BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS148B02

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO64510.1|  hypothetical protein CISIN_1g002306mg                   277   1e-83   Citrus sinensis [apfelsine]
gb|KDO64509.1|  hypothetical protein CISIN_1g002306mg                   277   2e-83   Citrus sinensis [apfelsine]
ref|XP_006440914.1|  hypothetical protein CICLE_v10018746mg             277   2e-83   Citrus clementina [clementine]
gb|KDP20084.1|  hypothetical protein JCGZ_05853                         276   3e-83   Jatropha curcas
ref|XP_006485749.1|  PREDICTED: DNA mismatch repair protein MSH2-...    276   3e-83   Citrus sinensis [apfelsine]
gb|EYU19022.1|  hypothetical protein MIMGU_mgv1a000954mg                275   7e-83   Erythranthe guttata [common monkey flower]
ref|XP_010663545.1|  PREDICTED: DNA mismatch repair protein MSH2 ...    276   7e-83   Vitis vinifera
ref|XP_006354733.1|  PREDICTED: DNA mismatch repair protein MSH2-...    275   1e-82   Solanum tuberosum [potatoes]
emb|CDO98471.1|  unnamed protein product                                275   2e-82   Coffea canephora [robusta coffee]
ref|XP_002511977.1|  DNA mismatch repair protein MSH2, putative         274   2e-82   Ricinus communis
ref|NP_001234067.1|  mismatch repair protein                            273   8e-82   Solanum lycopersicum
ref|XP_007209075.1|  hypothetical protein PRUPE_ppa000981mg             272   1e-81   Prunus persica
ref|XP_006406595.1|  hypothetical protein EUTSA_v10020006mg             272   2e-81   
ref|XP_008351910.1|  PREDICTED: DNA mismatch repair protein MSH2-...    269   2e-81   
ref|XP_008360917.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    269   2e-81   
ref|XP_008374721.1|  PREDICTED: DNA mismatch repair protein MSH2        270   6e-81   Malus domestica [apple tree]
gb|KJB34384.1|  hypothetical protein B456_006G063300                    269   6e-81   Gossypium raimondii
ref|XP_010695623.1|  PREDICTED: DNA mismatch repair protein MSH2        270   7e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB34381.1|  hypothetical protein B456_006G063300                    270   8e-81   Gossypium raimondii
gb|KJB34383.1|  hypothetical protein B456_006G063300                    270   1e-80   Gossypium raimondii
gb|KJB34382.1|  hypothetical protein B456_006G063300                    270   1e-80   Gossypium raimondii
ref|XP_009346787.1|  PREDICTED: DNA mismatch repair protein MSH2-...    270   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_009798771.1|  PREDICTED: DNA mismatch repair protein MSH2        270   1e-80   Nicotiana sylvestris
ref|XP_008244032.1|  PREDICTED: DNA mismatch repair protein MSH2        269   2e-80   Prunus mume [ume]
ref|XP_002317931.1|  muts homolog 2 family protein                      268   4e-80   Populus trichocarpa [western balsam poplar]
gb|KFK39205.1|  hypothetical protein AALP_AA3G213100                    268   4e-80   Arabis alpina [alpine rockcress]
gb|KFK39206.1|  hypothetical protein AALP_AA3G213100                    268   4e-80   Arabis alpina [alpine rockcress]
ref|XP_010506962.1|  PREDICTED: DNA mismatch repair protein MSH2        268   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_003549805.1|  PREDICTED: DNA mismatch repair protein MSH2-...    268   6e-80   Glycine max [soybeans]
gb|AAT67044.1|  DNA mismatch repair protein                             267   8e-80   Petunia x hybrida [garden petunia]
ref|NP_566804.3|  DNA mismatch repair protein Msh2                      266   2e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAD04176.1|  mismatch repair protein                                 266   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009627423.1|  PREDICTED: DNA mismatch repair protein MSH2        266   2e-79   Nicotiana tomentosiformis
ref|XP_007036428.1|  MUTS isoform 2                                     265   4e-79   
ref|XP_007036427.1|  MUTS isoform 1                                     265   5e-79   
gb|KHG20537.1|  DNA mismatch repair Msh2 -like protein                  265   7e-79   Gossypium arboreum [tree cotton]
ref|XP_011102330.1|  PREDICTED: DNA mismatch repair protein MSH2-...    265   8e-79   Sesamum indicum [beniseed]
ref|XP_006843758.1|  hypothetical protein AMTR_s00007p00236950          264   1e-78   Amborella trichopoda
ref|XP_006296923.1|  hypothetical protein CARUB_v10012916mg             263   2e-78   Capsella rubella
ref|XP_010465956.1|  PREDICTED: DNA mismatch repair protein MSH2-...    263   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010265279.1|  PREDICTED: DNA mismatch repair protein MSH2        263   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_002885262.1|  hypothetical protein ARALYDRAFT_479358             261   1e-77   
ref|XP_004138226.1|  PREDICTED: DNA mismatch repair protein MSH2-...    261   2e-77   
gb|KGN63799.1|  hypothetical protein Csa_1G020900                       261   2e-77   Cucumis sativus [cucumbers]
gb|KEH32085.1|  DNA mismatch repair MSH3-like protein                   260   4e-77   Medicago truncatula
ref|XP_004508573.1|  PREDICTED: DNA mismatch repair protein MSH2-...    260   4e-77   Cicer arietinum [garbanzo]
emb|CDX82340.1|  BnaA03g34810D                                          259   7e-77   
ref|XP_009135581.1|  PREDICTED: DNA mismatch repair protein MSH2        259   8e-77   Brassica rapa
ref|XP_004299238.1|  PREDICTED: DNA mismatch repair protein MSH2        259   8e-77   Fragaria vesca subsp. vesca
ref|XP_010549145.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    259   9e-77   Tarenaya hassleriana [spider flower]
ref|XP_010031721.1|  PREDICTED: DNA mismatch repair protein MSH2        259   1e-76   Eucalyptus grandis [rose gum]
emb|CDY52899.1|  BnaCnng23780D                                          256   7e-76   Brassica napus [oilseed rape]
ref|XP_007155145.1|  hypothetical protein PHAVU_003G177100g             255   2e-75   Phaseolus vulgaris [French bean]
ref|XP_010110802.1|  DNA mismatch repair protein Msh2                   254   8e-75   
ref|XP_008453367.1|  PREDICTED: DNA mismatch repair protein MSH2        249   2e-73   Cucumis melo [Oriental melon]
ref|XP_009404391.1|  PREDICTED: DNA mismatch repair protein MSH2        249   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011009801.1|  PREDICTED: DNA mismatch repair protein MSH2        247   2e-72   Populus euphratica
ref|XP_010916140.1|  PREDICTED: DNA mismatch repair protein MSH2 ...    247   2e-72   Elaeis guineensis
ref|XP_010916139.1|  PREDICTED: DNA mismatch repair protein MSH2 ...    247   2e-72   Elaeis guineensis
ref|XP_008785817.1|  PREDICTED: DNA mismatch repair protein MSH2        246   6e-72   Phoenix dactylifera
ref|XP_011073052.1|  PREDICTED: DNA mismatch repair protein MSH2-...    238   3e-69   Sesamum indicum [beniseed]
ref|XP_003562321.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...    231   9e-67   Brachypodium distachyon [annual false brome]
gb|EEC78891.1|  hypothetical protein OsI_19262                          228   6e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_010663546.1|  PREDICTED: DNA mismatch repair protein MSH2 ...    226   3e-65   Vitis vinifera
dbj|BAK07130.1|  predicted protein                                      225   1e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS48756.1|  DNA mismatch repair protein MSH2                        227   1e-64   Triticum urartu
ref|NP_001146301.1|  DNA mismatch repair protein MSH2                   224   2e-64   Zea mays [maize]
ref|XP_006655161.1|  PREDICTED: DNA mismatch repair protein MSH2-...    221   3e-63   Oryza brachyantha
gb|EPS69989.1|  hypothetical protein M569_04769                         218   4e-62   Genlisea aurea
ref|XP_004962511.1|  PREDICTED: DNA mismatch repair protein MSH2-...    215   4e-61   Setaria italica
ref|XP_002463122.1|  hypothetical protein SORBIDRAFT_02g038230          211   8e-60   Sorghum bicolor [broomcorn]
gb|AAZ42361.1|  DNA mismatch repair protein MSH2                        199   3e-55   Physcomitrella patens
ref|XP_001779144.1|  predicted protein                                  199   3e-55   
ref|XP_002966234.1|  hypothetical protein SELMODRAFT_85179              193   3e-53   
ref|XP_002982304.1|  hypothetical protein SELMODRAFT_268576             193   3e-53   
ref|XP_011102331.1|  PREDICTED: DNA mismatch repair protein MSH2-...    152   2e-38   Sesamum indicum [beniseed]
tpg|DAA45374.1|  TPA: hypothetical protein ZEAMMB73_164133              147   8e-37   
tpg|DAA37234.1|  TPA: hypothetical protein ZEAMMB73_988752              144   3e-36   
ref|XP_003056389.1|  predicted protein                                  127   8e-30   Micromonas pusilla CCMP1545
ref|XP_005646040.1|  DNA mismatch repair protein                        122   3e-28   Coccomyxa subellipsoidea C-169
ref|XP_002507226.1|  predicted protein                                  121   7e-28   Micromonas commoda
gb|KIY98739.1|  DNA mismatch repair protein Msh2                        112   6e-25   Monoraphidium neglectum
ref|XP_002955323.1|  hypothetical protein VOLCADRAFT_96164              109   1e-23   Volvox carteri f. nagariensis
ref|XP_009063476.1|  hypothetical protein LOTGIDRAFT_195636             108   3e-23   Lottia gigantea
ref|XP_004363541.2|  Msh2 protein                                       107   4e-23   Capsaspora owczarzaki ATCC 30864
ref|XP_005098367.1|  PREDICTED: DNA mismatch repair protein Msh2-...    107   6e-23   
ref|XP_002154213.2|  PREDICTED: DNA mismatch repair protein Msh2-...    103   1e-21   
ref|XP_001415744.1|  predicted protein                                  102   3e-21   Ostreococcus lucimarinus CCE9901
gb|KJE92931.1|  Msh2 protein                                          99.8    2e-20   Capsaspora owczarzaki ATCC 30864
ref|XP_001619624.1|  hypothetical protein NEMVEDRAFT_v1g224004        95.5    5e-20   Nematostella vectensis
ref|XP_011437807.1|  PREDICTED: DNA mismatch repair protein Msh2-...  97.4    2e-19   Crassostrea gigas
dbj|GAM86574.1|  hypothetical protein ANO11243_045880                 96.7    3e-19   fungal sp. No.11243
ref|XP_006571175.1|  PREDICTED: DNA mismatch repair protein Msh2      96.3    4e-19   
ref|XP_002740239.1|  PREDICTED: DNA mismatch repair protein Msh2      95.1    8e-19   Saccoglossus kowalevskii
ref|XP_003493495.1|  PREDICTED: DNA mismatch repair protein Msh2-...  95.1    9e-19   Bombus impatiens
ref|XP_003706395.1|  PREDICTED: DNA mismatch repair protein Msh2-...  95.1    9e-19   
ref|XP_006614540.1|  PREDICTED: DNA mismatch repair protein Msh2-...  95.1    1e-18   Apis dorsata [rock honeybee]
ref|XP_003393508.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  94.7    1e-18   Bombus terrestris [large earth bumblebee]
ref|XP_011152479.1|  PREDICTED: DNA mismatch repair protein Msh2      93.6    3e-18   
ref|XP_011252841.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  93.6    3e-18   Camponotus floridanus
ref|XP_003697302.1|  PREDICTED: DNA mismatch repair protein Msh2-...  93.6    3e-18   
ref|XP_007589160.1|  putative dna mismatch repair protein msh-2 p...  92.8    5e-18   
pir||S53609  DNA mismatch repair protein MSH2 - African clawed frog   92.8    7e-18
ref|XP_003081646.1|  Mismatch repair ATPase MSH4 (MutS family) (ISS)  92.4    7e-18   
emb|CEF99387.1|  DNA mismatch repair protein, MSH2                    92.4    7e-18   Ostreococcus tauri
ref|XP_011169227.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  92.4    7e-18   Solenopsis invicta [imported red fire ant]
ref|XP_002935427.2|  PREDICTED: DNA mismatch repair protein Msh2      92.0    9e-18   Xenopus tropicalis [western clawed frog]
gb|KFY03717.1|  hypothetical protein O988_01278                       91.7    1e-17   Pseudogymnoascus sp. VKM F-3808
gb|KFX99088.1|  hypothetical protein V490_01957                       91.7    1e-17   Pseudogymnoascus sp. VKM F-3557
ref|XP_011341920.1|  PREDICTED: DNA mismatch repair protein Msh2      91.3    2e-17   Ooceraea biroi
gb|KIH88997.1|  DNA mismatch repair protein MSH2                      91.3    2e-17   Sporothrix brasiliensis 5110
ref|XP_007798315.1|  putative dna mismatch repair protein msh-2 p...  90.9    2e-17   
ref|NP_001154964.1|  mutS homolog 2                                   90.9    2e-17   Nasonia vitripennis
gb|ERT02672.1|  DNA mismatch repair protein msh-2                     90.9    2e-17   Sporothrix schenckii ATCC 58251
ref|XP_011169226.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  90.9    3e-17   
gb|KFY44683.1|  hypothetical protein V495_03312                       91.3    3e-17   Pseudogymnoascus sp. VKM F-4514 (FW-929)
ref|XP_003729116.1|  PREDICTED: DNA mismatch repair protein Msh2      90.9    3e-17   
gb|KFY23866.1|  hypothetical protein V491_02389                       87.4    3e-17   Pseudogymnoascus sp. VKM F-3775
ref|XP_008210276.1|  PREDICTED: mutS homolog 2 isoform X1             90.9    4e-17   
gb|EPE03362.1|  dna mismatch repair protein msh-2                     89.7    6e-17   Ophiostoma piceae UAMH 11346
gb|KEQ74803.1|  DNA mismatch repair protein                           89.7    7e-17   Aureobasidium namibiae CBS 147.97
ref|XP_010576063.1|  PREDICTED: DNA mismatch repair protein Msh2      89.4    8e-17   Haliaeetus leucocephalus
ref|XP_005491525.1|  PREDICTED: DNA mismatch repair protein Msh2      89.4    9e-17   Zonotrichia albicollis
ref|XP_002113012.1|  hypothetical protein TRIADDRAFT_56718            89.4    9e-17   Trichoplax adhaerens
ref|XP_007780867.1|  DNA mismatch repair protein msh-2                89.0    1e-16   Coniosporium apollinis CBS 100218
gb|KFY99744.1|  hypothetical protein V500_01272                       89.0    1e-16   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_005824578.1|  Msh2 mismatch repair muts-like protein, meio...  89.0    1e-16   Guillardia theta CCMP2712
gb|KFY53035.1|  hypothetical protein V496_07961                       88.6    1e-16   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ESZ90350.1|  DNA mismatch repair protein msh-2                     88.6    1e-16   Sclerotinia borealis F-4128
gb|AAB59566.1|  mutation causes premature stop                        85.5    2e-16   Homo sapiens [man]
gb|KFY40284.1|  hypothetical protein V494_03584                       88.6    2e-16   Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_006682779.1|  hypothetical protein BATDEDRAFT_21067            88.2    2e-16   Batrachochytrium dendrobatidis JAM81
dbj|BAG28295.1|  mismatch repair protein                              87.8    2e-16   Mesocricetus auratus [Syrian golden hamster]
gb|KEY67948.1|  hypothetical protein S7711_02156                      88.2    2e-16   Stachybotrys chartarum IBT 7711
gb|AAB59567.1|  premature stop codon due to mutation                  85.5    2e-16   Homo sapiens [man]
gb|KFA72895.1|  hypothetical protein S40288_02138                     87.8    2e-16   Stachybotrys chartarum IBT 40288
gb|KFA48013.1|  hypothetical protein S40293_02678                     87.8    2e-16   Stachybotrys chartarum IBT 40293
gb|KFA66863.1|  hypothetical protein S40285_02325                     87.8    2e-16   Stachybotrys chlorohalonata IBT 40285
gb|KFZ23680.1|  hypothetical protein V502_01863                       88.2    3e-16   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
gb|EKG21122.1|  hypothetical protein MPH_01541                        87.8    3e-16   Macrophomina phaseolina MS6
gb|KDN48308.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...  87.4    3e-16   Rhizoctonia solani AG-8 WAC10335
gb|KFY21952.1|  hypothetical protein V493_06965                       87.8    3e-16   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KFY06630.1|  hypothetical protein V492_07892                       87.4    4e-16   Pseudogymnoascus sp. VKM F-4246
gb|KFB45519.1|  AGAP010282-PA-like protein                            87.0    5e-16   Anopheles sinensis
ref|XP_005324544.1|  PREDICTED: DNA mismatch repair protein Msh2      87.0    5e-16   Ictidomys tridecemlineatus
sp|Q5XXB5.1|MSH2_CHLAE  RecName: Full=DNA mismatch repair protein...  87.0    5e-16   Chlorocebus aethiops [African green monkey]
ref|XP_009235603.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  85.1    5e-16   
ref|XP_007811006.1|  DNA mismatch repair protein MSH2                 87.0    5e-16   Metarhizium acridum CQMa 102
ref|XP_003473123.1|  PREDICTED: DNA mismatch repair protein Msh2      87.0    5e-16   Cavia porcellus [guinea pig]
ref|XP_007968903.1|  PREDICTED: DNA mismatch repair protein Msh2      87.0    6e-16   Chlorocebus sabaeus
ref|XP_008553059.1|  PREDICTED: DNA mismatch repair protein Msh2      86.7    6e-16   Microplitis demolitor
gb|KEQ61140.1|  DNA mismatch repair protein-like protein msh-2        86.7    7e-16   Aureobasidium melanogenum CBS 110374
gb|AAB59569.1|  mutation causes premature stop                        85.1    7e-16   Homo sapiens [man]
gb|ELR08238.1|  hypothetical protein GMDG_03040                       87.0    7e-16   Pseudogymnoascus destructans 20631-21
gb|EHH55555.1|  hypothetical protein EGM_04786                        86.3    8e-16   Macaca fascicularis [crab eating macaque]
gb|EUC61162.1|  DNA mismatch repair protein msh-2                     86.3    8e-16   Rhizoctonia solani AG-3 Rhs1AP
gb|EHH22108.1|  hypothetical protein EGK_05309                        86.3    8e-16   Macaca mulatta [rhesus macaque]
ref|XP_010362595.1|  PREDICTED: DNA mismatch repair protein Msh2      86.3    9e-16   Rhinopithecus roxellana
ref|XP_004590831.1|  PREDICTED: DNA mismatch repair protein Msh2      86.3    9e-16   
ref|XP_011305124.1|  PREDICTED: DNA mismatch repair protein Msh2      86.3    9e-16   Fopius arisanus
ref|XP_007428533.1|  PREDICTED: DNA mismatch repair protein Msh2      86.3    9e-16   Python bivittatus
emb|CCD50782.1|  similar to DNA mismatch repair protein msh-2         86.3    1e-15   Botrytis cinerea T4
gb|EMR86681.1|  putative dna mismatch repair protein                  86.3    1e-15   Botrytis cinerea BcDW1
gb|EAX00215.1|  mutS homolog 2, colon cancer, nonpolyposis type 1...  85.1    1e-15   Homo sapiens [man]
gb|KDB14691.1|  DNA mismatch repair protein MSH2                      85.9    1e-15   Ustilaginoidea virens
gb|AAB59570.1|  The base insertion results in premature stop          84.7    1e-15   Homo sapiens [man]
gb|EZA46081.1|  DNA mismatch repair protein Msh2-like protein         85.9    1e-15   
emb|CEL63099.1|  DNA mismatch repair protein msh-2 OS=Neurospora ...  85.5    1e-15   Rhizoctonia solani AG-1 IB
gb|AAB59571.1|  Insertion mutation results in premature stop          84.7    1e-15   Homo sapiens [man]
ref|XP_007820842.2|  DNA mismatch repair protein MSH2                 85.5    2e-15   Metarhizium robertsii ARSEF 23
ref|XP_319476.4|  AGAP010282-PA                                       85.5    2e-15   Anopheles gambiae str. PEST
pdb|2O8E|A  Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO A G T MI...  85.5    2e-15   Homo sapiens [man]
gb|AAY15096.1|  unknown                                               84.7    2e-15   Homo sapiens [man]
ref|XP_008529130.1|  PREDICTED: DNA mismatch repair protein Msh2      85.5    2e-15   Equus przewalskii [Przewalski horse]
gb|KID96642.1|  DNA mismatch repair protein MSH2                      85.5    2e-15   Metarhizium majus ARSEF 297
ref|XP_005077361.1|  PREDICTED: DNA mismatch repair protein Msh2      85.5    2e-15   Mesocricetus auratus [Syrian golden hamster]
ref|XP_008252950.1|  PREDICTED: DNA mismatch repair protein Msh2      85.1    2e-15   Oryctolagus cuniculus [domestic rabbit]
gb|KID92464.1|  DNA mismatch repair protein MSH2                      85.5    2e-15   Metarhizium guizhouense ARSEF 977
gb|KID78510.1|  DNA mismatch repair protein MSH2                      85.1    2e-15   Metarhizium brunneum ARSEF 3297
gb|KFY74848.1|  hypothetical protein V499_05146                       85.1    2e-15   Pseudogymnoascus sp. VKM F-103
gb|KFG82318.1|  DNA mismatch repair protein MSH2                      85.1    2e-15   Metarhizium anisopliae
dbj|BAD97004.1|  mutS homolog 2 variant                               85.1    2e-15   Homo sapiens [man]
dbj|BAD96580.1|  mutS homolog 2 variant                               85.1    2e-15   Homo sapiens [man]
gb|KEQ95008.1|  hypothetical protein AUEXF2481DRAFT_40270             85.1    2e-15   Aureobasidium subglaciale EXF-2481
emb|CAH93337.1|  hypothetical protein                                 85.1    2e-15   Pongo abelii [orang utan]
gb|AAB59572.1|  The deletion results in premature stop                84.7    2e-15   Homo sapiens [man]
ref|XP_009235602.1|  PREDICTED: DNA mismatch repair protein Msh2      85.1    2e-15   
gb|AAA82080.1|  similar to S. cerevisiae Msh2p (Swiss-Prot access...  85.1    2e-15   Homo sapiens [man]
ref|XP_003262405.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  85.1    2e-15   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005264389.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  85.1    2e-15   
ref|XP_003839541.1|  similar to DNA mismatch repair protein msh-2     85.1    2e-15   Leptosphaeria maculans JN3
ref|XP_006012929.1|  PREDICTED: DNA mismatch repair protein Msh2-...  84.0    3e-15   
ref|NP_000242.1|  DNA mismatch repair protein Msh2 isoform 1          84.7    3e-15   Homo sapiens [man]
ref|XP_004029250.1|  PREDICTED: DNA mismatch repair protein Msh2      84.7    3e-15   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_003822726.1|  PREDICTED: DNA mismatch repair protein Msh2      84.7    3e-15   Pan paniscus [bonobo]
gb|EAX00213.1|  mutS homolog 2, colon cancer, nonpolyposis type 1...  84.7    3e-15   Homo sapiens [man]
ref|XP_008584424.1|  PREDICTED: DNA mismatch repair protein Msh2      84.7    3e-15   Galeopterus variegatus [Malayan flying lemur]
gb|ETE61002.1|  DNA mismatch repair protein Msh2                      84.7    3e-15   Ophiophagus hannah
ref|XP_003788028.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  84.3    3e-15   
ref|XP_003051522.1|  predicted protein                                84.3    3e-15   [Nectria] haematococca mpVI 77-13-4
emb|CCE29857.1|  probable DNA mismatch repair protein MSH2            84.3    4e-15   Claviceps purpurea 20.1
ref|XP_004792790.1|  PREDICTED: DNA mismatch repair protein Msh2      84.3    4e-15   
ref|XP_007913266.1|  putative dna mismatch repair protein msh-2 p...  84.3    4e-15   Phaeoacremonium minimum UCRPA7
ref|XP_004752924.1|  PREDICTED: DNA mismatch repair protein Msh2      84.3    4e-15   Mustela putorius furo [black ferret]
ref|XP_006986547.1|  PREDICTED: DNA mismatch repair protein Msh2      84.3    4e-15   Peromyscus maniculatus bairdii
ref|XP_008183903.1|  PREDICTED: DNA mismatch repair protein Msh2      84.0    5e-15   Acyrthosiphon pisum
gb|EFZ12092.1|  hypothetical protein SINV_12798                       84.0    5e-15   
ref|XP_004989716.1|  MSH2-Ex5 isoform                                 84.0    5e-15   Salpingoeca rosetta
ref|XP_005895687.1|  PREDICTED: DNA mismatch repair protein Msh2      84.0    5e-15   Bos mutus
ref|NP_001029756.1|  DNA mismatch repair protein Msh2                 84.0    5e-15   Bos taurus [bovine]
ref|XP_006273985.1|  PREDICTED: DNA mismatch repair protein Msh2      84.0    5e-15   Alligator mississippiensis
gb|AAA75027.1|  MutS homolog 2                                        84.0    6e-15   Mus musculus [mouse]
ref|XP_001248166.1|  hypothetical protein CIMG_01937                  84.0    6e-15   Coccidioides immitis RS
gb|AAH50897.1|  MutS homolog 2 (E. coli)                              84.0    6e-15   Mus musculus [mouse]
ref|NP_032654.1|  DNA mismatch repair protein Msh2                    84.0    6e-15   Mus musculus [mouse]
gb|KHO01041.1|  DNA mismatch repair protein MSH2                      84.0    6e-15   Metarhizium album ARSEF 1941
emb|CDP30063.1|  Putative DNA mismatch repair protein msh-2           84.0    6e-15   Podospora anserina S mat+
ref|XP_006048104.1|  PREDICTED: DNA mismatch repair protein Msh2      84.0    6e-15   Bubalus bubalis [domestic water buffalo]
ref|XP_004479774.1|  PREDICTED: DNA mismatch repair protein Msh2      84.0    6e-15   
ref|XP_006638841.1|  PREDICTED: DNA mismatch repair protein Msh2-...  84.0    6e-15   Lepisosteus oculatus
ref|XP_005523323.1|  PREDICTED: DNA mismatch repair protein Msh2      83.6    6e-15   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_003654300.1|  hypothetical protein THITE_2117183               83.6    6e-15   Thielavia terrestris NRRL 8126
ref|XP_004313192.1|  PREDICTED: DNA mismatch repair protein Msh2-...  81.6    7e-15   
ref|XP_011252842.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  83.6    7e-15   Camponotus floridanus
gb|EFN70623.1|  DNA mismatch repair protein Msh2                      83.6    7e-15   Camponotus floridanus
ref|XP_001917820.2|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  83.6    8e-15   
ref|XP_010763729.1|  DNA mismatch repair protein msh-2                83.6    8e-15   Paracoccidioides brasiliensis Pb18
