEY  +DIYD+I +H ER
Sbjct  94   TTRQVYEEAAKEVALSVVSGINSSIFAYGQTSSGKTYTMSGVTEYTAADIYDYICRHEER  153

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE+V+DLLS+D    RLLDDPE+GT+V
Sbjct  154  TFVLKFSAIEIYNEAVKDLLSTDSATSRLLDDPEKGTIV  192



>ref|XP_010315333.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Solanum lycopersicum]
 ref|XP_010315334.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Solanum lycopersicum]
Length=924

 Score =   234 bits (598),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI RN+VSDW C+N+T+I+YRN   S  ERS  P+ Y FDRV+  DC
Sbjct  26   ILVLVRLRPLSEKEISRNEVSDWECINETSILYRN---SLQERSGLPTAYTFDRVYRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE   K++ALSVV+G NS++FAYGQTSSGKTYTM GITE+ ++DIYD+++KH ER
Sbjct  83   STREVYEGGTKDIALSVVSGINSTIFAYGQTSSGKTYTMNGITEFTVADIYDYMRKHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE VRDLLSSD +PLRLLDDPE+GT++
Sbjct  143  AFVLKFSAMEIYNEVVRDLLSSDSSPLRLLDDPEKGTII  181



>ref|XP_010315335.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Solanum lycopersicum]
Length=922

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI RN+VSDW C+N+T+I+YRN   S  ERS  P+ Y FDRV+  DC
Sbjct  26   ILVLVRLRPLSEKEISRNEVSDWECINETSILYRN---SLQERSGLPTAYTFDRVYRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE   K++ALSVV+G NS++FAYGQTSSGKTYTM GITE+ ++DIYD+++KH ER
Sbjct  83   STREVYEGGTKDIALSVVSGINSTIFAYGQTSSGKTYTMNGITEFTVADIYDYMRKHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE VRDLLSSD +PLRLLDDPE+GT++
Sbjct  143  AFVLKFSAMEIYNEVVRDLLSSDSSPLRLLDDPEKGTII  181



>ref|XP_009777060.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Nicotiana 
sylvestris]
Length=889

 Score =   234 bits (596),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI RN+ SDW C+N+TTI YRN   S  ERS  P+ Y FD+VF  DC
Sbjct  26   ILVLVRLRPLSEKEIARNEASDWECINETTIFYRN---SFQERSGLPTAYTFDKVFRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYE   K++ALSVV G NS++FAYGQTSSGKTYTM GITEY ++DIYD++++H ER
Sbjct  83   TTREVYEGGTKDIALSVVRGINSTIFAYGQTSSGKTYTMNGITEYTVADIYDYMKRHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE VRDLLSSD TPLR+LDDPE+GT++
Sbjct  143  SFVLKFSAMEIYNEVVRDLLSSDSTPLRMLDDPEKGTII  181



>ref|XP_007201806.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
 gb|EMJ03005.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
Length=926

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KE+  N+V+DW C+N TTI+YRN   +  E S +P+ Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEVASNEVADWECINDTTILYRN---TLREGSTFPTAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE A+++ALSVVNG NSS+FAYGQTSSGKTYTM GITE+ +++I+D+I +H ER
Sbjct  82   STRQVYEEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMDGITEFTVAEIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE+VRDLLSSD TPLRLLDDPERGT++
Sbjct  142  AFVVKFSAIEIYNEAVRDLLSSDNTPLRLLDDPERGTII  180



>ref|XP_002512997.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49500.1| ATP binding protein, putative [Ricinus communis]
Length=842

 Score =   233 bits (595),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI+ ++V+DW C+N TTI+YRN   +  E S +PS Y FDRVF  D 
Sbjct  25   ILVLVRLRPLNDKEIVADEVADWECLNDTTILYRN---TLREGSTFPSAYTFDRVFRGDS  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+E AKEVALSVV+G NSS+FAYGQTSSGKTYTM GITEY ++DI+D+I +H ER
Sbjct  82   STRQVYDEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMIGITEYTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLS+D TPLRLLDDPE+GTVV
Sbjct  142  AFVLKFSAIEIYNEAIRDLLSADSTPLRLLDDPEKGTVV  180



>ref|XP_007226270.1| hypothetical protein PRUPE_ppa019074mg [Prunus persica]
 gb|EMJ27469.1| hypothetical protein PRUPE_ppa019074mg [Prunus persica]
Length=1044

 Score =   234 bits (597),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 132/159 (83%), Gaps = 4/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  +NDVSDW CV   T++Y N   S  +R M PS Y FDRVF  +C
Sbjct  13   ILVSVRLRPLNQKEKTKNDVSDW-CVKNNTVMYNN---SHPDRPMSPSAYSFDRVFGWEC  68

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TRKVY+E AKEVALS +NG NS++FAYGQTSSGKTYTM GIT+YAI+DIYD+I++H+++
Sbjct  69   PTRKVYDEGAKEVALSAINGINSTIFAYGQTSSGKTYTMKGITDYAITDIYDYIEQHSDK  128

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+V+DLLSSD  PLRLLDDPE+GTV+
Sbjct  129  EFVLKFSAMEIYNEAVKDLLSSDSGPLRLLDDPEKGTVI  167



>ref|XP_009398104.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398105.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398106.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=957

 Score =   234 bits (596),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KE+  ND  DW C+N TTI++RN   S  ERSM P+ Y FDRVF SDC
Sbjct  35   IFVSVRLRPLSEKEVAANDSCDWECINDTTIIFRN---SLPERSMIPTAYTFDRVFRSDC  91

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +T++VYEE AKE+ALSVV+G NS++FAYGQTSSGKTYTMTGITEY  +DIY++I KH ER
Sbjct  92   TTKQVYEEGAKEIALSVVSGINSTIFAYGQTSSGKTYTMTGITEYTAADIYEYIHKHEER  151

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE+V+DLLS+D   LRLLDDPE+GTV+
Sbjct  152  AFVLKFSAIEIYNEAVKDLLSTDSGHLRLLDDPEKGTVI  190



>ref|XP_007131749.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
 gb|ESW03743.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
Length=891

 Score =   233 bits (594),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVS+RLRPLN KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FD+VF  DC
Sbjct  25   ILVSIRLRPLNEKEIAANESADWECINDTTILYRN---TLREGSTFPSAYTFDKVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEE AKEVALSVV G NSS+FAYGQTSSGKTYTM GITEYA++DI+D+I++H ER
Sbjct  82   ATRQVYEEGAKEVALSVVGGINSSIFAYGQTSSGKTYTMVGITEYAVADIFDYIKRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             ++LK SA+EIYNE VRDLLS+D +PLRL DDPERG ++
Sbjct  142  AFILKFSAIEIYNEIVRDLLSTDNSPLRLRDDPERGPIL  180



>ref|XP_007131750.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
 gb|ESW03744.1| hypothetical protein PHAVU_011G038800g [Phaseolus vulgaris]
Length=892

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVS+RLRPLN KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FD+VF  DC
Sbjct  25   ILVSIRLRPLNEKEIAANESADWECINDTTILYRN---TLREGSTFPSAYTFDKVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEE AKEVALSVV G NSS+FAYGQTSSGKTYTM GITEYA++DI+D+I++H ER
Sbjct  82   ATRQVYEEGAKEVALSVVGGINSSIFAYGQTSSGKTYTMVGITEYAVADIFDYIKRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             ++LK SA+EIYNE VRDLLS+D +PLRL DDPERG ++
Sbjct  142  AFILKFSAIEIYNEIVRDLLSTDNSPLRLRDDPERGPIL  180



>ref|XP_011074638.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Sesamum indicum]
Length=974

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN +E+ RNDV +W C+N TTI+++N      ERS+ P+ Y FDRVF    
Sbjct  23   IFVSVRLRPLNERELSRNDVPEWECINNTTIIFKN---GLQERSLSPTAYTFDRVFGPQN  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAK++ALSV++G NSS+FAYGQTSSGKTYTM+GITEYA++DIYD+I+KH ER
Sbjct  80   PTRQVYEEAAKKIALSVLSGMNSSIFAYGQTSSGKTYTMSGITEYAVADIYDYIEKHRER  139

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE V+DLLS D TPLRLLDDP RGTVV
Sbjct  140  AFVLKFSAMEIYNEVVKDLLSFDGTPLRLLDDPVRGTVV  178



>emb|CDP07439.1| unnamed protein product [Coffea canephora]
Length=937

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VS+RLRPLN +E+   D + W C+N TT++Y+N   S  ERS  P+ Y FDRVF   C
Sbjct  26   IFVSIRLRPLNDRELANEDAAVWECINSTTLLYKN---SLPERSALPTAYNFDRVFAGGC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST +VYEE+AK VAL VV G NSS+FAYGQTSSGKTYTM GITEYAI+DIYD+IQKH  R
Sbjct  83   STMQVYEESAKRVALCVVGGINSSIFAYGQTSSGKTYTMCGITEYAIADIYDYIQKHPNR  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE+VRDLLSSD TPLRLLDDP+RGTVV
Sbjct  143  QFVLKFSAMEIYNEAVRDLLSSDATPLRLLDDPDRGTVV  181



>ref|XP_010503800.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1040

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KE +RNDV+DW C+N  T++YR+  LS SERSMYP+ Y F  +    C
Sbjct  18   IFVSVRLRPLSVKERVRNDVADWECINDETVLYRS-HLSISERSMYPTAYTFASMKILXC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY++ AKEVALSVVNG ++SVFAYGQTSSGKTYTM+GIT+YA++DIYD+I+KH ER
Sbjct  77   CTREVYDQGAKEVALSVVNGVHASVFAYGQTSSGKTYTMSGITDYALADIYDYIEKHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             ++LK SAMEIYNESVRDLLS+D++PLRLLDDPE+GTVV
Sbjct  137  AFILKFSAMEIYNESVRDLLSTDISPLRLLDDPEKGTVV  175



>ref|XP_011074636.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Sesamum indicum]
 ref|XP_011074637.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Sesamum indicum]
Length=989

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN +E+ RNDV +W C+N TTI+++N      ERS+ P+ Y FDRVF    
Sbjct  23   IFVSVRLRPLNERELSRNDVPEWECINNTTIIFKN---GLQERSLSPTAYTFDRVFGPQN  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEEAAK++ALSV++G NSS+FAYGQTSSGKTYTM+GITEYA++DIYD+I+KH ER
Sbjct  80   PTRQVYEEAAKKIALSVLSGMNSSIFAYGQTSSGKTYTMSGITEYAVADIYDYIEKHRER  139