ref|XP_005307393.1|  PREDICTED: DNA mismatch repair protein Msh2      83.6    8e-15   Chrysemys picta bellii
ref|XP_003065360.1|  DNA mismatch repair protein msh-2, putative      83.2    8e-15   Coccidioides posadasii C735 delta SOWgp
ref|XP_010862818.1|  PREDICTED: DNA mismatch repair protein Msh2      83.2    9e-15   Esox lucius
ref|XP_005980704.1|  PREDICTED: DNA mismatch repair protein Msh2      83.2    9e-15   Pantholops hodgsonii [Tibetan antelope]
gb|KIW89382.1|  DNA mismatch repair protein msh-2                     83.2    1e-14   Cladophialophora bantiana CBS 173.52
ref|XP_005686632.1|  PREDICTED: DNA mismatch repair protein Msh2      82.8    1e-14   
ref|XP_007084767.1|  PREDICTED: DNA mismatch repair protein Msh2      82.8    1e-14   Panthera tigris altaica
ref|XP_003984016.2|  PREDICTED: DNA mismatch repair protein Msh2      82.8    1e-14   
ref|XP_007460039.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  82.8    1e-14   Lipotes vexillifer [baiji]
ref|XP_002790205.1|  DNA mismatch repair protein msh-2                82.8    1e-14   Paracoccidioides lutzii Pb01
gb|EMD92836.1|  hypothetical protein COCHEDRAFT_1154553               82.8    1e-14   Bipolaris maydis C5
ref|XP_007460038.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  82.8    1e-14   Lipotes vexillifer [baiji]
ref|XP_007700699.1|  hypothetical protein COCSADRAFT_118766           82.8    1e-14   Bipolaris sorokiniana ND90Pr
ref|XP_008028868.1|  hypothetical protein SETTUDRAFT_43199            82.8    1e-14   Exserohilum turcica Et28A
ref|XP_002583908.1|  DNA mismatch repair protein msh-2                83.2    1e-14   Uncinocarpus reesii 1704
ref|XP_007691816.1|  hypothetical protein COCMIDRAFT_8663             82.8    1e-14   Bipolaris oryzae ATCC 44560
ref|XP_010966048.1|  PREDICTED: DNA mismatch repair protein Msh2      82.8    1e-14   Camelus bactrianus [camel]
ref|XP_006216498.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  82.4    2e-14   Vicugna pacos
gb|KEQ79885.1|  DNA mismatch repair protein-like protein msh-2        82.4    2e-14   Aureobasidium pullulans EXF-150
gb|ELV13655.1|  DNA mismatch repair protein Msh2                      81.6    2e-14   Tupaia chinensis
ref|XP_001382178.3|  PREDICTED: DNA mismatch repair protein Msh2      82.4    2e-14   
ref|XP_004436729.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  82.4    2e-14   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|ENH88976.1|  DNA mismatch repair protein                           82.4    2e-14   
ref|XP_007839003.1|  DNA mismatch repair protein msh-2                82.4    2e-14   Pestalotiopsis fici W106-1
ref|XP_009560886.1|  PREDICTED: DNA mismatch repair protein Msh2      82.4    2e-14   Cuculus canorus
emb|CDQ87856.1|  unnamed protein product                              82.4    2e-14   Oncorhynchus mykiss
gb|EDM02635.1|  mutS homolog 2 (E. coli)                              82.4    2e-14   Rattus norvegicus [brown rat]
ref|XP_007190111.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  82.4    2e-14   Balaenoptera acutorostrata scammoni
ref|XP_004356558.1|  DNA mismatch repair protein msh2, putative       82.0    2e-14   Acanthamoeba castellanii str. Neff
ref|XP_003351363.1|  MSH2 protein                                     82.0    2e-14   Sordaria macrospora k-hell
gb|EJT99314.1|  DNA mismatch repair protein                           82.0    2e-14   Dacryopinax primogenitus
ref|XP_006839493.1|  PREDICTED: DNA mismatch repair protein Msh2      82.0    2e-14   Chrysochloris asiatica
ref|XP_006162412.1|  PREDICTED: DNA mismatch repair protein Msh2      82.0    2e-14   Tupaia chinensis
gb|KIW11347.1|  DNA mismatch repair protein msh-2                     82.0    2e-14   Exophiala spinifera
ref|XP_004403444.1|  PREDICTED: DNA mismatch repair protein Msh2      82.0    2e-14   Odobenus rosmarus divergens
gb|ETN67363.1|  DNA mismatch repair protein spellchecker 1            82.0    2e-14   Anopheles darlingi [American malaria mosquito]
gb|KFH40924.1|  DNA mismatch repair protein msh-like protein          82.0    2e-14   Acremonium chrysogenum ATCC 11550
ref|XP_008698664.1|  PREDICTED: DNA mismatch repair protein Msh2      82.0    2e-14   Ursus maritimus [white bear]
ref|XP_006736893.1|  PREDICTED: DNA mismatch repair protein Msh2      82.0    2e-14   Leptonychotes weddellii
emb|CCT67360.1|  probable DNA mismatch repair protein MSH2            82.0    2e-14   Fusarium fujikuroi IMI 58289
ref|XP_001698121.1|  MSH2-like protein                                78.6    2e-14   Chlamydomonas reinhardtii
gb|KIW37346.1|  DNA mismatch repair protein msh-2                     82.0    2e-14   Exophiala oligosperma
gb|ERZ97731.1|  hypothetical protein GLOINDRAFT_39497                 82.0    2e-14   
ref|XP_007742215.1|  DNA mismatch repair protein msh-2                82.0    3e-14   Cladophialophora psammophila CBS 110553
gb|KIL91748.1|  dna mismatch repair protein msh-2                     82.0    3e-14   Fusarium avenaceum
ref|XP_004686280.1|  PREDICTED: DNA mismatch repair protein Msh2      82.0    3e-14   Condylura cristata
ref|XP_538482.2|  PREDICTED: DNA mismatch repair protein Msh2 iso...  82.0    3e-14   Canis lupus familiaris [dogs]
ref|XP_008100910.1|  PREDICTED: DNA mismatch repair protein Msh2      82.0    3e-14   Anolis carolinensis [Carolina anole]
ref|XP_959643.1|  DNA mismatch repair protein msh-2                   81.6    3e-14   Neurospora crassa OR74A
ref|XP_011324987.1|  DNA mismatch repair protein msh-2                81.6    3e-14   Fusarium graminearum PH-1
ref|XP_009252557.1|  hypothetical protein FPSE_01162                  81.6    3e-14   Fusarium pseudograminearum CS3096
ref|XP_009853531.1|  hypothetical protein NEUTE1DRAFT_124099          81.6    3e-14   Neurospora tetrasperma FGSC 2508
ref|NP_001182286.1|  DNA mismatch repair protein Msh2                 81.6    3e-14   
gb|EMS21732.1|  DNA mismatch repair protein MSH2                      81.6    3e-14   
gb|EWG43599.1|  DNA mismatch repair protein msh-2                     81.6    3e-14   
ref|XP_007278210.1|  DNA mismatch repair protein                      81.3    4e-14   
dbj|GAM39055.1|  DNA mismatch repair protein                          81.3    4e-14   
ref|XP_005354889.1|  PREDICTED: DNA mismatch repair protein Msh2      81.3    4e-14   
gb|ELK14721.1|  DNA mismatch repair protein Msh2                      80.9    4e-14   
ref|XP_008821271.1|  PREDICTED: DNA mismatch repair protein Msh2      81.3    4e-14   
ref|XP_007942597.1|  PREDICTED: DNA mismatch repair protein Msh2      81.3    4e-14   
ref|XP_004265025.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  81.3    4e-14   
ref|XP_004265024.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  81.3    4e-14   
ref|XP_011494385.1|  PREDICTED: DNA mismatch repair protein Msh2      81.3    4e-14   
gb|EXM25758.1|  DNA mismatch repair protein msh-2                     81.3    4e-14   
gb|EXK97599.1|  DNA mismatch repair protein msh-2                     81.3    5e-14   
gb|EXA42602.1|  DNA mismatch repair protein msh-2                     81.3    5e-14   
emb|CCX33776.1|  Similar to DNA mismatch repair protein msh-2; ac...  81.3    5e-14   
gb|KFH66052.1|  DNA mismatch repair protein MSH2                      81.3    5e-14   
ref|XP_007106909.1|  PREDICTED: DNA mismatch repair protein Msh2      81.3    5e-14   
gb|EWZ92869.1|  DNA mismatch repair protein msh-2                     81.3    5e-14   
gb|EGU76220.1|  hypothetical protein FOXB_13292                       81.3    5e-14   
gb|EMT68617.1|  DNA mismatch repair protein msh-2                     80.9    5e-14   
ref|XP_006909676.1|  PREDICTED: DNA mismatch repair protein Msh2      81.3    5e-14   
emb|CCF52621.1|  probable DNA mismatch repair protein MSH2            81.3    5e-14   
gb|EYE98224.1|  hypothetical protein EURHEDRAFT_513251                81.3    5e-14   
ref|XP_011359618.1|  PREDICTED: DNA mismatch repair protein Msh2      80.9    5e-14   
ref|XP_002912468.1|  PREDICTED: DNA mismatch repair protein Msh2      80.9    5e-14   
gb|ENH68333.1|  DNA mismatch repair protein msh-2                     80.9    5e-14   
ref|XP_002847933.1|  DNA mismatch repair protein msh-2                80.9    5e-14   
gb|KIX07184.1|  DNA mismatch repair protein msh-2                     80.9    5e-14   
ref|XP_004369541.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  80.9    5e-14   
ref|XP_004877693.1|  PREDICTED: DNA mismatch repair protein Msh2      80.9    5e-14   
gb|EEQ87949.1|  DNA mismatch repair protein msh-2                     80.9    5e-14   
gb|EUN31758.1|  hypothetical protein COCVIDRAFT_12080                 80.9    6e-14   
ref|XP_007707394.1|  hypothetical protein COCCADRAFT_83306            80.9    6e-14   
dbj|GAD93269.1|  hypothetical protein AN5006.2                        80.9    6e-14   
gb|KIW03011.1|  DNA mismatch repair protein msh-2                     80.5    7e-14   
ref|XP_011389403.1|  putative DNA mismatch repair protein MSH2        80.5    7e-14   
ref|XP_003176515.1|  DNA mismatch repair protein msh-2                80.5    7e-14   
emb|CDI57015.1|  probable DNA mismatch repair protein MSH2            80.5    7e-14   
ref|XP_003718090.1|  DNA mismatch repair protein msh-2                80.5    8e-14   
ref|XP_007801287.1|  DNA mismatch repair protein msh-2                80.1    9e-14   
ref|XP_008087362.1|  DNA repair protein MutS, III                     80.1    9e-14   
ref|XP_009013947.1|  hypothetical protein HELRODRAFT_190918           80.1    1e-13   
ref|XP_007294721.1|  MutS domain V                                    80.1    1e-13   
ref|XP_001227541.1|  DNA mismatch repair protein msh-2                80.1    1e-13   
gb|KIY03137.1|  DNA mismatch repair protein msh-2                     80.1    1e-13   
gb|EWC45512.1|  DNA mismatch repair protein msh-2                     80.1    1e-13   
ref|XP_003303190.1|  hypothetical protein PTT_15308                   80.1    1e-13   
ref|XP_002757838.2|  PREDICTED: DNA mismatch repair protein Msh2      80.1    1e-13   
gb|KIW27987.1|  DNA mismatch repair protein msh-2                     80.1    1e-13   
gb|EGD97064.1|  DNA mismatch repair protein Msh2                      79.7    1e-13   
gb|EGE01907.1|  DNA mismatch repair protein msh-2                     79.7    1e-13   
dbj|GAN01926.1|  hypothetical protein MAM1_0014c01363                 76.6    1e-13   
ref|XP_004337972.1|  DNA mismatch repair protein msh2, putative       79.7    2e-13   
ref|XP_007730328.1|  DNA mismatch repair protein msh-2                79.3    2e-13   
ref|XP_010775985.1|  PREDICTED: DNA mismatch repair protein Msh2      79.3    2e-13   
gb|KIV82249.1|  DNA mismatch repair protein msh-2                     79.3    2e-13   
ref|XP_003977228.1|  PREDICTED: DNA mismatch repair protein Msh2-...  79.3    2e-13   
ref|XP_004006017.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  79.3    2e-13   
ref|XP_001941863.1|  DNA mismatch repair protein MSH2                 79.3    2e-13   
ref|XP_008726867.1|  DNA mismatch repair protein msh-2                79.3    2e-13   
ref|XP_003238945.1|  DNA mismatch repair protein Msh2                 79.3    2e-13   
gb|EHK23308.1|  hypothetical protein TRIVIDRAFT_36626                 79.3    2e-13   
ref|XP_011403621.1|  PREDICTED: DNA mismatch repair protein Msh2-...  79.3    2e-13   
emb|CEJ91980.1|  Putative DNA mismatch repair protein                 79.3    2e-13   
gb|KDB22187.1|  DNA mismatch repair protein msh-2                     79.3    2e-13   
ref|XP_009221861.1|  DNA mismatch repair protein msh-2                79.3    2e-13   
ref|XP_007756594.1|  DNA mismatch repair protein msh-2                79.3    2e-13   
gb|EEH08956.1|  DNA mismatch repair protein msh-2                     79.3    2e-13   
ref|XP_003851957.1|  hypothetical protein MYCGRDRAFT_72798            79.3    2e-13   
ref|XP_002558363.1|  Pc12g15640                                       79.3    2e-13   
ref|XP_003012592.1|  hypothetical protein ARB_01205                   79.3    2e-13   
gb|KDN65656.1|  putative MutS domain V                                79.3    2e-13   
ref|XP_002838490.1|  hypothetical protein                             79.0    2e-13   
emb|CCF31929.1|  DNA mismatch repair protein msh-2                    79.0    2e-13   
ref|XP_005816304.1|  PREDICTED: DNA mismatch repair protein Msh2-...  79.0    2e-13   
emb|CDM34089.1|  DNA mismatch repair protein msh-2                    79.0    2e-13   
ref|XP_007534328.1|  PREDICTED: DNA mismatch repair protein Msh2      79.0    2e-13   
dbj|GAA94508.1|  hypothetical protein E5Q_01160                       79.0    2e-13   
gb|KIW75281.1|  DNA mismatch repair protein msh-2                     79.0    3e-13   
gb|EHK43745.1|  hypothetical protein TRIATDRAFT_127655                78.6    3e-13   
ref|XP_007927987.1|  hypothetical protein MYCFIDRAFT_49240            78.6    3e-13   
ref|XP_001799798.1|  hypothetical protein SNOG_09508                  79.0    3e-13   
ref|XP_009656577.1|  DNA mismatch repair protein msh-2                78.6    3e-13   
ref|XP_007722093.1|  DNA mismatch repair protein msh-2                78.6    3e-13   
gb|KFZ12577.1|  hypothetical protein V501_04143                       78.6    3e-13   
gb|KGO70394.1|  DNA mismatch repair protein, MSH2                     78.6    3e-13   
gb|KDR09158.1|  hypothetical protein L798_01274                       78.2    3e-13   
gb|KIW50624.1|  DNA mismatch repair protein msh-2                     78.2    4e-13   
ref|XP_002144239.1|  DNA mismatch repair protein Msh2, putative       78.2    4e-13   
gb|KIN00808.1|  hypothetical protein OIDMADRAFT_123678                78.2    4e-13   
ref|XP_008594611.1|  DNA mismatch repair protein MSH2                 78.2    4e-13   
gb|EEH17317.2|  DNA mismatch repair protein msh-2                     78.6    4e-13   
gb|EST05312.1|  putative DNA mismatch repair protein MSH2             78.2    4e-13   
ref|XP_001539990.1|  DNA mismatch repair protein msh-2                78.2    4e-13   
gb|EER44281.1|  DNA mismatch repair protein                           78.2    4e-13   
gb|EPB90257.1|  DNA mismatch repair protein MSH2                      78.2    4e-13   
ref|XP_003020589.1|  hypothetical protein TRV_05311                   78.2    4e-13   
gb|KIW68979.1|  DNA mismatch repair protein msh-2                     78.2    4e-13   
ref|XP_002341306.1|  DNA mismatch repair protein Msh2, putative       78.2    4e-13   
ref|XP_008302017.1|  PREDICTED: DNA mismatch repair protein Msh2      78.2    5e-13   
gb|EKV06815.1|  DNA mismatch repair protein Msh2, putative            78.2    5e-13   
gb|KGO42203.1|  DNA mismatch repair protein, MSH2                     77.8    5e-13   
ref|XP_007602362.1|  DNA mismatch repair protein msh-2                77.8    5e-13   
ref|XP_008312168.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  77.8    5e-13   
ref|XP_008312167.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  77.8    5e-13   
ref|XP_002426440.1|  DNA mismatch repair protein MsH2, putative       77.8    6e-13   
ref|XP_003007209.1|  DNA mismatch repair protein msh-2                77.8    6e-13   
ref|XP_002612619.1|  hypothetical protein BRAFLDRAFT_280395           77.8    6e-13   
ref|NP_112320.1|  DNA mismatch repair protein Msh2                    77.8    6e-13   
ref|XP_001904760.1|  hypothetical protein                             77.8    6e-13   
ref|XP_004699807.1|  PREDICTED: DNA mismatch repair protein Msh2      77.8    6e-13   
gb|ETS62048.1|  hypothetical protein PaG_03605                        77.4    7e-13   
ref|XP_011120137.1|  hypothetical protein AOL_s00054g519              77.4    7e-13   
dbj|GAC97618.1|  hypothetical protein PHSY_005204                     77.4    8e-13   
ref|XP_004080503.1|  PREDICTED: DNA mismatch repair protein Msh2      77.4    8e-13   
emb|CEP08620.1|  hypothetical protein                                 77.0    9e-13   
ref|XP_006778685.1|  PREDICTED: DNA mismatch repair protein Msh2      77.0    1e-12   
ref|XP_003441937.1|  PREDICTED: DNA mismatch repair protein Msh2-...  77.0    1e-12   
ref|XP_007562484.1|  PREDICTED: DNA mismatch repair protein Msh2      76.6    1e-12   
ref|XP_008435300.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  76.6    1e-12   
ref|XP_006083438.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  76.6    1e-12   
ref|XP_007231046.1|  PREDICTED: DNA mismatch repair protein Msh2-...  75.9    1e-12   
dbj|GAK65717.1|  DNA mismatch repair protein                          76.6    1e-12   
ref|XP_004618654.1|  PREDICTED: DNA mismatch repair protein Msh2      76.6    1e-12   
ref|XP_006880962.1|  PREDICTED: DNA mismatch repair protein Msh2      76.6    1e-12   
ref|XP_010614096.1|  PREDICTED: DNA mismatch repair protein Msh2      76.6    1e-12   
emb|CEP63431.1|  LALA0S08e02300g1_1                                   76.3    2e-12   
ref|XP_005864867.1|  PREDICTED: DNA mismatch repair protein Msh2      76.3    2e-12   
ref|XP_011112835.1|  hypothetical protein H072_7062                   76.3    2e-12   
gb|KDE04567.1|  DNA mismatch repair protein MSH2                      76.3    2e-12   
ref|XP_007626983.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  76.3    2e-12   
ref|XP_001818204.1|  DNA mismatch repair protein msh-2                76.3    2e-12   
gb|EIT81026.1|  mismatch repair ATPase MSH2                           76.3    2e-12   
ref|XP_004660261.1|  PREDICTED: DNA mismatch repair protein Msh2      75.9    2e-12   
emb|CBQ73427.1|  probable DNA mismatch repair protein MSH2            75.9    2e-12   
ref|XP_002126892.1|  PREDICTED: DNA mismatch repair protein Msh2      75.9    2e-12   
ref|XP_002627806.1|  DNA mismatch repair protein msh-2                75.9    2e-12   
dbj|GAC75984.1|  hypothetical protein PANT_19d00052                   72.0    2e-12   
ref|XP_001270985.1|  DNA mismatch repair protein Msh2, putative       75.9    2e-12   
gb|EFQ36236.1|  MutS domain V                                         75.9    2e-12   
ref|XP_001516305.3|  PREDICTED: DNA mismatch repair protein Msh2-...  74.3    3e-12   
gb|KGQ10643.1|  DNA mismatch repair protein msh-2                     75.5    3e-12   
ref|XP_006791330.1|  PREDICTED: LOW QUALITY PROTEIN: DNA mismatch...  75.5    3e-12   
ref|XP_001213686.1|  DNA mismatch repair protein msh-2                75.5    3e-12   
ref|XP_010734927.1|  PREDICTED: DNA mismatch repair protein Msh2      75.5    3e-12   
gb|KDQ06534.1|  hypothetical protein BOTBODRAFT_140987                75.1    4e-12   
gb|EFX72912.1|  mismatch repair ATPase Msh2                           75.1    5e-12   
gb|ETS02600.1|  DNA mismatch repair protein MSH2                      75.1    5e-12   
gb|KEF62230.1|  DNA mismatch repair protein msh-2                     75.1    5e-12   
gb|EPS30059.1|  hypothetical protein PDE_05009                        74.7    5e-12   
gb|KIV96281.1|  DNA mismatch repair protein msh-2                     74.7    5e-12   
gb|AAI65693.1|  Msh2 protein                                          74.7    5e-12   
gb|AAL04169.1|AF412833_1  mismatch repair protein Msh2                74.7    5e-12   
ref|NP_998689.1|  DNA mismatch repair protein Msh2                    74.7    5e-12   
ref|XP_006692163.1|  DNA mismatch repair protein msh2-like protein    74.7    6e-12   
ref|XP_008160680.1|  PREDICTED: DNA mismatch repair protein Msh2      74.3    6e-12   
gb|KEY79939.1|  DNA mismatch repair protein Msh2                      74.3    7e-12   
gb|EKD03209.1|  DNA mismatch repair protein MSH2                      71.2    8e-12   
emb|CAF91023.1|  unnamed protein product                              74.3    8e-12   
gb|KDN35895.1|  DNA mismatch repair protein                           74.3    9e-12   
ref|XP_754634.1|  DNA mismatch repair protein Msh2                    73.9    1e-11   
ref|XP_001263475.1|  DNA mismatch repair protein Msh2, putative       73.9    1e-11   
ref|XP_011294478.1|  PREDICTED: DNA mismatch repair protein spell...  73.6    1e-11   
ref|XP_006463889.1|  hypothetical protein AGABI2DRAFT_187339          73.6    1e-11   
ref|XP_004561210.1|  PREDICTED: DNA mismatch repair protein Msh2-...  73.6    1e-11   
ref|XP_007333529.1|  hypothetical protein AGABI1DRAFT_131867          73.6    1e-11   
ref|XP_005736573.1|  PREDICTED: DNA mismatch repair protein Msh2-...  73.6    1e-11   
ref|XP_006965085.1|  DNA mismatch repair protein                      73.6    1e-11   
gb|EIE91304.1|  hypothetical protein RO3G_16015                       73.2    2e-11   
ref|XP_009159064.1|  DNA mismatch repair protein msh-2                73.2    2e-11   
ref|XP_007515224.1|  DNA mismatch repair protein msh-2                73.2    2e-11   
ref|XP_011398677.1|  DNA mismatch repair protein MSH2                 72.8    2e-11   
ref|XP_007308737.1|  DNA mismatch repair protein                      72.8    2e-11   
emb|CCA69819.1|  probable DNA mismatch repair protein MSH2            72.8    3e-11   
gb|EMF12393.1|  DNA mismatch repair protein MSH2                      72.4    3e-11   
ref|XP_003499584.1|  PREDICTED: DNA mismatch repair protein Msh2 ...  72.0    4e-11   
ref|XP_005919534.1|  PREDICTED: DNA mismatch repair protein Msh2-...  72.0    4e-11   
ref|XP_007263499.1|  DNA mismatch repair protein MSH2                 72.0    4e-11   
ref|XP_662610.1|  hypothetical protein AN5006.2                       72.0    5e-11   
gb|KIJ24074.1|  hypothetical protein M422DRAFT_39300                  71.6    6e-11   
ref|XP_005139513.1|  PREDICTED: DNA mismatch repair protein Msh2-...  67.4    6e-11   
ref|XP_001867917.1|  DNA mismatch repair protein spellchecker 1       71.2    7e-11   
ref|XP_005152107.1|  PREDICTED: DNA mismatch repair protein Msh2      71.2    7e-11   
ref|XP_001749922.1|  hypothetical protein                             70.9    9e-11   
ref|XP_010073462.1|  PREDICTED: DNA mismatch repair protein Msh2      70.9    9e-11   
gb|EME42400.1|  hypothetical protein DOTSEDRAFT_54773                 70.9    1e-10   
ref|XP_010003301.1|  PREDICTED: DNA mismatch repair protein Msh2      70.9    1e-10   
tpe|CBF76294.1|  TPA: DNA mismatch repair protein Msh2, putative ...  70.5    1e-10   
ref|XP_003683593.1|  hypothetical protein TPHA_0A00740                70.9    1e-10   
gb|EJT47892.1|  DNA mismatch repair protein MSH2                      67.8    1e-10   
gb|KDQ60242.1|  hypothetical protein JAAARDRAFT_32621                 70.5    1e-10   
ref|XP_009469498.1|  PREDICTED: DNA mismatch repair protein Msh2      70.5    1e-10   
ref|XP_009266341.1|  DNA mismatch repair protein msh-2                70.1    2e-10   
ref|XP_002089289.1|  GE19033                                          70.1    2e-10   
gb|KIR45249.1|  DNA mismatch repair protein MSH2                      70.1    2e-10   
ref|XP_004178599.1|  hypothetical protein TBLA_0B02380                70.1    2e-10   
ref|XP_005430770.1|  PREDICTED: DNA mismatch repair protein Msh2      70.1    2e-10   
ref|XP_005043238.1|  PREDICTED: DNA mismatch repair protein Msh2      69.7    2e-10   
ref|XP_007416313.1|  hypothetical protein MELLADRAFT_118031           69.7    2e-10   
ref|XP_006666559.1|  DNA mismatch repair protein MSH2                 69.7    2e-10   
ref|XP_005242465.1|  PREDICTED: DNA mismatch repair protein Msh2      69.7    3e-10   
ref|XP_010139015.1|  PREDICTED: DNA mismatch repair protein Msh2      69.7    3e-10   
ref|XP_005440338.1|  PREDICTED: DNA mismatch repair protein Msh2      69.3    3e-10   
ref|XP_002035824.1|  GM15583                                          68.9    3e-10   
ref|XP_001968883.1|  GG25117                                          69.3    3e-10   
ref|XP_009910837.1|  PREDICTED: DNA mismatch repair protein Msh2-...  67.4    3e-10   
ref|XP_002079451.1|  GD23963                                          69.3    3e-10   
ref|XP_009698903.1|  PREDICTED: DNA mismatch repair protein Msh2-...  67.4    3e-10   
ref|XP_009476196.1|  PREDICTED: DNA mismatch repair protein Msh2-...  67.4    3e-10   
emb|CEG81649.1|  Putative DNA mismatch repair protein MSH2            68.6    3e-10   
dbj|GAA84949.1|  DNA mismatch repair protein Msh2                     68.9    3e-10   
gb|KFQ16552.1|  DNA mismatch repair protein Msh2                      68.9    4e-10   
gb|KFQ65385.1|  DNA mismatch repair protein Msh2                      68.9    4e-10   
gb|KFW62051.1|  DNA mismatch repair protein Msh2                      68.9    4e-10   
gb|KFM11805.1|  DNA mismatch repair protein Msh2                      68.9    4e-10   
ref|XP_007772591.1|  DNA mismatch repair protein                      68.9    4e-10   
gb|KFU95183.1|  DNA mismatch repair protein Msh2                      68.9    4e-10   
gb|AHZ64224.1|  FI23518p1                                             68.9    4e-10   
gb|KFO10213.1|  DNA mismatch repair protein Msh2                      68.9    4e-10   
gb|KFP10590.1|  DNA mismatch repair protein Msh2                      68.9    4e-10   



>gb|KDO64510.1| hypothetical protein CISIN_1g002306mg [Citrus sinensis]
Length=888

 Score =   277 bits (708),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  EEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTT  318
            +EQNKLPELKLDAKQA+GFLSF+KTLP+DTR VRFFDRRDYYTAHG NATFIAKTYYHTT
Sbjct  3    DEQNKLPELKLDAKQARGFLSFYKTLPNDTRAVRFFDRRDYYTAHGENATFIAKTYYHTT  62

Query  319  TALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNL  498
            TALRQLG+G  A+SSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNWRLVK+GTPGNL
Sbjct  63   TALRQLGTGSDALSSVSVSKNMFETIARDLLLERTDHTLELYEGSGSNWRLVKSGTPGNL  122

Query  499  GSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            GS+ED+LFANNEMQD+PVIVAL PN RENGC +GLGYVDLT
Sbjct  123  GSYEDVLFANNEMQDTPVIVALFPNFRENGCTIGLGYVDLT  163



>gb|KDO64509.1| hypothetical protein CISIN_1g002306mg [Citrus sinensis]
Length=938

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  EEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTT  318
            +EQNKLPELKLDAKQA+GFLSF+KTLP+DTR VRFFDRRDYYTAHG NATFIAKTYYHTT
Sbjct  3    DEQNKLPELKLDAKQARGFLSFYKTLPNDTRAVRFFDRRDYYTAHGENATFIAKTYYHTT  62

Query  319  TALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNL  498
            TALRQLG+G  A+SSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNWRLVK+GTPGNL
Sbjct  63   TALRQLGTGSDALSSVSVSKNMFETIARDLLLERTDHTLELYEGSGSNWRLVKSGTPGNL  122

Query  499  GSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            GS+ED+LFANNEMQD+PVIVAL PN RENGC +GLGYVDLT
Sbjct  123  GSYEDVLFANNEMQDTPVIVALFPNFRENGCTIGLGYVDLT  163



>ref|XP_006440914.1| hypothetical protein CICLE_v10018746mg [Citrus clementina]
 gb|ESR54154.1| hypothetical protein CICLE_v10018746mg [Citrus clementina]
Length=938

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  EEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTT  318
            +EQNKLPELKLDAKQA+GFLSF+KTLP+DTR VRFFDRRDYYTAHG NATFIAKTYYHTT
Sbjct  3    DEQNKLPELKLDAKQARGFLSFYKTLPNDTRAVRFFDRRDYYTAHGENATFIAKTYYHTT  62