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE V+DLLS D TPLRLLDDP RGTVV
Sbjct  140  AFVLKFSAMEIYNEVVKDLLSFDGTPLRLLDDPVRGTVV  178



>ref|XP_006423481.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36721.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=960

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  ++ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEITADEATDWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AKE+ALSVV+G NSS+FAYGQTSSGKTYTMTGITE  ++DI+D+I +H ER
Sbjct  82   STRQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITECTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE++RDLLS+D TPLRLLDDPE+G VV
Sbjct  142  AFVLKFSAMEIYNEAIRDLLSTDNTPLRLLDDPEKGVVV  180



>ref|XP_006423482.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423483.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423486.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36722.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36723.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36726.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=962

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  ++ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEITADEATDWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AKE+ALSVV+G NSS+FAYGQTSSGKTYTMTGITE  ++DI+D+I +H ER
Sbjct  82   STRQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITECTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE++RDLLS+D TPLRLLDDPE+G VV
Sbjct  142  AFVLKFSAMEIYNEAIRDLLSTDNTPLRLLDDPEKGVVV  180



>ref|XP_002313758.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE87713.2| kinesin motor family protein [Populus trichocarpa]
Length=975

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI+ N+V+DW C+N TTI+YRN   +  E S +PS Y FDRVF  D 
Sbjct  25   ILVLVRLRPLSDKEIVENEVADWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDN  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEE AKE ALSVV+G NSS+FAYGQTSSGKTYTM GITEY ++DI+D+I +H ER
Sbjct  82   ATREVYEEGAKEAALSVVSGINSSIFAYGQTSSGKTYTMMGITEYTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLS+D TPLRLLDDPE+GTVV
Sbjct  142  AFVLKFSAIEIYNEAIRDLLSTDSTPLRLLDDPEKGTVV  180



>gb|EYU37862.1| hypothetical protein MIMGU_mgv1a001175mg [Erythranthe guttata]
Length=872

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI R++V+DW C+N TTI+YRN   S  ERS  P+ Y FDRVF  DC
Sbjct  26   ILVLVRLRPLSEKEIARSEVADWECINPTTILYRN---SLQERSGLPTAYSFDRVFRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR++Y+E  K++ALSVV G NS++FAYGQTSSGKTYTM GITEYA++DIYD+I +H ER
Sbjct  83   TTREIYDEGTKDIALSVVGGINSTIFAYGQTSSGKTYTMNGITEYAVADIYDYILRHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             + LK SAMEIYNE VRDLLS+D TPLRL+DDPE+GT++
Sbjct  143  AFALKFSAMEIYNEVVRDLLSTDNTPLRLMDDPEKGTII  181



>gb|KJB63570.1| hypothetical protein B456_010G006400 [Gossypium raimondii]
Length=995

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 131/159 (82%), Gaps = 7/159 (4%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVR+RPLN KE      SDW C+N  TI+++N   S  ERSM+P+ Y FDRV++ DC
Sbjct  14   IFVSVRIRPLNDKE----RKSDWECINNDTIIFKN---SLPERSMFPAAYTFDRVYDCDC  66

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VY+E AK +ALSV+NG NSS+FAYGQTSSGKTYTM GITEYA++DIYD+I+KH ER
Sbjct  67   PTKQVYDEGAKHIALSVLNGINSSIFAYGQTSSGKTYTMRGITEYAVADIYDYIEKHKER  126

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++V+K SAMEIYNE+VRDLLS D TPLRLLDDPERGTVV
Sbjct  127  EFVVKFSAMEIYNEAVRDLLSLDSTPLRLLDDPERGTVV  165



>ref|XP_007042026.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
 gb|EOX97857.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
Length=965

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI+ N+V+DW C+N +TI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  28   ILVVVRLRPLSEKEIVANEVADWECINDSTILYRN---TLREGSTFPSAYQFDRVFRGDC  84

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AKE+ALSVV+G NSS+FAYGQTSSGKTYTMTGITEY ++DI+D+I +H ER
Sbjct  85   STKQVYEEGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITEYTVADIFDYINRHEER  144

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLSSD T +RL DDPERGT+V
Sbjct  145  AFVLKFSAIEIYNEAIRDLLSSDNTQVRLRDDPERGTIV  183



>gb|KHN25430.1| Centromere-associated protein E [Glycine soja]
Length=909

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVS+RLRPLN KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVSIRLRPLNEKEIAANESADWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTM GITEYA++DI+D+I +H ER
Sbjct  82   VTRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMVGITEYAVADIFDYITRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             ++LK SA+EIYNE VRDLLS+D TPLRL DDPE+G ++
Sbjct  142  AFILKFSAIEIYNEIVRDLLSTDNTPLRLRDDPEKGPIL  180



>ref|XP_007135918.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 ref|XP_007135919.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 gb|ESW07912.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 gb|ESW07913.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
Length=888

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KE+  N+V+DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLNEKEVEVNEVADWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AK +ALSVV G NSS+FAYGQTSSGKTYTM GITEYA++DI+D+I+KH ER
Sbjct  82   STKQVYEEGAKAIALSVVGGINSSIFAYGQTSSGKTYTMIGITEYAVADIFDYIRKHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE +RDLLSS+ TPLRL DDPERG +V
Sbjct  142  AFVLKFSAIEIYNEIIRDLLSSENTPLRLRDDPERGPIV  180



>ref|XP_010535298.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010535299.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010535300.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=1118

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE+ RND+ DW C+N TTI+ +N   +  ERS++PS Y +DRVF  + 
Sbjct  16   ILVSVRVRPLNEKEMTRNDICDWECINNTTIICKN---NFPERSLFPSAYSYDRVFGFES  72

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T+ VYEE AKEV L V+ G NSS+FAYGQTSSGKTYTM+GITE+A+ DIYD+I+KH ER
Sbjct  73   PTKHVYEEGAKEVVLCVLTGINSSIFAYGQTSSGKTYTMSGITEFAMDDIYDYIEKHKER  132

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++L+ SA+EIYNE+VRDLLS D TPLRLLDDPERGTVV
Sbjct  133  EFILRFSAIEIYNEAVRDLLSGDNTPLRLLDDPERGTVV  171



>ref|XP_006661465.1| PREDICTED: kinesin-like protein NACK2-like [Oryza brachyantha]
Length=881

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRP+N +E  R D SDW C   TT+++R    +  ER+M+P+ Y +DRVF+ +C
Sbjct  25   ILVSVRLRPVNAREAERGDGSDWECSGPTTLMFRG---TVPERTMFPAAYSYDRVFSHEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+E A++VALSV++G N+S+FAYGQTSSGKTYTM GITEY++SDIY +I KH ER
Sbjct  82   STRQVYDEGARQVALSVLSGINASIFAYGQTSSGKTYTMVGITEYSMSDIYSYIDKHPER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            DY+LK SAMEIYNE+VRDLLS D TPLRLLDDPE+GTVV
Sbjct  142  DYILKFSAMEIYNEAVRDLLSPDATPLRLLDDPEKGTVV  180



>gb|EYU40392.1| hypothetical protein MIMGU_mgv1a001117mg [Erythranthe guttata]
Length=884

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI RN+V+DW C+N TTI+YRN   S  ERS  P+ Y FDRVF  D 
Sbjct  26   ILVLVRLRPLSEKEIARNEVADWECINSTTILYRN---SLQERSGLPTAYSFDRVFRGDS  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY+E  KE+ALSVV+G NS+VFAYGQTSSGKTYTM GITEY ++DIY+++Q+H ER
Sbjct  83   QTREVYDEGIKEIALSVVDGVNSTVFAYGQTSSGKTYTMNGITEYTVTDIYEYVQRHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SAMEIYNE VRDLLS++ TPLR+LDDPERGT++
Sbjct  143  AFVMKFSAMEIYNEVVRDLLSTENTPLRMLDDPERGTII  181



>gb|KJB32589.1| hypothetical protein B456_005G248400 [Gossypium raimondii]
 gb|KJB32590.1| hypothetical protein B456_005G248400 [Gossypium raimondii]
 gb|KJB32591.1| hypothetical protein B456_005G248400 [Gossypium raimondii]
 gb|KJB32592.1| hypothetical protein B456_005G248400 [Gossypium raimondii]
Length=909

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ +EI+ N+V+DW C+N +TI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  28   ILVLVRLRPLSDQEIVANEVADWECINDSTILYRN---TLREGSTFPSAYTFDRVFRGDC  84

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AKE+ALSVVNG NSS+FAYGQTSSGKTYTM GITEY ++DI+D+I +H ER
Sbjct  85   STKQVYEEGAKEIALSVVNGINSSIFAYGQTSSGKTYTMNGITEYTVADIFDYINRHEER  144

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLL+SD T LRL DDPERGT+V
Sbjct  145  AFVLKFSAIEIYNEAIRDLLTSDNTQLRLRDDPERGTIV  183



>ref|XP_010672217.1| PREDICTED: kinesin-like protein NACK2 [Beta vulgaris subsp. vulgaris]
Length=1052

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KEI  ND  DW  +N TTI+++N      ERSMYP+ Y FDRVF  D 
Sbjct  25   ICVSVRLRPLNDKEIQGNDFVDWESINNTTILFKNC---LGERSMYPNAYNFDRVFGDDD  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TRKVY+EAAKE+ALSV+NG NSSVFAYGQTSSGKT+TM+G+T+YA++DIYD+I++  ER
Sbjct  82   PTRKVYDEAAKEIALSVLNGINSSVFAYGQTSSGKTFTMSGVTQYAVADIYDYIEQQKER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SA+EIYNE VRDLLS+D  PLRLLDDPERGTVV
Sbjct  142  EFVLKFSAIEIYNELVRDLLSADTNPLRLLDDPERGTVV  180



>ref|XP_008448048.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448049.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448050.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
Length=930

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI+ N+ +DW C+N T+I+YRN   +  E S +PS Y FDRVF  DC
Sbjct  24   ILVLVRLRPLNEKEIMMNEAADWECINDTSILYRN---TLREGSTFPSAYTFDRVFRGDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE A+E+A SVV+G NSS+FAYGQTSSGKTYTM GI EY+++DI+D+I++H ER
Sbjct  81   STRQVYEEGAREIAFSVVSGINSSIFAYGQTSSGKTYTMNGILEYSVADIFDYIRRHEER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +++K SA+EIYNE+VRDLLS+D +PLRLLDD ERGT+V
Sbjct  141  AFIVKFSAIEIYNEAVRDLLSTDTSPLRLLDDQERGTIV  179