Query  319  TALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNL  498
            TALRQLG+G  A+SSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNWRLVK+GTPGNL
Sbjct  63   TALRQLGTGSDALSSVSVSKNMFETIARDLLLERTDHTLELYEGSGSNWRLVKSGTPGNL  122

Query  499  GSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            GS+ED+LFANNEMQD+PVIVAL PN RENGC +GLGYVDLT
Sbjct  123  GSYEDVLFANNEMQDTPVIVALFPNFRENGCTIGLGYVDLT  163



>gb|KDP20084.1| hypothetical protein JCGZ_05853 [Jatropha curcas]
Length=936

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  136  FEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHT  315
             +E+NKLPELKLDAKQAQGFLSFFKTLP D R VR FDRR+YYT+HG NATFIAKTYYHT
Sbjct  1    MDEENKLPELKLDAKQAQGFLSFFKTLPDDPRAVRVFDRREYYTSHGENATFIAKTYYHT  60

Query  316  TTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGN  495
            TTALRQLGSGP A+SSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNWRLVK+GTPGN
Sbjct  61   TTALRQLGSGPNALSSVSISKNMFETIARDLLLERTDHTLELYEGSGSNWRLVKSGTPGN  120

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            LGSFE++LFANNEMQD+PV+VAL+PN R+NGC +GL YVDLT
Sbjct  121  LGSFEEVLFANNEMQDTPVVVALIPNFRDNGCTIGLSYVDLT  162



>ref|XP_006485749.1| PREDICTED: DNA mismatch repair protein MSH2-like [Citrus sinensis]
Length=938

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +1

Query  139  EEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTT  318
            +EQNKLPELKLDAKQA+GFLSF+KTLP+DTR VRFFDRRDYYTAHG NATFIAKTYYHTT
Sbjct  3    DEQNKLPELKLDAKQARGFLSFYKTLPNDTRAVRFFDRRDYYTAHGENATFIAKTYYHTT  62

Query  319  TALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNL  498
            TALRQLG+G  A+SSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNWRLVK+GTPGNL
Sbjct  63   TALRQLGTGSDALSSVSVSKNMFETIARDLLLERTDHTLELYEGSGSNWRLVKSGTPGNL  122

Query  499  GSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            GS+ED+LFANNEMQD+PV+VAL PN RENGC +GLGYVDLT
Sbjct  123  GSYEDVLFANNEMQDTPVVVALFPNFRENGCTIGLGYVDLT  163



>gb|EYU19022.1| hypothetical protein MIMGU_mgv1a000954mg [Erythranthe guttata]
Length=934

 Score =   275 bits (704),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M + FEEQNKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDRRDYYT HG NATFIAKT
Sbjct  1    MGDNFEEQNKLPELKLDAKQAQGFLSFFKTLPNDPRAVRFFDRRDYYTVHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTA+RQ+GSG  AISSVS+S+N FET+ARDLLLERTDHTLELYEGSGSNWRLVK+G
Sbjct  61   YYHTTTAVRQIGSGSDAISSVSVSKNTFETVARDLLLERTDHTLELYEGSGSNWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFE+ILFANNEMQDSPVIVA+V N RENGC VGL YVDLT
Sbjct  121  TPGNLGSFEEILFANNEMQDSPVIVAVVANFRENGCTVGLSYVDLT  166



>ref|XP_010663545.1| PREDICTED: DNA mismatch repair protein MSH2 isoform X1 [Vitis 
vinifera]
 emb|CBI15412.3| unnamed protein product [Vitis vinifera]
Length=945

 Score =   276 bits (705),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD+  ++ +KLPELKLDAKQAQGFLSFFKTLP D R VRFFDRRDYYTAHG NATFIAKT
Sbjct  1    MDQDSQDHSKLPELKLDAKQAQGFLSFFKTLPRDPRAVRFFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG   ISSVS+S+NMFETIAR+LLLERTDHTLELYEGSGSNWRLVK+G
Sbjct  61   YYHTTTALRQLGSGSDGISSVSVSKNMFETIARNLLLERTDHTLELYEGSGSNWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFED+LFANNEMQDSPVIVAL PN RENGC VGLG+VDLT
Sbjct  121  TPGNLGSFEDVLFANNEMQDSPVIVALFPNFRENGCTVGLGFVDLT  166



>ref|XP_006354733.1| PREDICTED: DNA mismatch repair protein MSH2-like [Solanum tuberosum]
Length=943

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDEKFEEQ KLPELKLDA+QAQGFLSFFKTLP D R VR FDRRDYYTAHG++ATFIAKT
Sbjct  1    MDEKFEEQGKLPELKLDARQAQGFLSFFKTLPKDVRAVRLFDRRDYYTAHGDDATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLG+G GA+SSVS+SRNMFETIARD+LLER D TLELYEGSGSNW+LVK+G
Sbjct  61   YYHTTTALRQLGNGVGALSSVSVSRNMFETIARDILLERMDRTLELYEGSGSNWKLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGN GSFEDILFANNEMQDSP IVAL P   +NGC VGLGYVD+T
Sbjct  121  TPGNFGSFEDILFANNEMQDSPAIVALAPKFDQNGCTVGLGYVDIT  166



>emb|CDO98471.1| unnamed protein product [Coffea canephora]
Length=939

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/166 (87%), Positives = 154/166 (93%), Gaps = 2/166 (1%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD+  EEQ+KLPE KLDAKQAQGFLSFFKTLPSD R VRFFDRRDYYTAHG NATFIAKT
Sbjct  1    MDD--EEQSKLPEFKLDAKQAQGFLSFFKTLPSDARAVRFFDRRDYYTAHGENATFIAKT  58

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG GAISSVS+S+NMFETIARDLLLERTDHTLELYEG+GSNWRLVK+G
Sbjct  59   YYHTTTALRQLGSGSGAISSVSVSKNMFETIARDLLLERTDHTLELYEGNGSNWRLVKSG  118

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGN+GSFEDILFANNEMQ+SPVI ALVPN REN C +GL Y+DLT
Sbjct  119  TPGNIGSFEDILFANNEMQNSPVIAALVPNFRENVCTIGLAYLDLT  164



>ref|XP_002511977.1| DNA mismatch repair protein MSH2, putative [Ricinus communis]
 gb|EEF50646.1| DNA mismatch repair protein MSH2, putative [Ricinus communis]
Length=936

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  136  FEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHT  315
             +E NKLPELKLDAKQAQGFLSFFKTLP D R VR FDRRDYYT+HG NATFIAKTYYHT
Sbjct  1    MDEDNKLPELKLDAKQAQGFLSFFKTLPHDPRAVRVFDRRDYYTSHGENATFIAKTYYHT  60

Query  316  TTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGN  495
            TTALRQLGSGP  +SSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNWRLVK+GTPGN
Sbjct  61   TTALRQLGSGPDGLSSVSISKNMFETIARDLLLERTDHTLELYEGSGSNWRLVKSGTPGN  120

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            LGSFED+LFANNEMQDSP + A++PN RENGC +GLGYVDLT
Sbjct  121  LGSFEDVLFANNEMQDSPAVAAVIPNFRENGCSIGLGYVDLT  162



>ref|NP_001234067.1| mismatch repair protein [Solanum lycopersicum]
 gb|ADG85112.1| mismatch repair protein [Solanum lycopersicum]
Length=943

 Score =   273 bits (697),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE FE+Q KLPELKLDA+QAQGFLSFFKTLP D R VR FDRRDYYTAHG++ATFIAKT
Sbjct  1    MDENFEKQGKLPELKLDARQAQGFLSFFKTLPKDVRAVRLFDRRDYYTAHGDDATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLG+G GA+SSVS+SRNMFETIARD+LLER D TLELYEGSGSNW+LVK+G
Sbjct  61   YYHTTTALRQLGNGVGALSSVSVSRNMFETIARDILLERMDRTLELYEGSGSNWKLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGN GSFEDILFANNEMQDSPVIVAL P   +NGC VGLGYVD+T
Sbjct  121  TPGNFGSFEDILFANNEMQDSPVIVALAPKFDQNGCTVGLGYVDIT  166



>ref|XP_007209075.1| hypothetical protein PRUPE_ppa000981mg [Prunus persica]
 gb|EMJ10274.1| hypothetical protein PRUPE_ppa000981mg [Prunus persica]
Length=942

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD  FE+Q+KLPELKLDAKQ+QGFLSFFKTLP D R +R FDRRDYYTAHG NATFIAKT
Sbjct  1    MDANFEDQSKLPELKLDAKQSQGFLSFFKTLPHDPRPIRLFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+S+NMFETIARDLLLERTDHTLE+YEGSGS+WRLVK+G
Sbjct  61   YYRTTTALRQLGSGLDGLSSVSVSKNMFETIARDLLLERTDHTLEIYEGSGSSWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFED+LFANN+MQD+PV+VAL+PN RENGC VGLGYVDLT
Sbjct  121  TPGNLGSFEDVLFANNDMQDTPVVVALLPNFRENGCTVGLGYVDLT  166



>ref|XP_006406595.1| hypothetical protein EUTSA_v10020006mg [Eutrema salsugineum]
 gb|ESQ48048.1| hypothetical protein EUTSA_v10020006mg [Eutrema salsugineum]
Length=937

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEEQNKLPELKLDAKQAQGFLSFFKTLP+D+R VRFFDR+ YYTAHG N+ FIAKT
Sbjct  1    MEGNFEEQNKLPELKLDAKQAQGFLSFFKTLPTDSRAVRFFDRKGYYTAHGENSIFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  A+SSVS+S+NMFETIARDLLLER DHTLELYEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLGSGSNALSSVSISKNMFETIARDLLLERNDHTLELYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V+L PN +E+ CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSLFPNFQESRCVIGMAYVDLT  166



>ref|XP_008351910.1| PREDICTED: DNA mismatch repair protein MSH2-like [Malus domestica]
Length=762

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD  FE+ +KLPELKLDAKQ+QGFLSFFKTLP+D+R +R FDRRDYYTAHG NATFIAKT
Sbjct  1    MDANFEDHSKLPELKLDAKQSQGFLSFFKTLPNDSRAIRLFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+S+NMFETIARDL LERTDHTLE+YEGSGS+WRLVK+G
Sbjct  61   YYRTTTALRQLGSGSNGLSSVSVSKNMFETIARDLJLERTDHTLEIYEGSGSSWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNL SFED+LFANNEMQD+PV+VAL+PN +ENGC VGLGYVDLT
Sbjct  121  TPGNLCSFEDVLFANNEMQDTPVVVALLPNFQENGCTVGLGYVDLT  166



>ref|XP_008360917.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein MSH2-like 
[Malus domestica]
Length=774

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD  FE+ +KLPELKLDAKQ+QGFLSFFKTLP+D+R +R FDRRDYYTAHG NATFIAKT
Sbjct  1    MDANFEDHSKLPELKLDAKQSQGFLSFFKTLPNDSRAIRLFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+S+NMFETIARDL LERTDHTLE+YEGSGS+WRLVK+G
Sbjct  61   YYRTTTALRQLGSGSNGLSSVSVSKNMFETIARDLJLERTDHTLEIYEGSGSSWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNL SFED+LFANNEMQD+PV+VAL+PN +ENGC VGLGYVDLT
Sbjct  121  TPGNLCSFEDVLFANNEMQDTPVVVALLPNFQENGCTVGLGYVDLT  166



>ref|XP_008374721.1| PREDICTED: DNA mismatch repair protein MSH2 [Malus domestica]
Length=942

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD  FE+ +KLPELKLDAKQ+QGFLSFFKTLP+D+R +R FDRRDYYTAHG NATFIAKT
Sbjct  1    MDANFEDHSKLPELKLDAKQSQGFLSFFKTLPNDSRAIRLFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+S+NMFETI RD+LLERTDHTLE+YEGSGS+W+LVK+G
Sbjct  61   YYRTTTALRQLGSGSNGLSSVSVSKNMFETITRDILLERTDHTLEIYEGSGSSWKLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFED+LFANNEMQD+PV+VAL+PN RENGC VGLGYVDLT
Sbjct  121  TPGNLGSFEDVLFANNEMQDTPVVVALLPNFRENGCTVGLGYVDLT  166



>gb|KJB34384.1| hypothetical protein B456_006G063300 [Gossypium raimondii]
Length=876

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE F+EQNKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDRRDYYTAHG NATFIAKT
Sbjct  1    MDENFDEQNKLPELKLDAKQAQGFLSFFKTLPNDPRAVRFFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+++NMFETI RDLLLERTDHTLELYEGSGSNWRL+K+ 
Sbjct  61   YYRTTTALRQLGSGSNGLSSVSVNKNMFETITRDLLLERTDHTLELYEGSGSNWRLMKSA  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGNL SFED+LFANNEMQD+PV+VAL+PN RENGC VG  YVDLT
Sbjct  121  SPGNLSSFEDVLFANNEMQDTPVVVALLPNFRENGCTVGFSYVDLT  166



>ref|XP_010695623.1| PREDICTED: DNA mismatch repair protein MSH2 [Beta vulgaris subsp. 
vulgaris]
Length=944

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  DEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTY  306
            D  F++QNKLPELKLDAKQAQGFLSFFKTLP D R VRFFDRRDY+TAHG NA F+AK Y
Sbjct  4    DLHFQDQNKLPELKLDAKQAQGFLSFFKTLPQDLRAVRFFDRRDYFTAHGENAAFVAKVY  63

Query  307  YHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGT  486
            YHTTTALRQLGSG  A+SSV++S++MFETIARDLLLERTDHT+ELYEGSGSNWRLVK+G+
Sbjct  64   YHTTTALRQLGSGSDALSSVTVSKSMFETIARDLLLERTDHTVELYEGSGSNWRLVKSGS  123

Query  487  PGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            PGNLGSFEDILFANNEMQDSP  VAL+PN RENGC VGLGYVDLT
Sbjct  124  PGNLGSFEDILFANNEMQDSPATVALLPNFRENGCTVGLGYVDLT  168



>gb|KJB34381.1| hypothetical protein B456_006G063300 [Gossypium raimondii]
Length=911

 Score =   270 bits (689),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE F+EQNKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDRRDYYTAHG NATFIAKT
Sbjct  1    MDENFDEQNKLPELKLDAKQAQGFLSFFKTLPNDPRAVRFFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+++NMFETI RDLLLERTDHTLELYEGSGSNWRL+K+ 
Sbjct  61   YYRTTTALRQLGSGSNGLSSVSVNKNMFETITRDLLLERTDHTLELYEGSGSNWRLMKSA  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGNL SFED+LFANNEMQD+PV+VAL+PN RENGC VG  YVDLT
Sbjct  121  SPGNLSSFEDVLFANNEMQDTPVVVALLPNFRENGCTVGFSYVDLT  166



>gb|KJB34383.1| hypothetical protein B456_006G063300 [Gossypium raimondii]
Length=943

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE F+EQNKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDRRDYYTAHG NATFIAKT
Sbjct  1    MDENFDEQNKLPELKLDAKQAQGFLSFFKTLPNDPRAVRFFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+++NMFETI RDLLLERTDHTLELYEGSGSNWRL+K+ 
Sbjct  61   YYRTTTALRQLGSGSNGLSSVSVNKNMFETITRDLLLERTDHTLELYEGSGSNWRLMKSA  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGNL SFED+LFANNEMQD+PV+VAL+PN RENGC VG  YVDLT
Sbjct  121  SPGNLSSFEDVLFANNEMQDTPVVVALLPNFRENGCTVGFSYVDLT  166



>gb|KJB34382.1| hypothetical protein B456_006G063300 [Gossypium raimondii]
Length=942

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE F+EQNKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDRRDYYTAHG NATFIAKT
Sbjct  1    MDENFDEQNKLPELKLDAKQAQGFLSFFKTLPNDPRAVRFFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+++NMFETI RDLLLERTDHTLELYEGSGSNWRL+K+ 
Sbjct  61   YYRTTTALRQLGSGSNGLSSVSVNKNMFETITRDLLLERTDHTLELYEGSGSNWRLMKSA  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGNL SFED+LFANNEMQD+PV+VAL+PN RENGC VG  YVDLT
Sbjct  121  SPGNLSSFEDVLFANNEMQDTPVVVALLPNFRENGCTVGFSYVDLT  166



>ref|XP_009346787.1| PREDICTED: DNA mismatch repair protein MSH2-like [Pyrus x bretschneideri]
Length=942

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD  FE+ +KLPELKLDAKQ+QGFLSFFKTLP+D+R +R FDRRDYYTAHG NAT IAKT
Sbjct  1    MDANFEDHSKLPELKLDAKQSQGFLSFFKTLPNDSRAIRLFDRRDYYTAHGENATLIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSVS+S+NMFETI RD+LLERTDHTLE+YEGSGS+WRLVK+G
Sbjct  61   YYRTTTALRQLGSGSNGLSSVSVSKNMFETITRDILLERTDHTLEIYEGSGSSWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFED+LFANNEMQD+PV+VAL+PN RENGC VGLGYVDLT
Sbjct  121  TPGNLGSFEDVLFANNEMQDTPVVVALLPNFRENGCTVGLGYVDLT  166



>ref|XP_009798771.1| PREDICTED: DNA mismatch repair protein MSH2 [Nicotiana sylvestris]
Length=939

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+E  EEQ+KLPELKLDAKQAQGFLSFFKTLP D R VR FDRRDYYTAHG++ATFIAKT
Sbjct  1    MNENLEEQSKLPELKLDAKQAQGFLSFFKTLPKDPRAVRLFDRRDYYTAHGDDATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLG+G  A+SS+S+SRNMFETIARD+LLER D TLELYEGSGSNWRLVK+G
Sbjct  61   YYHTTTALRQLGNGADALSSISVSRNMFETIARDILLERMDRTLELYEGSGSNWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFEDILFANNEMQDSPVI AL PN  +NGC VGLGYVD+T
Sbjct  121  TPGNLGSFEDILFANNEMQDSPVIAALAPNFGQNGCEVGLGYVDIT  166



>ref|XP_008244032.1| PREDICTED: DNA mismatch repair protein MSH2 [Prunus mume]
Length=942

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD  FE+Q+KLPELKLDAKQ+QGFLSFFKTLP D R +R FDRRDYYTAHG NATFIAK 
Sbjct  1    MDANFEDQSKLPELKLDAKQSQGFLSFFKTLPHDPRPIRLFDRRDYYTAHGENATFIAKA  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLG+G   +SSVS+S+NMFETIARDLLLERTDHTLE+YEGSGS+WRLVK+G
Sbjct  61   YYRTTTALRQLGNGLDGLSSVSVSKNMFETIARDLLLERTDHTLEIYEGSGSSWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFED+LFANN+MQD+PV+VAL+PN RENGC VGLGYVDLT
Sbjct  121  TPGNLGSFEDVLFANNDMQDTPVVVALLPNFRENGCTVGLGYVDLT  166



>ref|XP_002317931.1| muts homolog 2 family protein [Populus trichocarpa]
 gb|EEE96151.1| muts homolog 2 family protein [Populus trichocarpa]
Length=944

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  DEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTY  306
            ++ FEEQNKLPELKLDAKQAQGFLSFFKTLP D R VR FDRRDYYT H  NATFIAKTY
Sbjct  4    NKNFEEQNKLPELKLDAKQAQGFLSFFKTLPHDPRAVRVFDRRDYYTVHAENATFIAKTY  63