>ref|XP_008221318.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=1069

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 131/159 (82%), Gaps = 4/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  +NDVSDW CV   T++Y N   S  +R M PS Y FDRVF  +C
Sbjct  13   ILVSVRLRPLNQKEKTKNDVSDW-CVKNNTVMYNN---SHPDRPMSPSAYSFDRVFGWEC  68

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TRKVY+E AKEV LS +NG NS++FAYGQTSSGKTYTM GIT+YAI+DIYD+I++H+++
Sbjct  69   PTRKVYDEGAKEVVLSAINGINSTIFAYGQTSSGKTYTMKGITDYAITDIYDYIEQHSDK  128

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+V+DLLSSD  PLRLLDDPE+GTV+
Sbjct  129  EFVLKFSAMEIYNEAVKDLLSSDSGPLRLLDDPEKGTVI  167



>ref|XP_011088489.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088490.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088491.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088492.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=909

 Score =   231 bits (589),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI + +V+DW C+N TTI+YRN   S  E S  P+ Y FDRVF  DC
Sbjct  26   ILVLVRLRPLSEKEIAQPEVADWECINSTTILYRN---SLQECSGLPTAYSFDRVFRGDC  82

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEE  K++ALSVV G NS++FAYGQTSSGKTYTM GITEYA++DIYD+IQ+H ER
Sbjct  83   TTREVYEEGTKDIALSVVGGVNSTIFAYGQTSSGKTYTMNGITEYAVADIYDYIQRHEER  142

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA EIYNE VRDLLS+D TPLRLLDDPERGT++
Sbjct  143  AFVLKFSATEIYNEVVRDLLSTDNTPLRLLDDPERGTII  181



>ref|NP_001063734.2| Os09g0528000 [Oryza sativa Japonica Group]
 dbj|BAD46370.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAG93071.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF25648.2| Os09g0528000 [Oryza sativa Japonica Group]
Length=862

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRP+N +E  R D SDW C   TT+ +R    +  ER+M+P+ Y +DRVF+ +C
Sbjct  10   IVVSVRLRPVNAREAERGDGSDWECAGPTTLTFRG---AVPERAMFPASYSYDRVFSHEC  66

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY+E A++VA+SV++G N+S+FAYGQTSSGKTYTM GITEY++SDIYD+I+KH ER
Sbjct  67   GTRQVYDEGARQVAMSVLSGINASIFAYGQTSSGKTYTMVGITEYSMSDIYDYIEKHPER  126

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNE+VRDLLSSD TPLRLLDDPE+GTVV
Sbjct  127  EFILKFSAMEIYNEAVRDLLSSDATPLRLLDDPEKGTVV  165



>gb|EPS66111.1| hypothetical protein M569_08665, partial [Genlisea aurea]
Length=856

 Score =   230 bits (587),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V++RLRPLN +E+ +NDVS+W C+N TT+V+ N   S  ERS+ P+ Y FDRVF  + 
Sbjct  5    IFVAIRLRPLNERELSKNDVSEWDCINDTTVVFNN---SLQERSLLPAAYTFDRVFGFES  61

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY EAAK++ALS ++G NS++FAYGQTSSGKTYTMTG+TEYA++DIYD+I KH ER
Sbjct  62   PTRQVYNEAAKKIALSAISGINSTIFAYGQTSSGKTYTMTGVTEYAVADIYDYISKHDER  121

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             ++LK +A+EIYNESVRDLLS D T LRLLDDPERGTV+
Sbjct  122  KFILKFAAIEIYNESVRDLLSPDATSLRLLDDPERGTVI  160



>ref|XP_004958729.1| PREDICTED: kinesin-like protein NACK1-like [Setaria italica]
Length=913

 Score =   231 bits (588),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRP+N +E  R D SDW C   TT+++R    +  ER+M+P+ Y +DRVFN +C
Sbjct  7    ILVSVRLRPVNAREAERGDGSDWECAGPTTLMFRG---NIPERAMFPATYTYDRVFNPEC  63

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEE AK+VALSV++G NSS+FAYGQTSSGKTYTM GITE+++SDIYD+I KH ER
Sbjct  64   NTRQVYEEGAKQVALSVLSGINSSIFAYGQTSSGKTYTMVGITEHSMSDIYDYIDKHKER  123

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE VRDLLS D T LRLLDDPE+GTVV
Sbjct  124  EFVLKFSAMEIYNEGVRDLLSPDATQLRLLDDPEKGTVV  162



>ref|XP_009389113.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389114.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=947

 Score =   231 bits (588),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPL+ KE+  ND SDW C+N TT+++R   L   ERS+ P+ Y FD+VF SDC
Sbjct  34   IVVSVRLRPLSEKEVAENDPSDWECINDTTVIFRESLL---ERSINPTAYTFDKVFPSDC  90

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +T++VYEE AKEVALSVV G NS+VFAYGQT SGKTYTMTGITEY   DIY++I KH ER
Sbjct  91   TTKQVYEEGAKEVALSVVTGINSTVFAYGQTCSGKTYTMTGITEYTAQDIYEYIHKHEER  150

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE+V+DLLS+D  PLRLLDDPE+GTV+
Sbjct  151  AFVLKFSAIEIYNEAVKDLLSTDSAPLRLLDDPEKGTVI  189



>gb|EEE70089.1| hypothetical protein OsJ_30085 [Oryza sativa Japonica Group]
Length=870

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRP+N +E  R D SDW C   TT+ +R    +  ER+M+P+ Y +DRVF+ +C
Sbjct  10   IVVSVRLRPVNAREAERGDGSDWECAGPTTLTFRG---AVPERAMFPASYSYDRVFSHEC  66

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY+E A++VA+SV++G N+S+FAYGQTSSGKTYTM GITEY++SDIYD+I+KH ER
Sbjct  67   GTRQVYDEGARQVAMSVLSGINASIFAYGQTSSGKTYTMVGITEYSMSDIYDYIEKHPER  126

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNE+VRDLLSSD TPLRLLDDPE+GTVV
Sbjct  127  EFILKFSAMEIYNEAVRDLLSSDATPLRLLDDPEKGTVV  165



>ref|XP_008236841.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
 ref|XP_008236842.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
Length=926

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KE+  N+V+DW C+N T+I+YRN   +  E S +P+ Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEVASNEVADWECINDTSILYRN---TLREGSTFPTAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE A+++ALSVVNG NSS+FAYGQTSSGKTYTM GITE+ +++I+D+I +H ER
Sbjct  82   STRQVYEEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMDGITEFTVAEIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE+VRDLLSSD  PLRLLDDPERGT++
Sbjct  142  AFVVKFSAIEIYNEAVRDLLSSDNIPLRLLDDPERGTII  180



>gb|KCW53111.1| hypothetical protein EUGRSUZ_J02403 [Eucalyptus grandis]
Length=875

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +1

Query  190  NDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDCSTRKVYEEAAKEVALSV  369
            NDVSDW C++  TI Y N +LS SERSMYP+ Y FDRVF  DCSTR+VYEE AK+VALSV
Sbjct  13   NDVSDWECIDDNTIFYIN-NLSVSERSMYPAAYTFDRVFRCDCSTRQVYEEGAKKVALSV  71

Query  370  VNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTERDYVLKLSAMEIYNESVR  549
            V+G NSSVFAYGQTSSGKTYTM+GITEY+++DIY +I+KH ER+++LK SAMEIYNESVR
Sbjct  72   VSGINSSVFAYGQTSSGKTYTMSGITEYSMADIYSYIEKHKEREFLLKFSAMEIYNESVR  131

Query  550  DLLSSDVTPLRLLDDPERGTVV  615
            DLLS+D TPLRLLDDPERGTVV
Sbjct  132  DLLSADSTPLRLLDDPERGTVV  153



>ref|XP_009336756.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=1068

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 129/159 (81%), Gaps = 4/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  +NDVSDW CV   TI+Y N   S  +R M PS Y FDRVF  DC
Sbjct  7    ILVSVRLRPLNDKEKAKNDVSDW-CVKNNTIMYNN---SHPDRPMSPSAYGFDRVFGWDC  62

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T KVY E AKEV LSV+NG NS++FAYGQTSSGKTYTM GIT+YA++DIYD+I+KH++R
Sbjct  63   PTTKVYNEGAKEVVLSVINGINSTIFAYGQTSSGKTYTMKGITDYAVADIYDYIEKHSDR  122

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLSSD   LRLLDDPE+GTVV
Sbjct  123  EFVLKFSAMEIYNEAVRDLLSSDSAHLRLLDDPEKGTVV  161



>gb|EMT22069.1| Kinesin-related protein 4 [Aegilops tauschii]
Length=1013

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 134/159 (84%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVR+RPLN +E    D SDW C++ TT+++R+   +  +R+M+P+ Y +DRVF  +C
Sbjct  22   IMVSVRMRPLNGRE--SGDSSDWECISPTTVMFRS---TVPDRAMFPTAYTYDRVFGPNC  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVVNG NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I+KH ER
Sbjct  77   STRQVYEEGAKEVALSVVNGINSSIFAYGQTSSGKTYTMTGITEYSVMDIYDYIEKHPER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  137  EFMLKFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  175



>ref|XP_010526582.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=732

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI  N+V+DW C+N TTI+YRN   +  E S +PS Y FDRV+  DC
Sbjct  25   ILVLVRLRPLNEKEIAANEVADWECINDTTILYRN---TLREGSTFPSAYTFDRVYRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEE  KE+ALSVV G NSS+FAYGQTSSGKTYTM GITE+A+ DI+D+I KH +R
Sbjct  82   MTRQVYEEGTKEIALSVVEGINSSIFAYGQTSSGKTYTMNGITEFAVGDIFDYIHKHEKR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             + +K SA+EIYNE +RDLLSSD TPLRL DDPE+GT+V
Sbjct  142  AFAVKFSAIEIYNEVIRDLLSSDNTPLRLRDDPEKGTIV  180



>gb|KDO49885.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=758

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  ++ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEITADEATDWECINDTTILYRN---TLREGSTFPSAYTFDRVFWGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST +VYE+ AKE+ALSVV+G NSS+FAYGQTSSGKTYTMTGITE  ++DI+D+I +H ER
Sbjct  82   STTQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITECTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE++RDLLS+D TPLRLLDDPE+G VV
Sbjct  142  AFVLKFSAMEIYNEAIRDLLSTDNTPLRLLDDPEKGVVV  180



>ref|XP_011047311.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047320.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047328.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
Length=983

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEIL N+V+DW C+N TTI+YRN   +  E S +PS Y FDRVF  D 
Sbjct  25   ILVLVRLRPLSDKEILANEVADWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDN  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEE  KE ALSVV+G NSS+FAYGQTSSGKTYTM GITEY ++DI+D+I +H ER
Sbjct  82   ATREVYEEGVKEAALSVVSGINSSIFAYGQTSSGKTYTMMGITEYTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLS+D TPLRLLDDPE+GTVV
Sbjct  142  VFVLKFSAIEIYNEAIRDLLSTDSTPLRLLDDPEKGTVV  180



>gb|AAD23678.1| putative kinesin heavy chain [Arabidopsis thaliana]
Length=581

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   ILVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTM+GITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMSGITEFAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G  V
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAAV  180



>ref|XP_011047336.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Populus euphratica]
Length=976

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEIL N+V+DW C+N TTI+YRN   +  E S +PS Y FDRVF  D 
Sbjct  25   ILVLVRLRPLSDKEILANEVADWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDN  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYEE  KE ALSVV+G NSS+FAYGQTSSGKTYTM GITEY ++DI+D+I +H ER
Sbjct  82   ATREVYEEGVKEAALSVVSGINSSIFAYGQTSSGKTYTMMGITEYTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLS+D TPLRLLDDPE+GTVV
Sbjct  142  VFVLKFSAIEIYNEAIRDLLSTDSTPLRLLDDPEKGTVV  180



>ref|XP_010526578.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526579.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526580.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526581.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=840

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI  N+V+DW C+N TTI+YRN   +  E S +PS Y FDRV+  DC
Sbjct  25   ILVLVRLRPLNEKEIAANEVADWECINDTTILYRN---TLREGSTFPSAYTFDRVYRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEE  KE+ALSVV G NSS+FAYGQTSSGKTYTM GITE+A+ DI+D+I KH +R
Sbjct  82   MTRQVYEEGTKEIALSVVEGINSSIFAYGQTSSGKTYTMNGITEFAVGDIFDYIHKHEKR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             + +K SA+EIYNE +RDLLSSD TPLRL DDPE+GT+V
Sbjct  142  AFAVKFSAIEIYNEVIRDLLSSDNTPLRLRDDPEKGTIV  180



>ref|XP_004148539.1| PREDICTED: kinesin-like protein KIN12B-like [Cucumis sativus]
 ref|XP_004167100.1| PREDICTED: kinesin-like protein KIN12B-like [Cucumis sativus]
Length=930

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI+ N+ +DW C+N T+I+YRN   +  E S +PS Y FDRVF  DC
Sbjct  24   ILVLVRLRPLNEKEIMMNEAADWECINGTSILYRN---TLREGSTFPSAYTFDRVFRGDC  80

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE A+E+A SVV+G NSS+FAYGQTSSGKTYTM GI EY+++DI+D+I++H ER
Sbjct  81   STKQVYEEGAREIAFSVVSGINSSIFAYGQTSSGKTYTMNGILEYSVADIFDYIRRHEER  140

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +++K SA+EIYNE+VRDLLS+D +PLRLLDD ERGT+V
Sbjct  141  AFIVKFSAIEIYNEAVRDLLSTDTSPLRLLDDQERGTIV  179



>ref|XP_009378441.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378442.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378443.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378444.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KE+  N+V+DW C+N TTI+YRN   +  E S +P+ Y FD+VF  DC
Sbjct  25   ILVLVRLRPLSEKEVAANEVADWECINDTTILYRN---TLREGSTFPTAYTFDKVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+E A+++ALSVVNG NSS+FAYGQTSSGKTYTM GITE+ +++I+D+I  H ER
Sbjct  82   STRQVYDEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMNGITEFTVAEIFDYIHAHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE+VRDLLS+D TPLRLLDDPERGT++
Sbjct  142  AFVVKFSAIEIYNEAVRDLLSTDNTPLRLLDDPERGTII  180



>ref|XP_008382370.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Malus 
domestica]
Length=929

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KE+  N+V+DW C+N TTI+YRN   +  E S +P+ Y FD+VF  DC
Sbjct  25   ILVLVRLRPLSEKEVAANEVADWECINDTTILYRN---TLREGSTFPTAYTFDKVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+E A+++ALSVVNG NSS+FAYGQTSSGKTYTM GITE+ +++I+D+I  H ER
Sbjct  82   STRQVYDEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMNGITEFTVAEIFDYIHAHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE+VRDLLS+D TPLRLLDDPERGT++
Sbjct  142  AFVVKFSAIEIYNEAVRDLLSTDNTPLRLLDDPERGTII  180



>ref|XP_004974129.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Setaria 
italica]
 ref|XP_004974130.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Setaria 
italica]
Length=1028

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D SDW C++ TTI++R+   +  ER+M+P+ Y +DRVF   C
Sbjct  17   IMVSVRLRPLNGREA--GDSSDWECISPTTIMFRS---TVPERAMFPTAYTYDRVFGPSC  71

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I KH ER
Sbjct  72   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSMLDIYDYIDKHPER  131

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  132  EFILKFSAIEIYNEAVRDLLSHDSTPLRLLDDPEKGTTV  170



>ref|XP_004974127.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
Length=1045

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D SDW C++ TTI++R+   +  ER+M+P+ Y +DRVF   C
Sbjct  34   IMVSVRLRPLNGREA--GDSSDWECISPTTIMFRS---TVPERAMFPTAYTYDRVFGPSC  88

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I KH ER
Sbjct  89   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSMLDIYDYIDKHPER  148

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  149  EFILKFSAIEIYNEAVRDLLSHDSTPLRLLDDPEKGTTV  187



>ref|XP_008388149.1| PREDICTED: kinesin-like protein NACK2 [Malus domestica]
Length=1054

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  +NDVSDW CV   T++Y N   S  +R M PS Y FDRVF  DC
Sbjct  7    ILVSVRLRPLNDKEKAKNDVSDW-CVKNNTVMYNN---SHPDRPMSPSAYGFDRVFGWDC  62

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T KVY+E AKEV LSV+NG NS++FAYGQTSSGKTYTM GIT+YA++DIYD+I+KH++R
Sbjct  63   PTTKVYDEGAKEVVLSVINGINSTIFAYGQTSSGKTYTMKGITDYAVADIYDYIEKHSDR  122

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLSS+   LRLLDDPE+GTVV
Sbjct  123  EFVLKFSAMEIYNEAVRDLLSSEGAQLRLLDDPEKGTVV  161



>ref|XP_004974128.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=1044

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D SDW C++ TTI++R+   +  ER+M+P+ Y +DRVF   C
Sbjct  34   IMVSVRLRPLNGREA--GDSSDWECISPTTIMFRS---TVPERAMFPTAYTYDRVFGPSC  88

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I KH ER
Sbjct  89   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSMLDIYDYIDKHPER  148

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  149  EFILKFSAIEIYNEAVRDLLSHDSTPLRLLDDPEKGTTV  187



>ref|XP_006404570.1| hypothetical protein EUTSA_v10000043mg [Eutrema salsugineum]
 gb|ESQ46023.1| hypothetical protein EUTSA_v10000043mg [Eutrema salsugineum]
Length=862

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   ILVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTMTGITEYA++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMTGITEYAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>gb|EPS66399.1| hypothetical protein M569_08373, partial [Genlisea aurea]
Length=430

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KE L+N+V+DW C+N TTI+YRN   S  ERS  P+ Y FDRVF  D 
Sbjct  27   ILVLVRLRPLSEKETLQNEVADWECINATTILYRN---SIQERSGLPTAYSFDRVFRGDN  83

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR VY+E  +++ALSVV G NS++FAYGQTSSGKTYTM GITEY   D+YD+I+KH ER
Sbjct  84   TTRDVYDEGIRDIALSVVGGINSTIFAYGQTSSGKTYTMNGITEYTAVDVYDYIKKHEER  143

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SA+EIYNE VRDLL++D T LRLLDDPE+GT++
Sbjct  144  EFVLKFSAVEIYNEVVRDLLATDGTSLRLLDDPEKGTII  182



>gb|KDO49879.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49880.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49881.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49882.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=960

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  ++ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEITADEATDWECINDTTILYRN---TLREGSTFPSAYTFDRVFWGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST +VYE+ AKE+ALSVV+G NSS+FAYGQTSSGKTYTMTGITE  ++DI+D+I +H ER
Sbjct  82   STTQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITECTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE++RDLLS+D TPLRLLDDPE+G VV
Sbjct  142  AFVLKFSAMEIYNEAIRDLLSTDNTPLRLLDDPEKGVVV  180



>ref|XP_006487377.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487378.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487379.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487380.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Citrus 
sinensis]
 ref|XP_006487381.1| PREDICTED: kinesin-like protein NACK1-like isoform X5 [Citrus 
sinensis]
 ref|XP_006487382.1| PREDICTED: kinesin-like protein NACK1-like isoform X6 [Citrus 
sinensis]
 ref|XP_006487383.1| PREDICTED: kinesin-like protein NACK1-like isoform X7 [Citrus 
sinensis]
 ref|XP_006487384.1| PREDICTED: kinesin-like protein NACK1-like isoform X8 [Citrus 
sinensis]
Length=962

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  ++ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEITADEATDWECINDTTILYRN---TLREGSTFPSAYTFDRVFWGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST +VYE+ AKE+ALSVV+G NSS+FAYGQTSSGKTYTMTGITE  ++DI+D+I +H ER
Sbjct  82   STTQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITECTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE++RDLLS+D TPLRLLDDPE+G VV
Sbjct  142  AFVLKFSAMEIYNEAIRDLLSTDNTPLRLLDDPEKGVVV  180



>ref|XP_006487385.1| PREDICTED: kinesin-like protein NACK1-like isoform X9 [Citrus 
sinensis]
Length=960

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  ++ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEITADEATDWECINDTTILYRN---TLREGSTFPSAYTFDRVFWGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST +VYE+ AKE+ALSVV+G NSS+FAYGQTSSGKTYTMTGITE  ++DI+D+I +H ER
Sbjct  82   STTQVYEDGAKEIALSVVSGINSSIFAYGQTSSGKTYTMTGITECTVADIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SAMEIYNE++RDLLS+D TPLRLLDDPE+G VV
Sbjct  142  AFVLKFSAMEIYNEAIRDLLSTDNTPLRLLDDPEKGVVV  180