Query  307  YHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGT  486
            YHTTTALRQLGSG   +SSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNW+LVK+GT
Sbjct  64   YHTTTALRQLGSGSNGLSSVSISKNMFETIARDLLLERTDHTLELYEGSGSNWKLVKSGT  123

Query  487  PGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            PGNLGSFED+LFANN+MQDSPV+VAL+ N RE GC VGL YVDLT
Sbjct  124  PGNLGSFEDVLFANNDMQDSPVVVALLLNFREKGCTVGLSYVDLT  168



>gb|KFK39205.1| hypothetical protein AALP_AA3G213100 [Arabis alpina]
Length=937

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEEQNKLPELKLDAKQAQGFLSFFKTLP+D+R VRFFDR+DYYTAHG+N+ FIAKT
Sbjct  1    MEGNFEEQNKLPELKLDAKQAQGFLSFFKTLPTDSRAVRFFDRKDYYTAHGDNSVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  A+SSVS+S+NMFETI RDLLLER DHT+ELYEGSGSNWRLVK G
Sbjct  61   YYHTTTALRQLGSGTNALSSVSISKNMFETIVRDLLLERNDHTVELYEGSGSNWRLVKAG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V+L PN +E+ CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSLFPNFQESRCVIGIAYVDLT  166



>gb|KFK39206.1| hypothetical protein AALP_AA3G213100 [Arabis alpina]
Length=932

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEEQNKLPELKLDAKQAQGFLSFFKTLP+D+R VRFFDR+DYYTAHG+N+ FIAKT
Sbjct  1    MEGNFEEQNKLPELKLDAKQAQGFLSFFKTLPTDSRAVRFFDRKDYYTAHGDNSVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  A+SSVS+S+NMFETI RDLLLER DHT+ELYEGSGSNWRLVK G
Sbjct  61   YYHTTTALRQLGSGTNALSSVSISKNMFETIVRDLLLERNDHTVELYEGSGSNWRLVKAG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V+L PN +E+ CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSLFPNFQESRCVIGIAYVDLT  166



>ref|XP_010506962.1| PREDICTED: DNA mismatch repair protein MSH2 [Camelina sativa]
Length=937

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEEQNKLPELKLDAKQAQGFLSF+KTLP+D+R VRFFDR+DYYTAHG N+ FIAKT
Sbjct  1    MEGNFEEQNKLPELKLDAKQAQGFLSFYKTLPNDSRAVRFFDRKDYYTAHGENSVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLG+G  A+SSVS+SRNMFETIARDLLLER DHT+ELYEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLGNGSNALSSVSISRNMFETIARDLLLERNDHTVELYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V++ PN +E  CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSIFPNFQEGRCVIGMAYVDLT  166



>ref|XP_003549805.1| PREDICTED: DNA mismatch repair protein MSH2-like [Glycine max]
 gb|KHN10417.1| DNA mismatch repair protein Msh2 [Glycine soja]
Length=942

 Score =   268 bits (684),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = +1

Query  124  MDEKFEE-QNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAK  300
            M E F++  NKLPELKLD+KQAQGFLSFFKTLP D R VRFFDRRDYYTAHG NATFIAK
Sbjct  1    MAENFDDLNNKLPELKLDSKQAQGFLSFFKTLPDDPRAVRFFDRRDYYTAHGENATFIAK  60

Query  301  TYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKT  480
            TYYHTTTA+RQLGSG  A+SSVS+SRNMFETIARDLLLERTDHTLELYEGSGSNWRLVK+
Sbjct  61   TYYHTTTAMRQLGSGSNALSSVSVSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKS  120

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            GTPGN+GSFED+LFAN+EMQDSPV+VAL  N RENGC +GLG+VDLT
Sbjct  121  GTPGNIGSFEDVLFANSEMQDSPVVVALSLNYRENGCTIGLGFVDLT  167



>gb|AAT67044.1| DNA mismatch repair protein [Petunia x hybrida]
Length=942

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD  FEEQ KLPELKLDA+QAQGFLSFFKTLP DTR VR FDRRDYYTAHG++A+FIAKT
Sbjct  1    MDTNFEEQAKLPELKLDARQAQGFLSFFKTLPKDTRAVRLFDRRDYYTAHGDDASFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTT+ALRQLG+G  A+SSV++SRNMFETIARD+LLER D TLELYEGSGSNWRLVK G
Sbjct  61   YYHTTSALRQLGNGADALSSVTVSRNMFETIARDILLERMDRTLELYEGSGSNWRLVKNG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPG LGSFEDILFANNEMQDSPVIVAL PN  +NGC +GLGYVD+T
Sbjct  121  TPGVLGSFEDILFANNEMQDSPVIVALAPNSSQNGCTIGLGYVDIT  166



>ref|NP_566804.3| DNA mismatch repair protein Msh2 [Arabidopsis thaliana]
 sp|O24617.1|MSH2_ARATH RecName: Full=DNA mismatch repair protein MSH2; Short=AtMSH2; 
AltName: Full=MutS protein homolog 2 [Arabidopsis thaliana]
 gb|AAB82649.1| MutS homolog 2 [Arabidopsis thaliana]
 gb|AAB82650.1| MutS homolog 2 [Arabidopsis thaliana]
 gb|AAB81282.1| DNA mismatch repair protein MSH2 [Arabidopsis thaliana]
 dbj|BAB01119.1| DNA mismatch repair protein MSH2 [Arabidopsis thaliana]
 gb|AEE76112.1| DNA mismatch repair protein Msh2 [Arabidopsis thaliana]
Length=937

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEEQNKLPELKLDAKQAQGFLSF+KTLP+DTR VRFFDR+DYYTAHG N+ FIAKT
Sbjct  1    MEGNFEEQNKLPELKLDAKQAQGFLSFYKTLPNDTRAVRFFDRKDYYTAHGENSVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  A+SSVS+SRNMFETIARDLLLER DHT+ELYEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLGSGSNALSSVSISRNMFETIARDLLLERNDHTVELYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V++ P+  +  CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSIFPSFHDGRCVIGMAYVDLT  166



>gb|AAD04176.1| mismatch repair protein [Arabidopsis thaliana]
Length=937

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEEQNKLPELKLDAKQAQGFLSF+KTLP+DTR VRFFDR+DYYTAHG N+ FIAKT
Sbjct  1    MEGNFEEQNKLPELKLDAKQAQGFLSFYKTLPNDTRAVRFFDRKDYYTAHGENSVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  A+SSVS+SRNMFETIARDLLLER DHT+ELYEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLGSGSNALSSVSISRNMFETIARDLLLERNDHTVELYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V++ P+  +  CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSIFPSFHDGRCVIGMAYVDLT  166



>ref|XP_009627423.1| PREDICTED: DNA mismatch repair protein MSH2 [Nicotiana tomentosiformis]
Length=939

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+E  EEQ+KLPELKLDAKQAQGFLSFFKTLP D R VR FDRRDYYT+HG++ATFIAKT
Sbjct  1    MNENLEEQSKLPELKLDAKQAQGFLSFFKTLPKDPRAVRLFDRRDYYTSHGDDATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLG+   A+SSVS+SRNMFETIARD+LLER D TLELYEGSGSNWRLVK+G
Sbjct  61   YYHTTTALRQLGNRADALSSVSVSRNMFETIARDILLERMDRTLELYEGSGSNWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFEDILFANNEMQDSPVI AL PN  +NGC VGLGYVD+T
Sbjct  121  TPGNLGSFEDILFANNEMQDSPVIAALAPNFGQNGCEVGLGYVDIT  166



>ref|XP_007036428.1| MUTS isoform 2 [Theobroma cacao]
 gb|EOY20929.1| MUTS isoform 2 [Theobroma cacao]
Length=942

 Score =   265 bits (678),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE F+E+NKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDRRDYYTAHG NATFIAKT
Sbjct  1    MDENFDERNKLPELKLDAKQAQGFLSFFKTLPNDARAVRFFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSV++S++MFETIARDLLLERTDHTLELYEGSGS+ RL+K+G
Sbjct  61   YYRTTTALRQLGSGSDGLSSVTVSKSMFETIARDLLLERTDHTLELYEGSGSHLRLMKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGNLGSFED+LFANNEMQD+PV+VAL+PN RENGC +G  YVDLT
Sbjct  121  SPGNLGSFEDVLFANNEMQDTPVVVALLPNFRENGCTIGFSYVDLT  166



>ref|XP_007036427.1| MUTS isoform 1 [Theobroma cacao]
 gb|EOY20928.1| MUTS isoform 1 [Theobroma cacao]
Length=967

 Score =   265 bits (678),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE F+E+NKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDRRDYYTAHG NATFIAKT
Sbjct  1    MDENFDERNKLPELKLDAKQAQGFLSFFKTLPNDARAVRFFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLGSG   +SSV++S++MFETIARDLLLERTDHTLELYEGSGS+ RL+K+G
Sbjct  61   YYRTTTALRQLGSGSDGLSSVTVSKSMFETIARDLLLERTDHTLELYEGSGSHLRLMKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGNLGSFED+LFANNEMQD+PV+VAL+PN RENGC +G  YVDLT
Sbjct  121  SPGNLGSFEDVLFANNEMQDTPVVVALLPNFRENGCTIGFSYVDLT  166



>gb|KHG20537.1| DNA mismatch repair Msh2 -like protein [Gossypium arboreum]
Length=943

 Score =   265 bits (676),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE F+EQNKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDRRDYYTAHG NATFI KT
Sbjct  1    MDENFDEQNKLPELKLDAKQAQGFLSFFKTLPNDPRAVRFFDRRDYYTAHGENATFITKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALR+LGSG   +SSVS+++NMFETI RDLLLERTDHTLELY GSGSNWRLVK+ 
Sbjct  61   YYRTTTALRKLGSGSNGLSSVSVNKNMFETITRDLLLERTDHTLELYGGSGSNWRLVKSA  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGNL SFED+LFANNEMQD+PV+VAL+PN RENGC VG  YVDLT
Sbjct  121  SPGNLSSFEDVLFANNEMQDTPVVVALLPNFRENGCTVGFSYVDLT  166



>ref|XP_011102330.1| PREDICTED: DNA mismatch repair protein MSH2-like isoform X1 [Sesamum 
indicum]
Length=940

 Score =   265 bits (676),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M + FEEQNKLPELKLDA+QAQGFLSFFK+LP+D R +RFFDRRDYYT HG NATFIAKT
Sbjct  1    MGDNFEEQNKLPELKLDARQAQGFLSFFKSLPNDPRAIRFFDRRDYYTTHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTA+ Q+GSG  AISS+S+S+NMFET+ARD+LLER DHTLELYEG+G+NWRLVK+ 
Sbjct  61   YYHTTTAVCQIGSGSDAISSLSVSKNMFETVARDVLLERADHTLELYEGTGANWRLVKSA  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFE+ILFANNEMQDSPVIVAL+ N RENGC VGL YVDLT
Sbjct  121  TPGNLGSFEEILFANNEMQDSPVIVALIANFRENGCAVGLSYVDLT  166



>ref|XP_006843758.1| hypothetical protein AMTR_s00007p00236950 [Amborella trichopoda]
 gb|ERN05433.1| hypothetical protein AMTR_s00007p00236950 [Amborella trichopoda]
Length=941

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +1

Query  145  QNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTA  324
            +NKLPELKLDAKQAQGF+SFF+ LP DT+ VRFFDRRDYYTAHG+NA FIAKTYYHT+TA
Sbjct  7    ENKLPELKLDAKQAQGFVSFFRRLPQDTKAVRFFDRRDYYTAHGDNANFIAKTYYHTSTA  66

Query  325  LRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLGS  504
            LRQLGSGP AISSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNWRL KTGTPGNLGS
Sbjct  67   LRQLGSGPDAISSVSVSKNMFETIARDLLLERTDHTLELYEGSGSNWRLSKTGTPGNLGS  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FED+LFANNEMQD+PV VAL P+ R+N C VGL YVDLT
Sbjct  127  FEDVLFANNEMQDTPVTVALFPSFRDNECTVGLAYVDLT  165



>ref|XP_006296923.1| hypothetical protein CARUB_v10012916mg [Capsella rubella]
 gb|EOA29821.1| hypothetical protein CARUB_v10012916mg [Capsella rubella]
Length=937

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+   EEQNKLPELKLDAKQAQGFLSF+KTLP+D+R VRFFDR+DYYTAHG N+ FIAKT
Sbjct  1    MEGSIEEQNKLPELKLDAKQAQGFLSFYKTLPNDSRAVRFFDRKDYYTAHGENSVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQL SG  A+SSVS+SRNMFETIARDLLLER DHT+ELYEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLRSGSNALSSVSISRNMFETIARDLLLERNDHTVELYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V++ PN +E  CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSIFPNFQEGRCVIGMAYVDLT  166



>ref|XP_010465956.1| PREDICTED: DNA mismatch repair protein MSH2-like [Camelina sativa]
Length=937

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+   E+QNKLPELKLDAKQAQGFLSF+KTLP+D+R VRFFDR+DYYTAHG N+ FIAK+
Sbjct  1    MEGNIEDQNKLPELKLDAKQAQGFLSFYKTLPNDSRAVRFFDRKDYYTAHGENSVFIAKS  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  A+SSVS+SRNMFETIARDLLLER DHT+ELYEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLGSGSNALSSVSISRNMFETIARDLLLERNDHTVELYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V++ PN +E  CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSIFPNFQEGRCVIGMSYVDLT  166



>ref|XP_010265279.1| PREDICTED: DNA mismatch repair protein MSH2 [Nelumbo nucifera]
Length=942

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/166 (83%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+E  +E NKLPELKLDAKQAQGF+SFFKTLP D R +RFFDRRDYYT HG NATFIAKT
Sbjct  1    MEENLQEPNKLPELKLDAKQAQGFISFFKTLPQDPRAIRFFDRRDYYTVHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG   ISSVS+S+NMFETIARDLLLERTDHTLELYEGSGSNWRL K+G
Sbjct  61   YYHTTTALRQLGSGSDGISSVSVSKNMFETIARDLLLERTDHTLELYEGSGSNWRLTKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFED+LFANNEM ++PVIVAL  N RE+ C VGLGYVDLT
Sbjct  121  TPGNLGSFEDVLFANNEMLETPVIVALCLNFRESECTVGLGYVDLT  166



>ref|XP_002885262.1| hypothetical protein ARALYDRAFT_479358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61521.1| hypothetical protein ARALYDRAFT_479358 [Arabidopsis lyrata subsp. 
lyrata]
Length=937

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEEQNKLPELKLDAKQAQGFLSF+KTLP+ TR VRFFDR+DYYTAHG N+ FIAKT
Sbjct  1    MEGNFEEQNKLPELKLDAKQAQGFLSFYKTLPNATRAVRFFDRKDYYTAHGENSVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  A+SSVS+S+NMFETIARDLLLER DHT ELYEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLGSGSNALSSVSISKNMFETIARDLLLERNDHTAELYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V++ P+ ++  CV+G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSIFPSFQDGRCVIGMAYVDLT  166



>ref|XP_004138226.1| PREDICTED: DNA mismatch repair protein MSH2-like [Cucumis sativus]
 ref|XP_004154930.1| PREDICTED: DNA mismatch repair protein MSH2-like [Cucumis sativus]
Length=938

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M +  +EQ KLPELKLDAKQAQGFL+FFKTLP D+R VRFFDRRDYYTAH +NA FIAKT
Sbjct  1    MGDNVDEQTKLPELKLDAKQAQGFLAFFKTLPPDSRAVRFFDRRDYYTAHSDNAVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLG+   A+SSVS+S+NMFE+IARDLLLERTDHTLELYEGSGSNWRL+K+G
Sbjct  61   YYRTTTALRQLGNASEALSSVSVSKNMFESIARDLLLERTDHTLELYEGSGSNWRLIKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQDSP IVAL P  R+NGC+VGLGYVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDSPAIVALFPYFRDNGCIVGLGYVDLT  166



>gb|KGN63799.1| hypothetical protein Csa_1G020900 [Cucumis sativus]
Length=942

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M +  +EQ KLPELKLDAKQAQGFL+FFKTLP D+R VRFFDRRDYYTAH +NA FIAKT
Sbjct  1    MGDNVDEQTKLPELKLDAKQAQGFLAFFKTLPPDSRAVRFFDRRDYYTAHSDNAVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLG+   A+SSVS+S+NMFE+IARDLLLERTDHTLELYEGSGSNWRL+K+G
Sbjct  61   YYRTTTALRQLGNASEALSSVSVSKNMFESIARDLLLERTDHTLELYEGSGSNWRLIKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQDSP IVAL P  R+NGC+VGLGYVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDSPAIVALFPYFRDNGCIVGLGYVDLT  166



>gb|KEH32085.1| DNA mismatch repair MSH3-like protein [Medicago truncatula]
Length=941

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +1

Query  124  MDEKFEEQN-KLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAK  300
            MDE F+  N KLPELKLD+KQAQGFLSFFKTLP D R +RFFDRRDYYTAHG NATFIAK
Sbjct  1    MDENFDGFNDKLPELKLDSKQAQGFLSFFKTLPHDPRAIRFFDRRDYYTAHGENATFIAK  60

Query  301  TYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKT  480
            TYYHTTTALRQLGSG  A+SSVS+SRNMFETIARDLLLERTDHTLE+YEGS SNW+L K+
Sbjct  61   TYYHTTTALRQLGSGSNALSSVSVSRNMFETIARDLLLERTDHTLEVYEGSSSNWQLAKS  120

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            GTPGN+GSFED+LFAN+EMQDSP +VAL  N RENGC +GLG+VDLT
Sbjct  121  GTPGNIGSFEDVLFANSEMQDSPAVVALSLNFRENGCTIGLGFVDLT  167



>ref|XP_004508573.1| PREDICTED: DNA mismatch repair protein MSH2-like [Cicer arietinum]
Length=942

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 151/167 (90%), Gaps = 1/167 (1%)
 Frame = +1

Query  124  MDEKFEEQN-KLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAK  300
            MDE F+  N KLPELKLD+KQAQGFLSFFKTL  D R +RFFDRRDYYTAHG NATFIAK
Sbjct  1    MDENFDALNHKLPELKLDSKQAQGFLSFFKTLSDDPRAIRFFDRRDYYTAHGENATFIAK  60

Query  301  TYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKT  480
            TYYHTTTALRQLGSG  A+SSVS+SRNMFETIARDLLLERTDHTLE+YEGSGSNWRLVK+
Sbjct  61   TYYHTTTALRQLGSGSNALSSVSVSRNMFETIARDLLLERTDHTLEVYEGSGSNWRLVKS  120

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            GTPGN+G+FED+LFAN+EMQDSPV+VAL  N  ENGC +GLG++DLT
Sbjct  121  GTPGNIGNFEDVLFANSEMQDSPVVVALSLNFCENGCTIGLGFLDLT  167