>gb|KGN43176.1| hypothetical protein Csa_7G006260 [Cucumis sativus]
Length=1027

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI+ N+ +DW C+N T+I+YRN   +  E S +PS Y FDRVF  DC
Sbjct  214  ILVLVRLRPLNEKEIMMNEAADWECINGTSILYRN---TLREGSTFPSAYTFDRVFRGDC  270

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE A+E+A SVV+G NSS+FAYGQTSSGKTYTM GI EY+++DI+D+I++H ER
Sbjct  271  STKQVYEEGAREIAFSVVSGINSSIFAYGQTSSGKTYTMNGILEYSVADIFDYIRRHEER  330

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +++K SA+EIYNE+VRDLLS+D +PLRLLDD ERGT+V
Sbjct  331  AFIVKFSAIEIYNEAVRDLLSTDTSPLRLLDDQERGTIV  369



>ref|XP_009117419.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
 ref|XP_009117420.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=862

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+V VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   IMVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYTFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTMTGITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMTGITEFAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>ref|XP_009336747.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=1073

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  +NDVSDW CV   T++Y N   S  +R M PS Y FDRVF  DC
Sbjct  7    ILVSVRLRPLNDKEKAKNDVSDW-CVKDNTVMYNN---SHPDRPMSPSAYGFDRVFGWDC  62

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T KVY+E AKEVALSV+NG NS++FAYGQTSSGKT TM GIT+YA++DIYD+I+KH++R
Sbjct  63   PTTKVYDEGAKEVALSVINGINSTIFAYGQTSSGKTCTMKGITDYAVADIYDYIEKHSDR  122

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLSS+   LRLLDDPE+GTVV
Sbjct  123  EFVLKFSAMEIYNEAVRDLLSSESAQLRLLDDPEKGTVV  161



>emb|CDY13822.1| BnaA09g43240D [Brassica napus]
Length=862

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+V VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   IMVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYTFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTMTGITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMTGITEFAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>ref|XP_008388151.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=1104

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  +NDVSDW CV   T++Y N   S  +R M PS Y FDRVF  DC
Sbjct  7    ILVSVRLRPLNDKEKAKNDVSDW-CVKDNTVMYNN---SHPDRPMSPSAYGFDRVFGWDC  62

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T KVY+E AKEVALSV+NG NS++FAYGQTSSGKTYTM GIT+ A++DIYD+I+KH++R
Sbjct  63   PTTKVYDEGAKEVALSVINGINSTIFAYGQTSSGKTYTMKGITDNAVADIYDYIEKHSDR  122

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLSS+   LRLLDDPE+GTVV
Sbjct  123  EFVLKFSAMEIYNEAVRDLLSSESAQLRLLDDPEKGTVV  161



>gb|KHG01762.1| Kinesin-related 11 [Gossypium arboreum]
Length=909

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ +EI+ N+V+DW C+N +TI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  28   ILVLVRLRPLSDQEIVANEVADWECINDSTILYRN---TLREGSTFPSAYTFDRVFRGDC  84

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYE+ AKE+ALSVVNG NSS+FAYGQTSSGKTYTM GITEY ++DI+D+I +H ER
Sbjct  85   STKQVYEKGAKEIALSVVNGLNSSIFAYGQTSSGKTYTMNGITEYTVADIFDYINRHEER  144

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLL+S  T LRL DDPERGT+V
Sbjct  145  AFVLKFSAIEIYNEAIRDLLTSGNTQLRLRDDPERGTIV  183



>ref|XP_010091188.1| Kinesin-related protein 11 [Morus notabilis]
 gb|EXB43288.1| Kinesin-related protein 11 [Morus notabilis]
Length=940

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  N+V+DW C+N TTI+YRN   +  E S +P+ Y FD VF  DC
Sbjct  25   ILVLVRLRPLSEKEIESNEVADWECINDTTILYRN---TLREGSTFPNAYTFDTVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE  +E+ALSVV+G NSS+FAYGQTSSGKTYTM GITEY +++I+D+I +H ER
Sbjct  82   STRQVYEEGTREIALSVVSGINSSIFAYGQTSSGKTYTMNGITEYTVAEIFDYIHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE+VRDLLS+D TPLRLLDDP+RGT+V
Sbjct  142  AFVVKFSAIEIYNEAVRDLLSTDNTPLRLLDDPDRGTIV  180



>gb|KHG01461.1| Kinesin-related 11 [Gossypium arboreum]
Length=953

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 135/159 (85%), Gaps = 4/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI+R+DVSDW C+N  TI+YR+  LS SERSMYP+ Y FD VF SDC
Sbjct  21   IFVSVRLRPLSEKEIVRHDVSDWECINDNTIIYRS-KLSVSERSMYPTAYTFDNVFGSDC  79

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
              R+VYE  AKEV LSVV+   +SVFAYGQTSSGKTYTMTGITEYA++DIYD+IQ+H ER
Sbjct  80   PNRQVYETGAKEVVLSVVS---ASVFAYGQTSSGKTYTMTGITEYAMADIYDYIQRHKER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SA+EIYNESVRDLLS+D TPLRLLDDPERG VV
Sbjct  137  EFVLKFSAIEIYNESVRDLLSADSTPLRLLDDPERGIVV  175



>ref|XP_010547436.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=1008

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI RN+VSDW C+N   I+ R+  LS S+    P  Y+FDRVF  +C
Sbjct  21   IFVSVRLRPLSEKEIARNEVSDWECINGVRIIDRS-HLSISD----PPAYIFDRVFGPEC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVALSVV+G N S+FAYGQTSSGKTYTMTGIT+Y ++DIYD+I+KH ER
Sbjct  76   CTRQVYEQGAKEVALSVVSGVNVSIFAYGQTSSGKTYTMTGITDYTMADIYDYIEKHKER  135

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRL DDPE+GTVV
Sbjct  136  EFILKFSAMEIYNESVRDLLSTDSTPLRLRDDPEKGTVV  174



>ref|XP_010547438.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Tarenaya hassleriana]
Length=1007

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI RN+VSDW C+N   I+ R+  LS S+    P  Y+FDRVF  +C
Sbjct  21   IFVSVRLRPLSEKEIARNEVSDWECINGVRIIDRS-HLSISD----PPAYIFDRVFGPEC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVALSVV+G N S+FAYGQTSSGKTYTMTGIT+Y ++DIYD+I+KH ER
Sbjct  76   CTRQVYEQGAKEVALSVVSGVNVSIFAYGQTSSGKTYTMTGITDYTMADIYDYIEKHKER  135

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRL DDPE+GTVV
Sbjct  136  EFILKFSAMEIYNESVRDLLSTDSTPLRLRDDPEKGTVV  174



>ref|XP_010547437.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=1007

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI RN+VSDW C+N   I+ R+  LS S+    P  Y+FDRVF  +C
Sbjct  21   IFVSVRLRPLSEKEIARNEVSDWECINGVRIIDRS-HLSISD----PPAYIFDRVFGPEC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVALSVV+G N S+FAYGQTSSGKTYTMTGIT+Y ++DIYD+I+KH ER
Sbjct  76   CTRQVYEQGAKEVALSVVSGVNVSIFAYGQTSSGKTYTMTGITDYTMADIYDYIEKHKER  135

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRL DDPE+GTVV
Sbjct  136  EFILKFSAMEIYNESVRDLLSTDSTPLRLRDDPEKGTVV  174



>gb|ADQ43205.1| kinesin motor family protein [Schrenkiella parvula]
Length=984

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPLN KE LR +V DW C+N TTI+YR+  LS S+RSMYPS Y F RVF  +C
Sbjct  18   IYVSVRLRPLNDKERLRTEVPDWECINDTTIIYRS-HLSISDRSMYPSAYSF-RVFGPEC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ A+EVA SVV+G NS VFAYGQTSSGKTYTM+GIT+  + DIYD+I KH ER
Sbjct  76   CTRQVYEQGAREVAFSVVSGVNS-VFAYGQTSSGKTYTMSGITDCTLVDIYDYIDKHKER  134

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D +PLRLLDDPE+GTVV
Sbjct  135  EFILKFSAMEIYNESVRDLLSTDSSPLRLLDDPEKGTVV  173



>ref|XP_010235379.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Brachypodium 
distachyon]
Length=1003

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 128/159 (81%), Gaps = 11/159 (7%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D SDW CV+ TT+++R         S  P+ Y +DRVF  DC
Sbjct  20   IMVSVRLRPLNGREA--GDCSDWECVSPTTVMFR---------STVPTAYTYDRVFGPDC  68

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYDHI+KH ER
Sbjct  69   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSVMDIYDHIEKHPER  128

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  129  EFILKFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  167



>ref|XP_010235378.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235380.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Brachypodium 
distachyon]
Length=1004

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 128/159 (81%), Gaps = 11/159 (7%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D SDW CV+ TT+++R         S  P+ Y +DRVF  DC
Sbjct  20   IMVSVRLRPLNGREA--GDCSDWECVSPTTVMFR---------STVPTAYTYDRVFGPDC  68

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYDHI+KH ER
Sbjct  69   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSVMDIYDHIEKHPER  128

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  129  EFILKFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  167



>ref|XP_008668212.1| PREDICTED: uncharacterized protein LOC100304245 isoform X2 [Zea 
mays]
Length=873

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRP+N +E  R D SDW C + TT+++R    +  ER+M+P+ Y +DRVFN  C
Sbjct  7    ILVSVRLRPVNAREAERGDGSDWECTSTTTLMFRG---NIPERAMFPASYTYDRVFNPKC  63

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK+VALSV++G NSS+FAYGQTSSGKTYTM GITE ++SDIYD+I KH ER
Sbjct  64   STRQVYEEGAKQVALSVLSGINSSIFAYGQTSSGKTYTMVGITERSMSDIYDYIDKHPER  123

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLL  D T LRLLDDPE+GTVV
Sbjct  124  EFVLKFSAMEIYNEAVRDLLRPDATQLRLLDDPEKGTVV  162



>ref|XP_008668211.1| PREDICTED: uncharacterized protein LOC100304245 isoform X1 [Zea 
mays]
Length=874

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRP+N +E  R D SDW C + TT+++R    +  ER+M+P+ Y +DRVFN  C
Sbjct  7    ILVSVRLRPVNAREAERGDGSDWECTSTTTLMFRG---NIPERAMFPASYTYDRVFNPKC  63

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK+VALSV++G NSS+FAYGQTSSGKTYTM GITE ++SDIYD+I KH ER
Sbjct  64   STRQVYEEGAKQVALSVLSGINSSIFAYGQTSSGKTYTMVGITERSMSDIYDYIDKHPER  123

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLL  D T LRLLDDPE+GTVV
Sbjct  124  EFVLKFSAMEIYNEAVRDLLRPDATQLRLLDDPEKGTVV  162



>ref|XP_010547439.1| PREDICTED: kinesin-like protein NACK2 isoform X4 [Tarenaya hassleriana]
Length=1005

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI RN+VSDW C+N   I+ R+  LS S+    P  Y+FDRVF  +C
Sbjct  21   IFVSVRLRPLSEKEIARNEVSDWECINGVRIIDRS-HLSISD----PPAYIFDRVFGPEC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVALSVV+G N S+FAYGQTSSGKTYTMTGIT+Y ++DIYD+I+KH ER
Sbjct  76   CTRQVYEQGAKEVALSVVSGVNVSIFAYGQTSSGKTYTMTGITDYTMADIYDYIEKHKER  135

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRL DDPE+GTVV
Sbjct  136  EFILKFSAMEIYNESVRDLLSTDSTPLRLRDDPEKGTVV  174



>ref|XP_010547440.1| PREDICTED: kinesin-like protein NACK2 isoform X5 [Tarenaya hassleriana]
Length=990

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI RN+VSDW C+N   I+ R+  LS S+    P  Y+FDRVF  +C
Sbjct  21   IFVSVRLRPLSEKEIARNEVSDWECINGVRIIDRS-HLSISD----PPAYIFDRVFGPEC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVALSVV+G N S+FAYGQTSSGKTYTMTGIT+Y ++DIYD+I+KH ER
Sbjct  76   CTRQVYEQGAKEVALSVVSGVNVSIFAYGQTSSGKTYTMTGITDYTMADIYDYIEKHKER  135

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRL DDPE+GTVV
Sbjct  136  EFILKFSAMEIYNESVRDLLSTDSTPLRLRDDPEKGTVV  174



>ref|XP_010531480.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531481.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531482.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=830

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI  N+V+DW C+N TTI+YRN   +  E S +PS Y FDRV+  DC
Sbjct  25   ILVLVRLRPLNEKEIAANEVADWECINDTTIIYRN---TLREGSTFPSAYTFDRVYRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +T +VY   AKE+ALSVV G NSS+FAYGQTSSGKTYTMTGITE A+ DI+D+I KH ER
Sbjct  82   TTGQVYGGGAKEIALSVVEGINSSIFAYGQTSSGKTYTMTGITESAVCDIFDYIHKHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K  A+EIYNE++RDLLSSD TPLRL DDPE+GT+V
Sbjct  142  AFVVKFFAIEIYNEAIRDLLSSDGTPLRLRDDPEKGTIV  180



>ref|XP_010547442.1| PREDICTED: kinesin-like protein NACK2 isoform X7 [Tarenaya hassleriana]
Length=962

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI RN+VSDW C+N   I+ R+  LS S+    P  Y+FDRVF  +C
Sbjct  21   IFVSVRLRPLSEKEIARNEVSDWECINGVRIIDRS-HLSISD----PPAYIFDRVFGPEC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVALSVV+G N S+FAYGQTSSGKTYTMTGIT+Y ++DIYD+I+KH ER
Sbjct  76   CTRQVYEQGAKEVALSVVSGVNVSIFAYGQTSSGKTYTMTGITDYTMADIYDYIEKHKER  135

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRL DDPE+GTVV
Sbjct  136  EFILKFSAMEIYNESVRDLLSTDSTPLRLRDDPEKGTVV  174



>gb|EYU19439.1| hypothetical protein MIMGU_mgv1a021560mg, partial [Erythranthe 
guttata]
Length=209

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 120/153 (78%), Gaps = 11/153 (7%)
 Frame = +1

Query  157  LRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDCSTRKVY  336
            LR LN +EILRNDVSDW C+N  TI+Y+N  LS+SERSMYP+ + F+           VY
Sbjct  1    LRLLNGREILRNDVSDWECINNETIIYKNFALSSSERSMYPASFTFE-----------VY  49

Query  337  EEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTERDYVLKL  516
            E+ AK+V LSV++G NS VFAYGQTS+GKTYTM GITEYA+ DIY +IQKH ERD+V K 
Sbjct  50   EQGAKDVVLSVISGINSRVFAYGQTSNGKTYTMIGITEYALPDIYGYIQKHQERDFVFKF  109

Query  517  SAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            SAMEIYNESVRDLLS D TPLRLLDD E+GTVV
Sbjct  110  SAMEIYNESVRDLLSVDNTPLRLLDDTEKGTVV  142



>ref|XP_010547441.1| PREDICTED: kinesin-like protein NACK2 isoform X6 [Tarenaya hassleriana]
Length=965

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 131/159 (82%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VSVRLRPL+ KEI RN+VSDW C+N   I+ R+  LS S+    P  Y+FDRVF  +C
Sbjct  21   IFVSVRLRPLSEKEIARNEVSDWECINGVRIIDRS-HLSISD----PPAYIFDRVFGPEC  75

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKEVALSVV+G N S+FAYGQTSSGKTYTMTGIT+Y ++DIYD+I+KH ER
Sbjct  76   CTRQVYEQGAKEVALSVVSGVNVSIFAYGQTSSGKTYTMTGITDYTMADIYDYIEKHKER  135

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNESVRDLLS+D TPLRL DDPE+GTVV
Sbjct  136  EFILKFSAMEIYNESVRDLLSTDSTPLRLRDDPEKGTVV  174



>ref|XP_003607070.1| Kinesin-related protein [Medicago truncatula]
 gb|AES89267.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=853

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV +RLRPLN KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLLRLRPLNEKEISANESADWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEE A+E+ALSVV G NSS+FAYGQTSSGKTYTM GITE+A++DI+D+ ++H ER
Sbjct  82   ETRQVYEEGAREIALSVVGGINSSIFAYGQTSSGKTYTMVGITEFAVADIFDYAKRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             + LK SA+EIYNE VRDLLS+D TPLRL DDPERG V+
Sbjct  142  AFALKFSAIEIYNEIVRDLLSTDNTPLRLRDDPERGPVL  180



>ref|XP_006659658.1| PREDICTED: kinesin-like protein NACK2-like [Oryza brachyantha]
Length=998

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D  DW C++ TT+++R+   +  ER+M+P+ Y +DRVF  D 
Sbjct  22   IMVSVRLRPLNGREA--GDSCDWECISPTTVMFRS---TVPERAMFPTAYTYDRVFGPDS  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I+KH ER
Sbjct  77   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSVLDIYDYIEKHPER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++L+ SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  137  EFILRFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  175



>ref|XP_006296345.1| hypothetical protein CARUB_v10025517mg [Capsella rubella]
 gb|EOA29243.1| hypothetical protein CARUB_v10025517mg [Capsella rubella]
Length=862

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   ILVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTM+GITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMSGITEFAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>gb|EEC83991.1| hypothetical protein OsI_30145 [Oryza sativa Indica Group]
Length=969

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D  DW C++ TT+++R+   +  ER+M+P+ Y +DRVF  D 
Sbjct  22   IMVSVRLRPLNGREA--GDSCDWECISPTTVMFRS---TVPERAMFPTAYTYDRVFGPDS  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I+KH ER
Sbjct  77   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSVLDIYDYIEKHPER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++L+ SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  137  EFILRFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  175



>emb|CDX82016.1| BnaC08g35850D [Brassica napus]
Length=862

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+V VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   IMVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYTFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTM GITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMAGITEFAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>gb|EEE69110.1| hypothetical protein OsJ_28179 [Oryza sativa Japonica Group]
Length=987

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D  DW C++ TT+++R+   +  ER+M+P+ Y +DRVF  D 
Sbjct  22   IMVSVRLRPLNGREA--GDSCDWECISPTTVMFRS---TVPERAMFPTAYTYDRVFGPDS  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I+KH ER
Sbjct  77   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSVLDIYDYIEKHPER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++L+ SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  137  EFILRFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  175



>ref|XP_009345268.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345269.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345270.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KE+  ++V+DW C+N TTI+YRN   +  E S +P+ Y FD+VF  DC
Sbjct  25   ILVLVRLRPLSEKEVAASEVADWECINDTTILYRN---TLREGSTFPTAYTFDKVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VY+E A+++ALSVVNG NSS+FAYGQTSSGKTYTM GITE+ +++I+D+I  H ER
Sbjct  82   STRQVYDEGAQQIALSVVNGINSSIFAYGQTSSGKTYTMNGITEFTVAEIFDYIHAHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE VRDLLS+D TPLRLLDDPERGT++
Sbjct  142  AFVVKFSAIEIYNEVVRDLLSTDNTPLRLLDDPERGTII  180



>ref|NP_001062429.1| Os08g0547500 [Oryza sativa Japonica Group]
 dbj|BAD09938.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF24343.1| Os08g0547500 [Oryza sativa Japonica Group]
Length=986

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D  DW C++ TT+++R+   +  ER+M+P+ Y +DRVF  D 
Sbjct  22   IMVSVRLRPLNGREA--GDSCDWECISPTTVMFRS---TVPERAMFPTAYTYDRVFGPDS  76

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I+KH ER
Sbjct  77   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSVLDIYDYIEKHPER  136

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++L+ SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  137  EFILRFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  175



>gb|EMS48622.1| Kinesin-related protein 4 [Triticum urartu]
Length=1238

 Score =   228 bits (581),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 134/159 (84%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVR+RPLN +E    D SDW C++ TT+++R+   +  +R+M+P+ Y +DRVF  +C
Sbjct  278  IMVSVRVRPLNGRE--SGDSSDWECISPTTVMFRS---TVPDRAMFPTAYTYDRVFGPNC  332

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I+KH ER
Sbjct  333  STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSVMDIYDYIEKHPER  392

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  393  EFMLKFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  431



>gb|KHN39844.1| Centromere-associated protein E [Glycine soja]
Length=889

 Score =   226 bits (575),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVS+RLRPLN KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVSIRLRPLNEKEIAANESADWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEE AKEVA SVV+G NSS+FAYGQTSSGKTYTM GITEYA++DI+D+I++H ER
Sbjct  82   VTRQVYEEGAKEVAPSVVSGINSSIFAYGQTSSGKTYTMVGITEYAVADIFDYIERHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPE  600
             ++LK SA+EIYNE VRDLLS+D TPLRL DDPE
Sbjct  142  AFILKFSAIEIYNEIVRDLLSTDNTPLRLRDDPE  175



>ref|XP_002880373.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56632.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=862