>emb|CDX82340.1| BnaA03g34810D [Brassica napus]
Length=937

 Score =   259 bits (662),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEE NKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDR+DYYTAHG N+ FIA+T
Sbjct  1    MEGNFEETNKLPELKLDAKQAQGFLSFFKTLPNDLRAVRFFDRKDYYTAHGENSVFIAQT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQ+GSG  A+SSVS+S+NMFETI RDLLLER DHT+ELYEGSGSNWRLVK G
Sbjct  61   YYHTTTALRQIGSGANALSSVSVSKNMFETIVRDLLLERNDHTVELYEGSGSNWRLVKAG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V+L P+ +E+ CVVG+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSLFPSFQESRCVVGMAYVDLT  166



>ref|XP_009135581.1| PREDICTED: DNA mismatch repair protein MSH2 [Brassica rapa]
Length=937

 Score =   259 bits (662),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEE NKLPELKLDAKQAQGFLSFFKTLP+D R VRFFDR+DYYTAHG N+ FIA+T
Sbjct  1    MEGNFEETNKLPELKLDAKQAQGFLSFFKTLPNDLRAVRFFDRKDYYTAHGENSVFIAQT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQ+GSG  A+SSVS+S+NMFETI RDLLLER DHT+ELYEGSGSNWRLVK G
Sbjct  61   YYHTTTALRQIGSGANALSSVSVSKNMFETIVRDLLLERNDHTVELYEGSGSNWRLVKAG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V+L P+ +E+ CVVG+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSLFPSFQESRCVVGMAYVDLT  166



>ref|XP_004299238.1| PREDICTED: DNA mismatch repair protein MSH2 [Fragaria vesca subsp. 
vesca]
Length=942

 Score =   259 bits (662),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD  FE+Q+KLPELKLDAKQ+QGFLSFFKTL  D R +R FDRRDYYTAHG NATFIAKT
Sbjct  1    MDPNFEDQSKLPELKLDAKQSQGFLSFFKTLSHDPRAIRLFDRRDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLG+G  ++SSVS+S+NMFETIARDLLLERTDHTLE+YEGSGS+WRLVK+G
Sbjct  61   YYRTTTALRQLGNGSDSLSSVSVSKNMFETIARDLLLERTDHTLEIYEGSGSSWRLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGNLGSFEDILFANNEMQD+PV+VAL+PN RENGC VGLGYVDLT
Sbjct  121  TPGNLGSFEDILFANNEMQDTPVVVALLPNFRENGCTVGLGYVDLT  166



>ref|XP_010549145.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein MSH2 
[Tarenaya hassleriana]
Length=934

 Score =   259 bits (661),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M + FEEQNKLPELKLD KQAQGFLSFFKTLP+D R VRF DR+DYYTAHG NATFIAKT
Sbjct  1    MKDNFEEQNKLPELKLDVKQAQGFLSFFKTLPADPRAVRFCDRKDYYTAHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  A+ S   SRNMFETIARDLLLER DHT+ELYEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLGSGSDALLSXKKSRNMFETIARDLLLERNDHTIELYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V+++ N+ E+G  +G+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSILLNVHESGYAIGMAYVDLT  166



>ref|XP_010031721.1| PREDICTED: DNA mismatch repair protein MSH2 [Eucalyptus grandis]
 gb|KCW83827.1| hypothetical protein EUGRSUZ_B00700 [Eucalyptus grandis]
Length=942

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+E FEE NKLPE KLD KQAQGFL+FF+ LPSD R VRFFDRRDYYTAHG NA FIAKT
Sbjct  1    MEEAFEEHNKLPEFKLDGKQAQGFLAFFRGLPSDARAVRFFDRRDYYTAHGENAVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLG+GP  +SSVS+++NMFETIARDLLLERTDHTLE+YEGSGSNWRLVKTG
Sbjct  61   YYHTTTALRQLGNGPNGLSSVSINKNMFETIARDLLLERTDHTLEVYEGSGSNWRLVKTG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFAN +MQ+SPV+VA+VP  R+ G  VGLGYVDLT
Sbjct  121  SPGNIGSFEDVLFANCDMQESPVVVAIVPIFRDAGYTVGLGYVDLT  166



>emb|CDY52899.1| BnaCnng23780D [Brassica napus]
Length=937

 Score =   256 bits (655),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            M+  FEE NKLPELKLDAKQAQGFLSFFKTLP+D+R VRFFDR+DYYTAHG N+ FIA+T
Sbjct  1    MEGNFEETNKLPELKLDAKQAQGFLSFFKTLPNDSRAVRFFDRKDYYTAHGENSVFIAQT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQ+GSG  A+SSVS+S+NMFETI RDLLLER DHT+ELYEGSGSNWRLVK G
Sbjct  61   YYHTTTALRQIGSGANALSSVSISKNMFETIVRDLLLERNDHTVELYEGSGSNWRLVKAG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQD+PV+V+L  + +E+ CVVG+ YVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDTPVVVSLFLSFQESRCVVGMAYVDLT  166



>ref|XP_007155145.1| hypothetical protein PHAVU_003G177100g [Phaseolus vulgaris]
 gb|ESW27139.1| hypothetical protein PHAVU_003G177100g [Phaseolus vulgaris]
Length=942

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 150/167 (90%), Gaps = 1/167 (1%)
 Frame = +1

Query  124  MDEKFEE-QNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAK  300
            M E F +  NKLP+LKLD KQAQGFLSFFKTLP D R VR FDRRDYYTAHG+NATFIAK
Sbjct  1    MAENFHDLTNKLPDLKLDPKQAQGFLSFFKTLPDDPRAVRLFDRRDYYTAHGDNATFIAK  60

Query  301  TYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKT  480
            TYYHTTTA+RQLG+G  A+SSVS+S+NMFETIARDLLL+RT H+LELYEGSGSNWRLVK+
Sbjct  61   TYYHTTTAMRQLGNGSNALSSVSVSKNMFETIARDLLLDRTVHSLELYEGSGSNWRLVKS  120

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            GTPGN+GSFE++LFAN+EMQDSPVIVAL  N RENGC +GLG+VDLT
Sbjct  121  GTPGNIGSFEEVLFANSEMQDSPVIVALSLNFRENGCTIGLGFVDLT  167



>ref|XP_010110802.1| DNA mismatch repair protein Msh2 [Morus notabilis]
 gb|EXC28067.1| DNA mismatch repair protein Msh2 [Morus notabilis]
Length=992

 Score =   254 bits (648),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE FEEQNKLPELKLDAKQAQGFLSFFK LP D R +RFFDRRDYYT HG NATFIAKT
Sbjct  1    MDENFEEQNKLPELKLDAKQAQGFLSFFKRLPQDPRAIRFFDRRDYYTVHGENATFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YYHTTTALRQLGSG  ++SSVS+SRNMFETIARDLLLERTDH +ELYEGSGSNW LVK+G
Sbjct  61   YYHTTTALRQLGSGSNSLSSVSVSRNMFETIARDLLLERTDHVVELYEGSGSNWTLVKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            TPGN+ SF+DILFANNEMQD+PV+VALVPN REN C +GLGYVDLT
Sbjct  121  TPGNISSFQDILFANNEMQDTPVVVALVPNFRENSCTIGLGYVDLT  166



>ref|XP_008453367.1| PREDICTED: DNA mismatch repair protein MSH2 [Cucumis melo]
Length=942

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 152/166 (92%), Gaps = 0/166 (0%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MD+  +E++KLPELKLDAKQAQGFL+FFKTLP D+R VRFFDRRDYYTAH +NA FIAKT
Sbjct  1    MDDNVDERSKLPELKLDAKQAQGFLAFFKTLPPDSRAVRFFDRRDYYTAHSDNAVFIAKT  60

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTTALRQLG+   ++SSVS+S+NMFE+IARDLLLERTDHTLELYEGSGSNWRL+K+G
Sbjct  61   YYRTTTALRQLGNASESLSSVSVSKNMFESIARDLLLERTDHTLELYEGSGSNWRLIKSG  120

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN+GSFED+LFANNEMQDSP IVAL P  R+NGC+VGLGYVDLT
Sbjct  121  SPGNIGSFEDVLFANNEMQDSPAIVALFPYFRDNGCIVGLGYVDLT  166



>ref|XP_009404391.1| PREDICTED: DNA mismatch repair protein MSH2 [Musa acuminata subsp. 
malaccensis]
Length=942

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  148  NKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            NKLPELKLDA+QAQGF+SFFK LP+D R VRFFDRRDYYT HG NATFIA+TYYHTTTAL
Sbjct  10   NKLPELKLDARQAQGFISFFKALPADPRAVRFFDRRDYYTVHGENATFIARTYYHTTTAL  69

Query  328  RQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLGSF  507
            RQLGSG   ISSVS+++NMFE IARDLLLERTDHTLELYEGSGSNW L KTGTPGN+GSF
Sbjct  70   RQLGSGSEGISSVSVNKNMFEAIARDLLLERTDHTLELYEGSGSNWNLTKTGTPGNVGSF  129

Query  508  EDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            EDILFANN+MQDSPV VAL P  REN C VGLG+VD+T
Sbjct  130  EDILFANNDMQDSPVTVALFPVFRENQCTVGLGFVDMT  167



>ref|XP_011009801.1| PREDICTED: DNA mismatch repair protein MSH2 [Populus euphratica]
Length=944

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  136  FEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHT  315
            FEEQNKLPELKLDAKQAQGFLSFFKTLP D R VR FDRRDYYT H  NA FIAKTYYHT
Sbjct  7    FEEQNKLPELKLDAKQAQGFLSFFKTLPHDPRAVRVFDRRDYYTVHAENANFIAKTYYHT  66

Query  316  TTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGN  495
            TTALRQLGSG   +SS S+S+NMFETIARDLLLERTDHTLELYEGSGSNW+LVK+GTPGN
Sbjct  67   TTALRQLGSGSSGLSSASISKNMFETIARDLLLERTDHTLELYEGSGSNWKLVKSGTPGN  126

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            LGSFED+LFANN+MQDSPV+VAL+ N RE GC VGL YVDLT
Sbjct  127  LGSFEDVLFANNDMQDSPVVVALLLNFREKGCTVGLSYVDLT  168



>ref|XP_010916140.1| PREDICTED: DNA mismatch repair protein MSH2 isoform X2 [Elaeis 
guineensis]
Length=920

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  DEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTY  306
            D+   E NKLPELKLDA+QAQGF+SFFKTLP D R VRFFDRRDYYT HG+NA FIA+TY
Sbjct  3    DDYSPEPNKLPELKLDARQAQGFISFFKTLPRDPRAVRFFDRRDYYTVHGDNAAFIARTY  62

Query  307  YHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGT  486
            YHTTTALRQLGSGP  ISSVS+S+ MFETIARDLLLERTDHTLE YEGSGSNWRL KTGT
Sbjct  63   YHTTTALRQLGSGPDGISSVSVSKTMFETIARDLLLERTDHTLEFYEGSGSNWRLTKTGT  122

Query  487  PGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            PGN+GSFED+LFANN+MQD+PV ++L P  REN   VGL +VD+T
Sbjct  123  PGNIGSFEDVLFANNDMQDTPVTISLFPVFRENQYTVGLSFVDIT  167



>ref|XP_010916139.1| PREDICTED: DNA mismatch repair protein MSH2 isoform X1 [Elaeis 
guineensis]
Length=942

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  DEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTY  306
            D+   E NKLPELKLDA+QAQGF+SFFKTLP D R VRFFDRRDYYT HG+NA FIA+TY
Sbjct  3    DDYSPEPNKLPELKLDARQAQGFISFFKTLPRDPRAVRFFDRRDYYTVHGDNAAFIARTY  62

Query  307  YHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGT  486
            YHTTTALRQLGSGP  ISSVS+S+ MFETIARDLLLERTDHTLE YEGSGSNWRL KTGT
Sbjct  63   YHTTTALRQLGSGPDGISSVSVSKTMFETIARDLLLERTDHTLEFYEGSGSNWRLTKTGT  122

Query  487  PGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            PGN+GSFED+LFANN+MQD+PV ++L P  REN   VGL +VD+T
Sbjct  123  PGNIGSFEDVLFANNDMQDTPVTISLFPVFRENQYTVGLSFVDIT  167



>ref|XP_008785817.1| PREDICTED: DNA mismatch repair protein MSH2 [Phoenix dactylifera]
Length=942

 Score =   246 bits (627),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            E NKLPELKLDA+QAQGF+SFFKTLP D R VRFFDRRDYYT HG+NA FIA+TYYHTTT
Sbjct  8    EPNKLPELKLDARQAQGFISFFKTLPRDPRAVRFFDRRDYYTVHGDNAAFIARTYYHTTT  67

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
            ALRQLGSGP  ISSVS+S+ MFE IARDLLLERTDHTLELYEGSGSNWRL KTGTPGN+G
Sbjct  68   ALRQLGSGPDRISSVSVSKTMFENIARDLLLERTDHTLELYEGSGSNWRLTKTGTPGNIG  127

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFED+LFANN+MQD+PV ++L P  REN   VGL +VD+T
Sbjct  128  SFEDVLFANNDMQDTPVTISLFPIFRENQYTVGLSFVDIT  167



>ref|XP_011073052.1| PREDICTED: DNA mismatch repair protein MSH2-like [Sesamum indicum]
Length=931

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  172  DAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLGSGPG  351
            DA+QAQGFLSFFK+LP+D R +RFFDRRDYYT HG NATFIAKTYYHTTTA+ Q+GSG  
Sbjct  8    DARQAQGFLSFFKSLPNDPRAIRFFDRRDYYTTHGENATFIAKTYYHTTTAVCQIGSGSD  67

Query  352  AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLGSFEDILFANN  531
            AISS+S+S+NMFET+ARD+LLER DHTLELYEG+G+NWRLVK+ TPGNLGSFE+ILFANN
Sbjct  68   AISSLSVSKNMFETVARDVLLERADHTLELYEGTGANWRLVKSATPGNLGSFEEILFANN  127

Query  532  EMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            EMQDSPVIVAL+ N RENGC VGL YVDLT
Sbjct  128  EMQDSPVIVALIANFRENGCAVGLSYVDLT  157



>ref|XP_003562321.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein MSH2 
[Brachypodium distachyon]
Length=942

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            E  KLPELKLDA+QAQGF+SFFK LP D R +RFFDRRDYYTAHG NATFIAKTYYHT T
Sbjct  9    EGGKLPELKLDARQAQGFISFFKKLPKDPRAIRFFDRRDYYTAHGENATFIAKTYYHTMT  68

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
            ALRQLGS    ISSVS+SR MFETIAR+LLLERTD TLELYEGSGS+WRL K+GTPGN+G
Sbjct  69   ALRQLGSNSDGISSVSVSRAMFETIARNLLLERTDCTLELYEGSGSSWRLAKSGTPGNIG  128

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFEDILF NN+MQDSPV VAL P +RE+   +GL +VD+T
Sbjct  129  SFEDILFTNNDMQDSPVTVALFPVLRESQLYIGLSFVDMT  168



>gb|EEC78891.1| hypothetical protein OsI_19262 [Oryza sativa Indica Group]
 gb|EEE63066.1| hypothetical protein OsJ_17874 [Oryza sativa Japonica Group]
Length=942

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +1

Query  127  DEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTY  306
            D+   E  KLPELKLDA+QAQGF+SFFK LP D+R +R FDRRDYYTAHG NATFIAK Y
Sbjct  4    DDFLPEGGKLPELKLDARQAQGFISFFKKLPQDSRAIRLFDRRDYYTAHGENATFIAKIY  63

Query  307  YHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGT  486
            YHT +ALRQLGS    +SSVS+S+ MFETIAR+LLLERTD TLELYEGSGS+WRL K+GT
Sbjct  64   YHTMSALRQLGSNSDGLSSVSVSKTMFETIARNLLLERTDRTLELYEGSGSSWRLTKSGT  123

Query  487  PGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            PGN+GSFEDILFANN+MQDSPV VAL P  +E    VGL +VDLT
Sbjct  124  PGNIGSFEDILFANNDMQDSPVTVALFPVFQEGQLYVGLSFVDLT  168



>ref|XP_010663546.1| PREDICTED: DNA mismatch repair protein MSH2 isoform X2 [Vitis 
vinifera]
Length=918

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            TAHG NATFIAKTYYHTTTALRQLGSG   ISSVS+S+NMFETIAR+LLLERTDHTLELY
Sbjct  21   TAHGENATFIAKTYYHTTTALRQLGSGSDGISSVSVSKNMFETIARNLLLERTDHTLELY  80

Query  445  EGSGSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            EGSGSNWRLVK+GTPGNLGSFED+LFANNEMQDSPVIVAL PN RENGC VGLG+VDLT
Sbjct  81   EGSGSNWRLVKSGTPGNLGSFEDVLFANNEMQDSPVIVALFPNFRENGCTVGLGFVDLT  139



>dbj|BAK07130.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=942

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            E  KLPELKLDA+QAQGF+SFFK LP D R +R FDRRDYYTAHG NATFIAK YYHT T
Sbjct  9    EGGKLPELKLDARQAQGFISFFKKLPKDPRAIRLFDRRDYYTAHGENATFIAKAYYHTMT  68

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
            ALRQLG     ISSVS+SR MFETIAR+LLL+RTDHTLELYEGSGS+WRL K+GTPGN+G
Sbjct  69   ALRQLGGNSDGISSVSVSRAMFETIARNLLLDRTDHTLELYEGSGSSWRLTKSGTPGNIG  128

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFEDILFANN+MQ SPV VAL P  RE    V L +VD+T
Sbjct  129  SFEDILFANNDMQYSPVTVALFPVFREGQLYVALSFVDMT  168



>gb|EMS48756.1| DNA mismatch repair protein MSH2 [Triticum urartu]
Length=1271

 Score =   227 bits (578),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            E  KLPELKLDA+QAQGF+SFFK LP D R +RFFDRRDYYTAHG NATFIAKTYYHT T
Sbjct  9    EGGKLPELKLDARQAQGFISFFKKLPKDPRAIRFFDRRDYYTAHGENATFIAKTYYHTMT  68

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
            ALRQLG     ISSVS+SR MFETIAR+LLL+RTDHTLELYEGSGS+WRL K+GTPGN+G
Sbjct  69   ALRQLGGNSDGISSVSVSRAMFETIARNLLLDRTDHTLELYEGSGSSWRLTKSGTPGNIG  128

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFEDILFANN+MQ SPV VAL P  RE    V L +VD+T
Sbjct  129  SFEDILFANNDMQYSPVTVALFPVFREGQLYVALSFVDMT  168



>ref|NP_001146301.1| DNA mismatch repair protein MSH2 [Zea mays]
 sp|Q9XGC9.1|MSH2_MAIZE RecName: Full=DNA mismatch repair protein MSH2; AltName: Full=MUS1 
[Zea mays]
 emb|CAB42554.1| MUS1 protein [Zea mays]
 tpg|DAA63434.1| TPA: DNA mismatch repair protein MSH2 [Zea mays]
Length=942

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            E  KLPE KLDA+QAQGF+SFFK LP D R VR FDRRDYYTAHG NATFIA+TYYHT +
Sbjct  9    EGGKLPEFKLDARQAQGFISFFKKLPQDPRAVRLFDRRDYYTAHGENATFIARTYYHTMS  68

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
            ALRQLGS    I S S+S+ MFETIAR++LLERTD TLELYEGSGSNWRL K+GTPGN+G
Sbjct  69   ALRQLGSSSDGILSASVSKAMFETIARNILLERTDCTLELYEGSGSNWRLTKSGTPGNIG  128