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   ILVLVRLRPLNDKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTM+GITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMSGITEFAVADIFDYIFKHKDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>dbj|BAD09937.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
Length=1003

 Score =   226 bits (576),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D  DW C++ TT+++R+   +  ER+M+P+ Y +DRVF  D 
Sbjct  38   IMVSVRLRPLNGREA--GDSCDWECISPTTVMFRS---TVPERAMFPTAYTYDRVFGPDS  92

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AKEVALSVV+G NSS+FAYGQTSSGKTYTMTGITEY++ DIYD+I+KH ER
Sbjct  93   STRQVYEEGAKEVALSVVSGINSSIFAYGQTSSGKTYTMTGITEYSVLDIYDYIEKHPER  152

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++L+ SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  153  EFILRFSAIEIYNEAVRDLLSHDTTPLRLLDDPEKGTTV  191



>ref|NP_179726.2| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 ref|NP_001031385.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEC07157.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEC07158.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=862

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   ILVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTM+GITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMSGITEFAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G  V
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAAV  180



>gb|KHF98979.1| Kinesin-related 11 [Gossypium arboreum]
Length=949

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI+ N+V+DW C+N  TI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  28   ILVVVRLRPLSDKEIIANEVADWECINDNTILYRN---TLREGSTFPSAYTFDRVFRGDC  84

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VYEE AKEVALSVV+G NS++FAYGQTSSGKTYTMTGITEY ++DI+D+I +H ER
Sbjct  85   LTKQVYEEGAKEVALSVVSGINSTIFAYGQTSSGKTYTMTGITEYTVADIFDYINRHKER  144

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLSS+ T L+L DDPERG +V
Sbjct  145  AFVLKFSAIEIYNEAIRDLLSSENTQLKLRDDPERGIIV  183



>ref|XP_011037209.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037210.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037211.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037212.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037214.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037215.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
Length=973

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEIL N+V+DW C+N TTI+YRN   +  E S +PS   FDRVF  + 
Sbjct  25   ILVLVRLRPLSDKEILANEVADWECINDTTILYRN---TLREGSSFPSACTFDRVFRGND  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYE  AKEVALSVV+G NSS+FAYGQTSSGKTYTM GITEY ++DI+D++ +H ER
Sbjct  82   TTREVYEAGAKEVALSVVSGINSSIFAYGQTSSGKTYTMMGITEYTVADIFDYMHRHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLS+D TPLRLLDDPE+GTVV
Sbjct  142  AFVLKFSAIEIYNEAIRDLLSTDDTPLRLLDDPEKGTVV  180



>gb|KDP38590.1| hypothetical protein JCGZ_04515 [Jatropha curcas]
Length=941

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 129/154 (84%), Gaps = 3/154 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I V VR+RPLN KEI R+DVSDW C+N TTI++++   +  +RSM P+ Y FDRV+ S+C
Sbjct  32   IFVCVRMRPLNEKEIARHDVSDWECINDTTIIFKS---NMPDRSMVPTAYTFDRVYGSEC  88

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             T++VYE  AKE+AL+ V+G NSS+FAYGQTSSGKTYTM+GITE A++DIY +I++H ER
Sbjct  89   PTKQVYEGGAKEIALAAVSGINSSIFAYGQTSSGKTYTMSGITECAMADIYQYIEQHKER  148

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPE  600
            ++VLK SAMEIYNE+VRDLLS+D TPLRLLDDPE
Sbjct  149  EFVLKFSAMEIYNEAVRDLLSADSTPLRLLDDPE  182



>ref|XP_008652981.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
Length=901

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRP+N +E  R D SDW C   TT+++     +  ER+M+P+ Y +DRVFN +C
Sbjct  7    ILVSVRLRPVNAREAERGDGSDWECAGPTTLMFHG---NIPERAMFPASYTYDRVFNPEC  63

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK+VALSV++G NSS+FAYGQTSSGKTYTM GITE +++DIYD+I KH ER
Sbjct  64   STRQVYEEGAKQVALSVLSGINSSIFAYGQTSSGKTYTMVGITERSMADIYDYIDKHPER  123

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLL  D T LRLLDDPE+GTVV
Sbjct  124  EFVLKFSAMEIYNEAVRDLLRPDATQLRLLDDPEKGTVV  162



>ref|XP_008652983.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
 tpg|DAA62429.1| TPA: hypothetical protein ZEAMMB73_515130 [Zea mays]
Length=900

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRP+N +E  R D SDW C   TT+++     +  ER+M+P+ Y +DRVFN +C
Sbjct  7    ILVSVRLRPVNAREAERGDGSDWECAGPTTLMFHG---NIPERAMFPASYTYDRVFNPEC  63

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE AK+VALSV++G NSS+FAYGQTSSGKTYTM GITE +++DIYD+I KH ER
Sbjct  64   STRQVYEEGAKQVALSVLSGINSSIFAYGQTSSGKTYTMVGITERSMADIYDYIDKHPER  123

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLL  D T LRLLDDPE+GTVV
Sbjct  124  EFVLKFSAMEIYNEAVRDLLRPDATQLRLLDDPEKGTVV  162



>ref|XP_010028651.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55426.1| hypothetical protein EUGRSUZ_I01329 [Eucalyptus grandis]
Length=928

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KE + N+V+DW C+N TTI+YRN   +  E S +P  Y FDRV+  DC
Sbjct  25   ILVLVRLRPLSEKEAVANEVADWECINDTTILYRN---TLREGSTFPYTYTFDRVYRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYEE A+ +ALSVVNG NSS+FAYGQTSSGKTYTM GITE  ++DI+D++ KH ER
Sbjct  82   STREVYEEGARGLALSVVNGINSSIFAYGQTSSGKTYTMNGITELTVADIFDYVHKHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE VRDLLS+D T LRLLDDPERGT+V
Sbjct  142  AFVLKFSAIEIYNEVVRDLLSTDSTSLRLLDDPERGTIV  180



>gb|KHN33713.1| Centromere-associated protein E [Glycine soja]
Length=899

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  N+  DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEIDVNETGDWECINDTTILYRN---TLREGSTFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AK++ALSVV G NSS+FAYGQTSSGKTYTM GITEYA++DI+D+I KH ER
Sbjct  82   STKQVYEEGAKDIALSVVGGINSSIFAYGQTSSGKTYTMIGITEYAVADIFDYINKHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE +RDLLS++ T LRL DDPERG +V
Sbjct  142  AFVLKFSAIEIYNEIIRDLLSTENTSLRLRDDPERGPIV  180



>ref|XP_010472110.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010472111.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   ILVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTM+GITE+A++DI+D+I K+ +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMSGITEFAVADIFDYIFKNEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>ref|XP_002305465.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE85976.1| kinesin motor family protein [Populus trichocarpa]
Length=842

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEIL N+V+DW C+N TTI+YRN   +  E S +PS   FDRVF  + 
Sbjct  14   ILVLVRLRPLSDKEILANEVADWECINDTTILYRN---TLREGSTFPSACTFDRVFRGND  70

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +TR+VYE  AKEVALSVV+G N ++FAYGQTSSGKTYTM GITEY ++DI+D++ +H ER
Sbjct  71   TTREVYEAGAKEVALSVVSGINCNIFAYGQTSSGKTYTMMGITEYTVADIFDYMHRHEER  130

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE++RDLLS+D TPLRLLDDPE+GTVV
Sbjct  131  AFVLKFSAIEIYNEAIRDLLSTDDTPLRLLDDPEKGTVV  169



>ref|XP_010429028.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010429029.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010429030.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   ILVLVRLRPLNEKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTM+GITE+A++DI+D+I K+ +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMSGITEFAVADIFDYIFKNEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>ref|XP_006411686.1| hypothetical protein EUTSA_v10024409mg [Eutrema salsugineum]
 gb|ESQ53139.1| hypothetical protein EUTSA_v10024409mg [Eutrema salsugineum]
Length=828

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FDRV+  +C
Sbjct  15   ILVLVRLRPLNEKEIAANETADWECINDTTILYRN---TLREGSNFPSAYSFDRVYRGEC  71

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KE+ALSVV G N S+FAYGQTSSGKTYTM+GITE+A++DI+D+I +H ER
Sbjct  72   PTRQVYEDGTKEIALSVVKGINCSIFAYGQTSSGKTYTMSGITEFAVADIFDYIFQHEER  131

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             + +K SA+EIYNE++RDLLSSD TPLRL DDPE+GTVV
Sbjct  132  AFSVKFSAIEIYNEAIRDLLSSDGTPLRLRDDPEKGTVV  170



>gb|EEC84919.1| hypothetical protein OsI_32119 [Oryza sativa Indica Group]
Length=1093

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 133/166 (80%), Gaps = 10/166 (6%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRP+N +E  R D SDW C   TT+ +R    +  ER+M+P+ Y +DRVF+ +C
Sbjct  10   IVVSVRLRPVNAREAERGDGSDWECAGPTTLTFRG---AVPERAMFPASYSYDRVFSHEC  66

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VY+E A++VA+SV++G N+S+FAYGQTSSGKTYTM GITEY++SDIYD+I+KH ER
Sbjct  67   GTRQVYDEGARQVAMSVLSGINASIFAYGQTSSGKTYTMVGITEYSMSDIYDYIEKHPER  126

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPE-------RGTVV  615
            +++LK SAMEIYNE+VRDLLSSD TPLRLLDDPE       +GTVV
Sbjct  127  EFILKFSAMEIYNEAVRDLLSSDATPLRLLDDPEVTFFLDMKGTVV  172



>ref|XP_010416871.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010416872.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010416873.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  +C
Sbjct  25   ILVLVRLRPLNDKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGEC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTM+GITE+A++DI+D+I K+ +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMSGITEFAVADIFDYIFKNEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D TPLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAVV  180



>ref|XP_004293191.1| PREDICTED: kinesin-like protein NACK2 [Fragaria vesca subsp. 
vesca]
Length=1009

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RPLN KE  +N+VSDW C + T +   N   S ++R   PS Y FDRVF  D 
Sbjct  12   ILVSVRVRPLNDKEKAKNEVSDWKCFHNTVMYNTN---SQADRPSSPSAYAFDRVFGKDS  68

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AKEVALSVV+G NS++FAYGQTSSGKTYTM G+TE+A+SDIYDH+++ ++R
Sbjct  69   STKQVYEEGAKEVALSVVSGINSTIFAYGQTSSGKTYTMNGVTEFAVSDIYDHMERQSDR  128

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SAMEIYNE+VRDLLSS+   LRLLDDPE+GTVV
Sbjct  129  EFVLKFSAMEIYNEAVRDLLSSENAQLRLLDDPEKGTVV  167



>ref|XP_010679851.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=1050

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 127/159 (80%), Gaps = 9/159 (6%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  R +  DW CV+ TTI+Y+N   ++         + FDRVF SDC
Sbjct  21   ILVSVRLRPLNEKEASRKEAIDWECVDDTTIIYKNNSSNS---------FTFDRVFRSDC  71

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AK V LSVV+G NSSVFAYGQTSSGKT+TM+GITEY + DI+D+IQKH ER
Sbjct  72   STRQVYEDGAKAVVLSVVSGINSSVFAYGQTSSGKTFTMSGITEYTMEDIFDYIQKHKER  131

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLL+SD +PLRLLDDPERGTVV
Sbjct  132  NFHLKFSAMEIYNESVRDLLTSDNSPLRLLDDPERGTVV  170



>ref|XP_006279726.1| hypothetical protein CARUB_v10027496mg [Capsella rubella]
 gb|EOA12624.1| hypothetical protein CARUB_v10027496mg [Capsella rubella]
Length=1054

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVR+RP N KE  RND+ DW CVN TTI+  N +L   ERS++PS Y FD+VF  + 
Sbjct  10   ILVSVRVRPQNEKEKARNDICDWECVNNTTIIC-NSNLP--ERSLFPSTYTFDKVFGFNS  66

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +T++VYE+ AKEVAL V++G NSS+FAYGQTSSGKTYTM+GITE+A+ DI+ +I+KHTER
Sbjct  67   ATKQVYEDGAKEVALCVLDGINSSIFAYGQTSSGKTYTMSGITEFAMDDIFCYIEKHTER  126

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +Y LK SA+EIYNE+VRDLLS D   LRLLDDPERGTVV
Sbjct  127  EYTLKFSAIEIYNEAVRDLLSGDNNQLRLLDDPERGTVV  165



>ref|XP_010679850.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=1052

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 127/159 (80%), Gaps = 9/159 (6%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRPLN KE  R +  DW CV+ TTI+Y+N   ++         + FDRVF SDC
Sbjct  21   ILVSVRLRPLNEKEASRKEAIDWECVDDTTIIYKNNSSNS---------FTFDRVFRSDC  71

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            STR+VYE+ AK V LSVV+G NSSVFAYGQTSSGKT+TM+GITEY + DI+D+IQKH ER
Sbjct  72   STRQVYEDGAKAVVLSVVSGINSSVFAYGQTSSGKTFTMSGITEYTMEDIFDYIQKHKER  131

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++ LK SAMEIYNESVRDLL+SD +PLRLLDDPERGTVV
Sbjct  132  NFHLKFSAMEIYNESVRDLLTSDNSPLRLLDDPERGTVV  170



>ref|XP_002868873.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45132.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=836

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 128/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FD+V+  +C
Sbjct  14   ILVLVRLRPLNEKEIAANEAADWECINDTTILYRN---TLREGSNFPSAYSFDKVYRGEC  70

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+ AKE+ALSVV G N S+FAYGQTSSGKTYTMTGITE+A++DI+D+I +H ER
Sbjct  71   PTRQVYEDGAKEIALSVVKGINCSIFAYGQTSSGKTYTMTGITEFAVADIFDYIFQHEER  130

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             + +K SA+EIYNE++RDLLSSD T LRL DDPE+GTVV
Sbjct  131  AFSVKFSAIEIYNEAIRDLLSSDGTSLRLRDDPEKGTVV  169



>ref|XP_008444776.1| PREDICTED: kinesin-like protein NACK1 [Cucumis melo]
Length=948

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I VS+RLRPLN KE+++ND SDW C+N  ++++R+   +  ERS++P  Y FDRVF  D 
Sbjct  21   IRVSIRLRPLNEKELMKNDSSDWECLNSNSVMFRS---TLPERSLFPHSYTFDRVFGIDS  77

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            +T++VYEE AKEVALSVVNG NS++FAYGQTSSGKT+TM G+T+Y+++DIY +I+ H +R
Sbjct  78   TTKQVYEEGAKEVALSVVNGINSTIFAYGQTSSGKTFTMNGVTQYSVADIYSYIESHQDR  137

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            ++VLK SA+EIYNE+V+DLLS +  PLRLLDDPE+GTVV
Sbjct  138  EFVLKFSAIEIYNEAVKDLLSLENVPLRLLDDPEKGTVV  176



>gb|KHN20030.1| Kinesin-related protein 4 [Glycine soja]
Length=887

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (79%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEIDVNEAADWECINDTTILYRN---TLREGSSFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AKE+ALSVV G NS +FAYGQTSSGKTYTM GITEYA++DI+D+I KH ER
Sbjct  82   STKQVYEEGAKEIALSVVGGINSCIFAYGQTSSGKTYTMIGITEYAVADIFDYINKHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE +RDLL +  T LRL DDPERG +V
Sbjct  142  AFVLKFSAIEIYNEIIRDLLITKNTSLRLRDDPERGPIV  180



>ref|XP_002444630.1| hypothetical protein SORBIDRAFT_07g025040 [Sorghum bicolor]
 gb|EES14125.1| hypothetical protein SORBIDRAFT_07g025040 [Sorghum bicolor]
Length=1032

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 132/165 (80%), Gaps = 11/165 (7%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            I+VSVRLRPLN +E    D SDW C++ TTI++R+   +  ER+M+P+ Y +DRVF   C
Sbjct  17   IMVSVRLRPLNGREA--GDSSDWECISPTTIMFRS---TVPERAMFPTAYTYDRVFGPSC  71

Query  319  STRKVYEEAAKEVALSVVNGFN------SSVFAYGQTSSGKTYTMTGITEYAISDIYDHI  480
            STR+VYEE AKEVALSVV+G N      +S+FAYGQTSSGKTYTMTGITEY++ DIYD+I
Sbjct  72   STRQVYEEGAKEVALSVVSGINCMHKRNTSIFAYGQTSSGKTYTMTGITEYSMLDIYDYI  131

Query  481  QKHTERDYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             KH ER+++LK SA+EIYNE+VRDLLS D TPLRLLDDPE+GT V
Sbjct  132  DKHPEREFILKFSAIEIYNEAVRDLLSHDPTPLRLLDDPEKGTTV  176



>ref|XP_009140272.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=842

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  + 
Sbjct  25   ILVLVRLRPLNDKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGES  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTMTGITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMTGITEFAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D  PLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSPPLRLRDDPEKGAVV  180



>gb|EYU34880.1| hypothetical protein MIMGU_mgv1a024217mg, partial [Erythranthe 
guttata]
Length=247

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 118/153 (77%), Gaps = 11/153 (7%)
 Frame = +1

Query  157  LRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDCSTRKVY  336
            LR LN +EIL NDVSDW C+N  TI+Y+N  LSASERSMYP+ Y F+           VY
Sbjct  1    LRLLNGREILSNDVSDWECINNKTIIYKNSALSASERSMYPTSYTFE-----------VY  49

Query  337  EEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTERDYVLKL  516
            E+ AK+V LSV++G NS  FAYGQTS+GKTYTM GITEYA+ DIY +IQKH ERD+V K 
Sbjct  50   EKGAKDVVLSVISGINSRGFAYGQTSNGKTYTMIGITEYALPDIYGYIQKHQERDFVFKF  109

Query  517  SAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            SAMEIYN+SVRDLLS D TPLRLLDD ERGTVV
Sbjct  110  SAMEIYNKSVRDLLSVDNTPLRLLDDTERGTVV  142



>ref|XP_003527612.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006581109.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
Length=880

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (79%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPL+ KEI  N+ +DW C+N TTI+YRN   +  E S +PS Y FDRVF  DC
Sbjct  25   ILVLVRLRPLSEKEIDVNEAADWECINDTTILYRN---TLREGSSFPSAYTFDRVFRGDC  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
            ST++VYEE AKE+ALSVV G NS +FAYGQTSSGKTYTM GITEYA++DI+D+I KH ER
Sbjct  82   STKQVYEEGAKEIALSVVGGINSCIFAYGQTSSGKTYTMIGITEYAVADIFDYINKHEER  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +VLK SA+EIYNE +RDLL +  T LRL DDPERG +V
Sbjct  142  AFVLKFSAIEIYNEIIRDLLITKNTSLRLRDDPERGPIV  180



>ref|XP_003578490.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
 ref|XP_010238416.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
Length=880

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 129/159 (81%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILVSVRLRP+N +E  R D  +W C   TT+ +     +  ER+M+P+ Y +DRVF+ +C
Sbjct  8    ILVSVRLRPVNAREAERGDGDEWECAGPTTLKFLG---NIPERAMFPATYTYDRVFSPEC  64

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYEE AKEVALSV++G NSS+FAYGQTSSGKTYTM G+TE+++++IY +I +H ER
Sbjct  65   DTRQVYEEGAKEVALSVLSGINSSIFAYGQTSSGKTYTMVGVTEHSMAEIYGYIDQHPER  124

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
            +++LK SAMEIYNE+VRDLLSSD TPLRLLDDPE+GTVV
Sbjct  125  EFILKFSAMEIYNEAVRDLLSSDATPLRLLDDPEKGTVV  163



>emb|CDY15900.1| BnaA04g12110D [Brassica napus]
Length=844

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  139  ILVSVRLRPLNHKEILRNDVSDWGCVNQTTIVYRNVDLSASERSMYPSVYVFDRVFNSDC  318
            ILV VRLRPLN KEIL N+ +DW C+N TT++YRN   +  E S +PS Y FDRV+  + 
Sbjct  25   ILVLVRLRPLNDKEILANEAADWECINDTTVLYRN---TLREGSTFPSAYSFDRVYRGES  81

Query  319  STRKVYEEAAKEVALSVVNGFNSSVFAYGQTSSGKTYTMTGITEYAISDIYDHIQKHTER  498
             TR+VYE+  KEVALSVV G NSS+FAYGQTSSGKTYTMTGITE+A++DI+D+I KH +R
Sbjct  82   PTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTMTGITEFAVADIFDYIFKHEDR  141

Query  499  DYVLKLSAMEIYNESVRDLLSSDVTPLRLLDDPERGTVV  615
             +V+K SA+EIYNE++RDLLS D  PLRL DDPE+G VV
Sbjct  142  AFVVKFSAIEIYNEAIRDLLSPDSPPLRLRDDPEKGAVV  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090