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFEDILFANN+M+DSPVIVAL P  RE+   VGL ++D+T
Sbjct  129  SFEDILFANNDMEDSPVIVALFPACRESQLYVGLSFLDMT  168



>ref|XP_006655161.1| PREDICTED: DNA mismatch repair protein MSH2-like [Oryza brachyantha]
Length=942

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            E  KLPELKLD +Q QGF+SFFK LP D+R VRFFDRRDYYTAHG NATFIAK YYHT +
Sbjct  9    EGGKLPELKLDVRQVQGFISFFKKLPQDSRAVRFFDRRDYYTAHGENATFIAKIYYHTMS  68

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
            ALRQL S    +SSVS+S+ MFETIAR++LLERTD TLELYEGSGS+WRL K+GTPGN+G
Sbjct  69   ALRQLSSNSDGLSSVSVSKTMFETIARNILLERTDRTLELYEGSGSSWRLTKSGTPGNIG  128

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFEDILFANN+MQDSPV VAL P  +E    VGL +VDLT
Sbjct  129  SFEDILFANNDMQDSPVTVALFPVFQEGQLYVGLSFVDLT  168



>gb|EPS69989.1| hypothetical protein M569_04769 [Genlisea aurea]
Length=930

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKT  303
            MDE   E N LPE KLDAKQAQG LSFF++LPSD+R VRFFDRR+YYT HG NA FIAK 
Sbjct  1    MDEN-SEPNNLPEFKLDAKQAQGLLSFFRSLPSDSRAVRFFDRREYYTTHGENAIFIAKA  59

Query  304  YYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTG  483
            YY TTT +RQLG+G   +S VS+S++MFE +ARDLLLER DHT+ELY+GSG+NWRL K  
Sbjct  60   YYGTTTVVRQLGTGSDTLSGVSLSKSMFEIVARDLLLERKDHTVELYQGSGANWRLAKKA  119

Query  484  TPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            +PGN  SFE++LFA NEMQDSPVI A+  N +E+GC+VGL Y+D T
Sbjct  120  SPGNFSSFEEVLFATNEMQDSPVIAAVSANFQESGCLVGLSYIDAT  165



>ref|XP_004962511.1| PREDICTED: DNA mismatch repair protein MSH2-like [Setaria italica]
Length=943

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            E   LPELKLDA+QAQGF+SFFK LP D R VR FDRRDYYTAHG NATFIA+TYYHT +
Sbjct  9    EGGNLPELKLDARQAQGFISFFKRLPQDPRAVRLFDRRDYYTAHGENATFIARTYYHTMS  68

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
            ALRQLGS    ISS S+S+ MFETIAR++LLERTD TLELYEGSGS+WRL K+GTPGN+G
Sbjct  69   ALRQLGSSSDGISSASVSKAMFETIARNILLERTDRTLELYEGSGSSWRLTKSGTPGNIG  128

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFEDILFANN+MQDSPVIVAL P  RE    VGL ++D+T
Sbjct  129  SFEDILFANNDMQDSPVIVALFPVFREGQLYVGLSFLDMT  168



>ref|XP_002463122.1| hypothetical protein SORBIDRAFT_02g038230 [Sorghum bicolor]
 gb|EER99643.1| hypothetical protein SORBIDRAFT_02g038230 [Sorghum bicolor]
Length=942

 Score =   211 bits (538),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            E  KLPE KLDA+QAQGF+SFFK LP D R VR FDRRDYYTAHG NATFIA+TYYHT +
Sbjct  9    EGGKLPEFKLDARQAQGFISFFKRLPQDPRAVRLFDRRDYYTAHGENATFIARTYYHTMS  68

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
            ALRQLGS    ISSVS+S+ MFETIAR++LLERTD TLELYEGSGSNWRL K+GTPGN+G
Sbjct  69   ALRQLGSSSDGISSVSVSKAMFETIARNILLERTDCTLELYEGSGSNWRLTKSGTPGNIG  128

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFED+LFANN+MQDSPVIVAL P  RE+   VGL ++D+T
Sbjct  129  SFEDLLFANNDMQDSPVIVALFPVCRESQLYVGLSFLDMT  168



>gb|AAZ42361.1| DNA mismatch repair protein MSH2 [Physcomitrella patens]
Length=951

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            ++ KLPELKLD KQAQGF+SFF+ LP + + VRFFDRRDY+TAHG+NATFIA TYY T T
Sbjct  10   DEPKLPELKLDVKQAQGFISFFRRLPENEQAVRFFDRRDYFTAHGDNATFIASTYYRTLT  69

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
             LRQLGSG  ++  V+++++MFETI RDLLLERTD T+ELYEG+GS W+LV++G+PG LG
Sbjct  70   VLRQLGSGADSLPGVTINKSMFETIVRDLLLERTDCTVELYEGTGSKWQLVRSGSPGKLG  129

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFE++LFA+NEMQ++PV++A+    R++   VG+ +VD+T
Sbjct  130  SFEEVLFASNEMQETPVVMAVNITTRQSERCVGIAFVDMT  169



>ref|XP_001779144.1| predicted protein [Physcomitrella patens]
 gb|EDQ56090.1| predicted protein [Physcomitrella patens]
Length=956

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +1

Query  142  EQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTT  321
            ++ KLPELKLD KQAQGF+SFF+ LP + + VRFFDR+DY+TAHG+NATFIA TYY T T
Sbjct  10   DEPKLPELKLDVKQAQGFISFFRRLPENEQAVRFFDRKDYFTAHGDNATFIASTYYRTLT  69

Query  322  ALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLG  501
             LRQLGSG  ++  V+++++MFETI RDLLLERTD T+ELYEG+GS W+LV++G+PG LG
Sbjct  70   VLRQLGSGADSLPGVTINKSMFETIVRDLLLERTDCTVELYEGTGSKWQLVRSGSPGKLG  129

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            SFE++LFA+NEMQ++PV++A+    R++   VG+ +VD+T
Sbjct  130  SFEEVLFASNEMQETPVVMAVNITTRQSERCVGIAFVDMT  169



>ref|XP_002966234.1| hypothetical protein SELMODRAFT_85179 [Selaginella moellendorffii]
 gb|EFJ32261.1| hypothetical protein SELMODRAFT_85179 [Selaginella moellendorffii]
Length=940

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +1

Query  151  KLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALR  330
            KLPELKLDAKQAQGF+ FF+ LP D  V+RFFDRRDY+TAHG+NA+ IA+ YY TTTALR
Sbjct  9    KLPELKLDAKQAQGFIKFFRKLPEDPSVIRFFDRRDYFTAHGDNASLIARLYYRTTTALR  68

Query  331  QLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLGSFE  510
            QLGSG   +SSVS+S++MFE I RD+LLE+T++ +ELYEGSG+NW+L K+ TPG LGSFE
Sbjct  69   QLGSGSDTLSSVSISKSMFEVITRDVLLEKTEYNVELYEGSGANWKLAKSATPGKLGSFE  128

Query  511  DILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            D+LF++ +M D+PV++A+    R+   +VG+ + D+T
Sbjct  129  DVLFSSIDMHDTPVVMAVWTVARDQEQLVGIAFTDMT  165



>ref|XP_002982304.1| hypothetical protein SELMODRAFT_268576 [Selaginella moellendorffii]
 gb|EFJ16549.1| hypothetical protein SELMODRAFT_268576 [Selaginella moellendorffii]
Length=936

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  136  FEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHT  315
             E+  KLPELKLDAKQAQGF+ FF+ LP D  V+RFFDRRDY+TAHG+NA+ IA+ YY T
Sbjct  1    MEDDPKLPELKLDAKQAQGFIKFFRKLPEDPSVIRFFDRRDYFTAHGDNASLIARLYYRT  60

Query  316  TTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGN  495
            TTALRQ+GSG   +SSVS+S++MFE I RD+LLE+T++ +ELYEGSG NW+L K+ TPG 
Sbjct  61   TTALRQVGSGSDTLSSVSISKSMFEVITRDVLLEKTEYNVELYEGSGGNWKLAKSATPGK  120

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            LGSFED+LF++ +M D+PV++A+    R+   +VG+ + D+T
Sbjct  121  LGSFEDVLFSSIDMHDTPVVMAVWTVARDQEQLVGIAFTDMT  162



>ref|XP_011102331.1| PREDICTED: DNA mismatch repair protein MSH2-like isoform X2 [Sesamum 
indicum]
 ref|XP_011102332.1| PREDICTED: DNA mismatch repair protein MSH2-like isoform X2 [Sesamum 
indicum]
 ref|XP_011102333.1| PREDICTED: DNA mismatch repair protein MSH2-like isoform X2 [Sesamum 
indicum]
Length=854

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +1

Query  382  MFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVA  561
            MFET+ARD+LLER DHTLELYEG+G+NWRLVK+ TPGNLGSFE+ILFANNEMQDSPVIVA
Sbjct  1    MFETVARDVLLERADHTLELYEGTGANWRLVKSATPGNLGSFEEILFANNEMQDSPVIVA  60

Query  562  LVPNIRENGCVVGLGYVDLT  621
            L+ N RENGC VGL YVDLT
Sbjct  61   LIANFRENGCAVGLSYVDLT  80



>tpg|DAA45374.1| TPA: hypothetical protein ZEAMMB73_164133 [Zea mays]
Length=855

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG  A FIA+TYYHT +ALR LGS  G ISSV +S+ MFETI R +LL+RTD TLELY
Sbjct  101  TVHGEKAMFIARTYYHTISALRHLGSNSGGISSVGVSKAMFETIVRKILLDRTDCTLELY  160

Query  445  EGSGSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVI  555
            EGSGS+WRL K+G PGN+G FEDILF NN+MQ+SPV+
Sbjct  161  EGSGSDWRLTKSGKPGNIGGFEDILFINNDMQESPVM  197



>tpg|DAA37234.1| TPA: hypothetical protein ZEAMMB73_988752 [Zea mays]
Length=679

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            TAHG NA FIA+TYYHT +ALR LGS  G ISSV +S  MFETI R +LL+RTD TL+ Y
Sbjct  317  TAHGENAMFIARTYYHTISALRHLGSNSGGISSVGVSEAMFETIVRKILLDRTDCTLDFY  376

Query  445  EGSGSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVI  555
            EGS S+WRL K+G PGN+G FEDILF NN+MQ+SPV+
Sbjct  377  EGSSSDWRLSKSGKPGNIGGFEDILFINNDMQESPVM  413



>ref|XP_003056389.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59765.1| predicted protein [Micromonas pusilla CCMP1545]
Length=978

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 105/155 (68%), Gaps = 1/155 (1%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            +L  +    +GF+S+F++LP D  V+R F  +++++ HG +A F+A+ +Y+TTT +R +G
Sbjct  15   DLSFNENDKKGFISYFRSLPDDKNVLRIFKVKEFFSVHGEDANFVARNFYNTTTVVRYIG  74

Query  340  SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-WRLVKTGTPGNLGSFEDI  516
             G  A+  V+ +R+MFET+ R +LL+  D ++ELYE S    W+LV+T +PG L +FE+ 
Sbjct  75   HGESALPGVTFNRSMFETVIRTVLLDVNDRSVELYEDSPRQGWKLVRTASPGRLCAFEEE  134

Query  517  LFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L+  +E+ D+PV+ A+   IR +  +VG+ Y +LT
Sbjct  135  LYCASELVDTPVVTAVRIAIRHDQRLVGVAYANLT  169



>ref|XP_005646040.1| DNA mismatch repair protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21496.1| DNA mismatch repair protein [Coccomyxa subellipsoidea C-169]
Length=909

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 101/153 (66%), Gaps = 0/153 (0%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            PEL  D +   GF+++FK L  +  +VRFFDR+D+Y+ HG NA FIA+T+Y TT  ++ +
Sbjct  9    PELSKDDRSDNGFVNWFKALNQEPTLVRFFDRKDFYSVHGENALFIARTFYKTTAVVKYM  68

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKTGTPGNLGSFEDI  516
            G     +  V++++N+FET  R LL+E  +++++++EGSG+ WR  +  +PG LG+FE+ 
Sbjct  69   GGSATGLPGVTLNKNLFETAVRHLLVESAEYSVQMFEGSGTQWRKTREASPGKLGAFEEE  128

Query  517  LFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            LF N +M D PV+ AL+    E    VG+ + D
Sbjct  129  LFRNVDMTDVPVVAALLLGYSEGARTVGIAFAD  161



>ref|XP_002507226.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68484.1| predicted protein [Micromonas sp. RCC299]
Length=963

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +1

Query  169  LDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLGSGP  348
            LD    +GF++F+++LP+D +++R F R+D Y+ HG+NA  IA+T+  TTTAL  LG G 
Sbjct  11   LDESDRKGFVAFYRSLPADPKIIRIFSRKDNYSVHGDNAVLIARTFLKTTTALHYLGHGE  70

Query  349  GAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-WRLVKTGTPGNLGSFEDILFA  525
             A+  ++++RN+FE+I R+LLL+RT+H +ELYE +    W+L +T +PG L +FE+ L  
Sbjct  71   SALPGLTLNRNLFESILRELLLDRTEHLVELYEETSRQVWKLSRTASPGKLDAFEEELNR  130

Query  526  NNEMQDSPVIVALVPNIRENGCVVGLGY  609
            ++++ D+P + A+   +R +   VG  Y
Sbjct  131  SDDLFDTPAVAAVQVKVRMDQQHVGFAY  158



>gb|KIY98739.1| DNA mismatch repair protein Msh2, partial [Monoraphidium neglectum]
Length=563

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 101/167 (60%), Gaps = 14/167 (8%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            PEL LDA    GF  +FK+L  D +++RFFDR+ +Y+ HG NA F+A+T+Y TT  ++ L
Sbjct  8    PELTLDANSQTGFFKWFKSLDQDPKLLRFFDRKGFYSCHGENALFVARTFYRTTAVVKYL  67

Query  337  GSGPGA--------------ISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLV  474
            G+  G               + SV+++R +FE   RDLLLE   H++EL++G G++W++ 
Sbjct  68   GAAGGGAGGGAGTPPPGAAGLPSVTLNRQLFEGALRDLLLEGGQHSVELWDGYGAHWKVA  127

Query  475  KTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            K+ +PG L +FED LF   E  D+P++ A+     E    VG  ++D
Sbjct  128  KSASPGRLSAFEDELFRGGEAADAPLVAAVALGYSEGQRTVGAAFLD  174



>ref|XP_002955323.1| hypothetical protein VOLCADRAFT_96164 [Volvox carteri f. nagariensis]
 gb|EFJ43623.1| hypothetical protein VOLCADRAFT_96164 [Volvox carteri f. nagariensis]
Length=890

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 100/165 (61%), Gaps = 4/165 (2%)
 Frame = +1

Query  121  KMDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAK  300
            +MDE+       P+  LD K  + F+ F KTL  D  ++RFFDR+ YY+ HG  A  IA+
Sbjct  10   EMDEEDANVEVAPK-DLDDKSLRAFMGFHKTLTEDPHIIRFFDRKGYYSVHGPAANTIAR  68

Query  301  TYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSNWRLVKT  480
             +Y TT  +R   SG   +  V+++R MFETI R+LLL  T H +ELYE  G+ W+LV++
Sbjct  69   QFYRTTAVVRGADSG---LPYVNVNRAMFETILRELLLGGTAHIVELYESVGTGWKLVRS  125

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
             TPG L +F++ L+ + EM + P++ A+   + E     G+ YVD
Sbjct  126  ATPGKLSAFDEELYRSAEMSEVPLVAAITFTVYEGQVTAGVAYVD  170



>ref|XP_009063476.1| hypothetical protein LOTGIDRAFT_195636 [Lottia gigantea]
 gb|ESO85742.1| hypothetical protein LOTGIDRAFT_195636 [Lottia gigantea]
Length=921

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 95/159 (60%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            EL+LD  Q QGFL+F + LP   +  +R FDR DYYT HG +A F+AK  + TT  ++ L
Sbjct  8    ELQLDFSQEQGFLAFHRDLPEKPSTTLRVFDRTDYYTVHGQDAIFVAKEVFKTTGVVKYL  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G G   + SV +S+  FE++ RDLLL +  + +E+Y   GS    +W L    +PGNL  
Sbjct  68   GGGTKKLESVVLSKMNFESLMRDLLLVQQ-YRVEVYRNKGSSKNNDWILALKASPGNLSQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FEDILF NNEM  S  ++ +  +      +VG+GY D T
Sbjct  127  FEDILFTNNEMAGSIGVIGIKVSTDNGQKIVGIGYADAT  165



>ref|XP_004363541.2| Msh2 protein [Capsaspora owczarzaki ATCC 30864]
Length=885

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (61%), Gaps = 15/176 (9%)
 Frame = +1

Query  124  MDEKFEEQ----NKLPELKLDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNAT  288
            MDE  E Q    N+  +++LD +  QGFLSF++ LP  +       DR+DYY+ HG++A 
Sbjct  1    MDEDDEPQGSGGNQQSQIELDNRTEQGFLSFYRGLPEKSATTVRIFDRQDYYSVHGDDAV  60

Query  289  FIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYE---GSGS  459
             +AK +YHT   ++ +G+ P     V+MS+ MFETI R+LLL R +  +E+Y    G  S
Sbjct  61   LVAKEFYHTLAVIKHIGTVP----YVTMSQLMFETILRELLLLRQNR-VEVYAREGGKNS  115

Query  460  N-WRLVKTGTPGNLGSFEDILF-ANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            N W L + G+PGNL  FED+LF  N+EM  S V++A+   + +   +VG+ + D T
Sbjct  116  NAWVLSRRGSPGNLQQFEDMLFTGNSEMSTSAVVMAIKLGVDDGNRMVGVSFADAT  171



>ref|XP_005098367.1| PREDICTED: DNA mismatch repair protein Msh2-like [Aplysia californica]
Length=930

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 94/157 (60%), Gaps = 6/157 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSDT-rvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +L+LD  Q QGFLSFF +LP      +R FDR DYYT HG +A F+AK  + T+  ++ +
Sbjct  8    DLQLDNVQEQGFLSFFSSLPEKLGTTLRVFDRTDYYTVHGQDALFVAKEVFKTSGVIKFI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYE----GSGSNWRLVKTGTPGNLGS  504
            G+G   + SV +SR  FE +ARDLLL R  + +E+Y     G  ++W L    +PGNL  
Sbjct  68   GTGSKKLESVVLSRMNFEALARDLLLVRQ-YRIEVYGNKAGGKSNDWSLSFKASPGNLTQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            FEDILF N EM  S  +V L     +   VVG+GY D
Sbjct  127  FEDILFGNTEMSASGGVVGLKVASDDGQTVVGIGYAD  163



>ref|XP_002154213.2| PREDICTED: DNA mismatch repair protein Msh2-like [Hydra vulgaris]
Length=911

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 76/122 (62%), Gaps = 4/122 (3%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T H ++A F AK  + T + +++LGSG   I SV++S+N FE   R+LLL R  + +ELY
Sbjct  45   TVHNDDAIFAAKELFKTQSVIKELGSGNKKILSVALSKNNFEKFLRELLLIRQ-YRVELY  103

Query  445  E---GSGSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
                G  + W LV   +PGNL  FE++LF NNEM D  VI++L  +  EN  ++G  +VD
Sbjct  104  RNKTGKSNQWDLVGKASPGNLQQFEEMLFGNNEMSDMAVILSLKVSSNENQKLIGAAFVD  163

Query  616  LT  621
            LT
Sbjct  164  LT  165



>ref|XP_001415744.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94036.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=936

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 93/146 (64%), Gaps = 7/146 (5%)
 Frame = +1

Query  193  FLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVS  369
            F+ F++ LPS+T  V  F DR+D  +AHG++A +IA+ +Y TT+ ++ +GSG  A+  V+
Sbjct  26   FVRFYRGLPSETARVVRFFDRKDCISAHGDDAMYIARAFYKTTSVIKTMGSGDDALPGVA  85

Query  370  MSRNMFETIARDLLLERTDHTLELYEGSGSN--WRLVKTGTPGNLGSFEDILFANNEMQD  543
            ++R+MFE+  R+LLL+     +E YE S  +  W  VK+ +PG L +FED LF +NEM D
Sbjct  86   LNRSMFESALRELLLDGDGARVEFYEESKPSGTWTCVKSASPGKLQAFEDELFRSNEMSD  145

Query  544  SPVIVALVPNIRENGCVVGLGYVDLT  621
            + V+ A    +R     VG+ Y + T
Sbjct  146  ASVVCA----VRVANGNVGVAYANTT  167



>gb|KJE92931.1| Msh2 protein [Capsaspora owczarzaki ATCC 30864]
Length=909

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 109/196 (56%), Gaps = 35/196 (18%)
 Frame = +1

Query  124  MDEKFEEQ----NKLPELKLDAKQAQGFLSFFKTLP---------------------SDT  228
            MDE  E Q    N+  +++LD +  QGFLSF++ LP                        
Sbjct  1    MDEDDEPQGSGGNQQSQIELDNRTEQGFLSFYRGLPEARCRCCMSFCQCCGFSRQTCKSA  60

Query  229  rvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDL  408
              VR FDR+DYY+ HG++A  +AK +YHT   ++ +G+ P     V+MS+ MFETI R+L
Sbjct  61   TTVRIFDRQDYYSVHGDDAVLVAKEFYHTLAVIKHIGTVP----YVTMSQLMFETILREL  116

Query  409  LLERTDHTLELYE---GSGSN-WRLVKTGTPGNLGSFEDILF-ANNEMQDSPVIVALVPN  573
            LL R +  +E+Y    G  SN W L + G+PGNL  FED+LF  N+EM  S V++A+   
Sbjct  117  LLLRQNR-VEVYAREGGKNSNAWVLSRRGSPGNLQQFEDMLFTGNSEMSTSAVVMAIKLG  175

Query  574  IRENGCVVGLGYVDLT  621
            + +   +VG+ + D T
Sbjct  176  VDDGNRMVGVSFADAT  191



>ref|XP_001619624.1| hypothetical protein NEMVEDRAFT_v1g224004 [Nematostella vectensis]
 gb|EDO27524.1| predicted protein, partial [Nematostella vectensis]
Length=273

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG +A F AK  + T++ ++ LG+G   + SV +S+  FE+  RDLLL R  + +E+Y
Sbjct  63   TVHGPDALFAAKEVFKTSSVVKYLGTGDHKVPSVVLSKMNFESTCRDLLLIR-QYRIEMY  121

Query  445  EGSG----SNWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYV  612
               G    S W LV  G+PGNL  FEDILF N+EM  S V++A+         VVG+ Y 
Sbjct  122  RSKGGKNSSAWELVAKGSPGNLQQFEDILFGNSEMSASAVVMAIKLGTVTGQRVVGVAYA  181

Query  613  DL  618
            D+
Sbjct  182  DV  183



>ref|XP_011437807.1| PREDICTED: DNA mismatch repair protein Msh2-like [Crassostrea 
gigas]
 gb|EKC26394.1| DNA mismatch repair protein Msh2 [Crassostrea gigas]
Length=915

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  169  LDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLGSG  345
            +DA Q QGF+S FK+LP   +  VRFFDR DYYT HG +A F+AK  + T   ++ LG+G
Sbjct  1    MDAFQDQGFISAFKSLPEKPSTTVRFFDRTDYYTVHGQDAVFVAKEVFKTVAVIKYLGAG  60

Query  346  PGAISSVSMSRNMFETIARDLLLERTDHTLELYE---GSGSN-WRLVKTGTPGNLGSFED  513
               + SV++S+  FE++ ++LLL R  + +E+++   GS +N W L    +PGNL  FED
Sbjct  61   EKKLESVTVSKLNFESLVKELLLIR-QYRVEIFKNKTGSKNNEWMLAFKASPGNLTQFED  119

Query  514  ILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDL  618
            ILF N+++  S  ++ L      N  +VG+G+ D+
Sbjct  120  ILFGNSDISQSVGVLGLKIGTENNERMVGVGFADV  154



>dbj|GAM86574.1| hypothetical protein ANO11243_045880 [fungal sp. No.11243]
Length=935

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (65%), Gaps = 7/137 (5%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            PELK+D +   GF+ FF+ LP+   V+R F+R D+YTAHG++A FIA+T Y TT+ LRQL
Sbjct  5    PELKVDDEI--GFIRFFRGLPTSDDVIRIFNRGDFYTAHGDDAAFIARTVYKTTSVLRQL  62

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-WRLVKTGTPGNLGSFED  513
            G  PG +SSV++S  +F    R+ L  R    +E+YE SG N W++ K  +PGNL   ED
Sbjct  63   GRDPG-LSSVTLSITVFRNFLREALF-RLGKRVEIYETSGRNTWKVTKNASPGNLQDIED  120

Query  514  ILFANNEMQDSPVIVAL  564
             L     +  +P+I+A+
Sbjct  121  EL--GGALDSAPIILAV  135



>ref|XP_006571175.1| PREDICTED: DNA mismatch repair protein Msh2 [Apis mellifera]
Length=921

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 91/159 (57%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D    Q F+ FFK LP      VRFF+R DYYT HGN+A F A+  + TT+  + +
Sbjct  8    QFNMDPSSQQSFVRFFKNLPEKLNTTVRFFNRSDYYTLHGNDALFAAQEIFKTTSVCKMI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G+ P     V +++N FE+  RDLLL +  + +E+Y   G+    NW L   G+PGNL  
Sbjct  68   GADPYKTEGVILNKNHFESFIRDLLLVK-QYRVEVYINQGTAKNQNWILEYKGSPGNLTQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FEDILF NN++  S  ++A+   I     +VGL  VD T
Sbjct  127  FEDILFGNNDIAVSVRVIAVKLGIEGKFRIVGLSCVDTT  165



>ref|XP_002740239.1| PREDICTED: DNA mismatch repair protein Msh2 [Saccoglossus kowalevskii]
Length=929

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 90/160 (56%), Gaps = 8/160 (5%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            +L LD  Q QGFLSFF+++    DT    F     Y T HG++A F AK  + TT  ++ 
Sbjct  8    QLSLDFVQEQGFLSFFRSMSEKPDTTFRVFDRTEYY-TCHGSDAVFAAKEVFKTTGVIKY  66

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYE----GSGSNWRLVKTGTPGNLG  501
            LG+G   + SV +S+  FE++ +DLLL R  + +E+Y+    G  ++W L    +PGNL 
Sbjct  67   LGTGTKKVESVVLSKMNFESLVKDLLLVR-QYRVEVYKNKGGGKNNDWTLEFKASPGNLT  125

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
             FE+ILF  N+M  S  ++A+   +     ++G  + D T
Sbjct  126  QFEEILFGANDMSTSACVLAVKMAMDGGHKIIGAAFADAT  165



>ref|XP_003493495.1| PREDICTED: DNA mismatch repair protein Msh2-like [Bombus impatiens]
Length=921

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 90/159 (57%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D    Q F+ FFK LP      +RFF+R DYYT HGN+A F A+  + TT+  + +
Sbjct  8    QFNMDPPSQQSFVRFFKNLPEKLNTTIRFFNRSDYYTLHGNDALFAAQEVFKTTSVCKMI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G+ P     V +++N FE+  RDLLL +  + +E+Y   GS    NW L   G+PGNL  
Sbjct  68   GADPYKTEGVILNKNHFESFIRDLLLVK-QYRVEVYVNQGSAKNQNWVLEYKGSPGNLTQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FED LF NN++  S  ++A+   +     +VGL  VD T
Sbjct  127  FEDTLFGNNDVAVSVHVIAVKLGMEAKSRIVGLSCVDTT  165



>ref|XP_003706395.1| PREDICTED: DNA mismatch repair protein Msh2-like [Megachile rotundata]
Length=920

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 90/159 (57%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D    Q F+ FFK LP      +RFF+R DYYT HG++A F A+  + TT   + +
Sbjct  8    QFNMDPPTQQSFVRFFKNLPEKLNTTIRFFNRSDYYTLHGSDALFAAQEVFKTTAVCKMI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G+ P     V +++N FE   RDLLL +  + +E+Y   GS    NW L  TG+PGNL  
Sbjct  68   GADPYKTEGVILNKNHFEAFIRDLLLVK-QYRIEVYVNQGSSKNQNWVLEFTGSPGNLSQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FED+LF NN++  S  ++A+   +     VVGL  VD T
Sbjct  127  FEDVLFGNNDIAVSVRVIAVKLGMDGKSRVVGLSCVDTT  165



>ref|XP_006614540.1| PREDICTED: DNA mismatch repair protein Msh2-like [Apis dorsata]
Length=921

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 92/159 (58%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D+   Q F+ FFK LP      VRFF+R DYYT HGN+A F A+  + TT+  + +
Sbjct  8    QFNMDSSSQQSFVRFFKNLPEKLNTTVRFFNRSDYYTLHGNDALFAAQEIFKTTSVCKII  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G+ P     V +++N FE+  RDLLL +  + +E+Y   G+    NW L   G+PGNL  
Sbjct  68   GADPYKTEGVILNKNHFESFIRDLLLVK-QYRVEVYINQGTAKNQNWILEYKGSPGNLTQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FEDILF NN++  S  ++A+   +     +VGL  VD T
Sbjct  127  FEDILFGNNDIAVSVRVIAVKLGMEGKFRIVGLSCVDTT  165



>ref|XP_003393508.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein Msh2-like 
[Bombus terrestris]
Length=921

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 90/159 (57%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D    Q F+ FFK LP      +RFF+R DYYT HGN+A F A+  + TT+  + +
Sbjct  8    QFNMDPPSQQSFVRFFKNLPEKLNTTIRFFNRSDYYTLHGNDALFAAQEVFKTTSVCKMI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G+ P     V +++N FE+  RDLLL +  + +E+Y   GS    NW L   G+PGNL  
Sbjct  68   GAEPYKTEGVILNKNHFESFIRDLLLVK-QYRVEVYVNQGSAKNQNWVLEYKGSPGNLTQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FED LF NN++  S  ++A+   +     +VGL  VD T
Sbjct  127  FEDTLFGNNDVAVSVHVIAVKLGMEAKSRIVGLSCVDTT  165



>ref|XP_011152479.1| PREDICTED: DNA mismatch repair protein Msh2 [Harpegnathos saltator]
Length=922

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 90/159 (57%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D    Q F+ FFK+LP      +RFF+R DYYT HG++A F A+  + +T+  + +
Sbjct  8    QFSMDPPTQQSFVRFFKSLPEKLNTTIRFFNRADYYTVHGSDALFAAQEVFKSTSVCKMI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G+ P     V +++N FET  RDLLL +  + +E+Y   GS    NW L   G+PGNL  
Sbjct  68   GAEPHKTEGVILNKNHFETFVRDLLLVKQ-YRVEVYVNQGSAKNQNWILEYKGSPGNLSH  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FEDILF NN++     ++A+         VVGL  VD+ 
Sbjct  127  FEDILFGNNDIAVGVSVIAVKLGTEGKSRVVGLSCVDVV  165



>ref|XP_011252841.1| PREDICTED: DNA mismatch repair protein Msh2 isoform X1 [Camponotus 
floridanus]
Length=924

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 86/160 (54%), Gaps = 8/160 (5%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            +L +D    Q F+ FFK+LP   DT +  F     Y T HG++A F A+  + TT+  + 
Sbjct  8    QLSMDPPTQQSFVRFFKSLPEKLDTTIRFFNRSDYY-TLHGSDALFAAQEVFKTTSVCKM  66

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLG  501
            +G+ P     V +++  FET  RDLLL +  + +E+Y   GS    NW L   G+PGNL 
Sbjct  67   IGAEPHKTEGVILNKGHFETFVRDLLLVK-QYRVEVYVNQGSSKNQNWVLEHKGSPGNLS  125

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
             FEDILF NN++     ++A+         VVGL  VD+ 
Sbjct  126  HFEDILFGNNDIAVGVSVIAVKLGTEGKSRVVGLSCVDVV  165



>ref|XP_003697302.1| PREDICTED: DNA mismatch repair protein Msh2-like [Apis florea]
Length=919

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 92/159 (58%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D    Q F+ FFK+LP      VRFF+R DYYT HGN+A F A+  + TT+  + +
Sbjct  8    QFNMDPSSQQSFVRFFKSLPEKLNTTVRFFNRSDYYTLHGNDALFAAQEIFKTTSVCKMI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G+ P     V +++N FE+  RDLLL +  + +E+Y   G+    NW L   G+PGNL  
Sbjct  68   GADPYKTEGVILNKNHFESFIRDLLLVK-QYRVEVYINQGTAKNQNWILEYKGSPGNLTQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FEDILF +N++  S  ++A+   +     +VGL  VD T
Sbjct  127  FEDILFGSNDIAVSVRVIAVKLGMEGKFRIVGLSCVDTT  165



>ref|XP_007589160.1| putative dna mismatch repair protein msh-2 protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD43366.1| putative dna mismatch repair protein msh-2 protein [Neofusicoccum 
parvum UCRNP2]
Length=935

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 93/158 (59%), Gaps = 13/158 (8%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP---SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELK++ +   GF+ FF++LP   SDT  +         TAHG++ATFIA+T Y TT+ L
Sbjct  5    PELKVEDEP--GFIRFFRSLPEKQSDTVRIFDRGDFY--TAHGDDATFIARTVYRTTSVL  60

Query  328  RQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-SNWRLVKTGTPGNLGS  504
            RQLG  PG + SV++S  +F    R+ L  R    +E++E +G SNW++ K  +PGNL  
Sbjct  61   RQLGREPG-LESVTLSVTVFRNFLREALF-RLGKRIEIWESTGRSNWKVTKQASPGNLQD  118

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCV-VGLGYVD  615
             E+ L    ++  +P+I+A+    R +    VG+ + D
Sbjct  119  VEEDL--GGQLDSAPIILAVKITARASEARHVGVCFAD  154



>pir||S53609 DNA mismatch repair protein MSH2 - African clawed frog
Length=933

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 91/162 (56%), Gaps = 9/162 (6%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +L +D+    GFL F++++P          DR DYYT HG +A F AK  + T   ++ L
Sbjct  8    KLSMDSGAENGFLHFYQSMPEKPDTTVRVFDRNDYYTVHGGDALFAAKEVFKTNGVIKYL  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-------SNWRLVKTGTPGN  495
            GSG   + SV +S+  FE++ +DLLL R  + +E+Y+          ++W+L    +PGN
Sbjct  68   GSGNKKLESVVLSKMNFESVVKDLLLVR-QYRVEVYKNKSGGKYSKENDWQLAFKASPGN  126

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FE+ILF NN+M  +  +V +     E   +VG+GYVD T
Sbjct  127  LTQFEEILFGNNDMSTAVGVVGIKLVSSEGQRLVGVGYVDST  168



>ref|XP_003081646.1| Mismatch repair ATPase MSH4 (MutS family) (ISS) [Ostreococcus 
tauri]
Length=913

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHT-LEL  441
            + HG +A ++A+T+Y TT+ ++  G G  A++ V+++R MFET  R+LL+E  +   +EL
Sbjct  39   SVHGADAEYVARTFYKTTSVIKHTGRGEDALAGVTLNRAMFETALRELLIEGAEGARVEL  98

Query  442  YEGS--GSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            YE S     W L KT +PG   +FE+ LF +NEM D+ V+ A+      +G  VG+ YV+
Sbjct  99   YEESKPSGTWTLSKTASPGRTQAFEEELFRSNEMSDAAVVCAVRAT---SGGGVGVAYVN  155

Query  616  LT  621
             T
Sbjct  156  AT  157



>emb|CEF99387.1| DNA mismatch repair protein, MSH2 [Ostreococcus tauri]
Length=926

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 6/122 (5%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHT-LEL  441
            + HG +A ++A+T+Y TT+ ++  G G  A++ V+++R MFET  R+LL+E  +   +EL
Sbjct  39   SVHGADAEYVARTFYKTTSVIKHTGRGEDALAGVTLNRAMFETALRELLIEGAEGARVEL  98

Query  442  YEGS--GSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            YE S     W L KT +PG   +FE+ LF +NEM D+ V+ A+      +G  VG+ YV+
Sbjct  99   YEESKPSGTWTLSKTASPGRTQAFEEELFRSNEMSDAAVVCAVRAT---SGGGVGVAYVN  155

Query  616  LT  621
             T
Sbjct  156  AT  157



>ref|XP_011169227.1| PREDICTED: DNA mismatch repair protein Msh2 isoform X2 [Solenopsis 
invicta]
Length=922

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 86/160 (54%), Gaps = 8/160 (5%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            +  +D    Q F+ FFK+LP   DT +  F     Y T HG++A F A+  + TT+  + 
Sbjct  8    QFHMDPPTQQSFVRFFKSLPEKLDTTIRFFNRSDYY-TVHGSDALFAAQEIFKTTSVCKM  66

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLG  501
            +G+ P     V ++++ FET  RDLLL +  + +E+Y   GS    NW L   G+PGNL 
Sbjct  67   IGAEPHKTEGVILNKSHFETFVRDLLLVKQ-YRVEVYVNQGSSKNQNWILEYKGSPGNLS  125

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
             FEDILF NN++     ++A+         VVGL  VD+ 
Sbjct  126  HFEDILFGNNDVAVGVSVIAVKLGTEGKSRVVGLSCVDVV  165



>ref|XP_002935427.2| PREDICTED: DNA mismatch repair protein Msh2 [Xenopus (Silurana) 
tropicalis]
Length=932

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 92/162 (57%), Gaps = 9/162 (6%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +L +D+    GF+SF++++P          DR DYYT HG +A F AK  + T   ++ L
Sbjct  8    KLSMDSGAENGFISFYQSMPEKPDTTVRVFDRNDYYTVHGGDAIFAAKEVFKTNGVIKYL  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-------SNWRLVKTGTPGN  495
            GSG   + SV +S+  FE++ +DLLL R  + +E+Y+          ++W+L    +PGN
Sbjct  68   GSGSKKLESVVLSKMNFESVVKDLLLVR-QYRVEVYKNKSGGKSSKENDWQLAFKASPGN  126

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FE+ILF N++M  +  +V +     E   +VG+GYVD T
Sbjct  127  LTQFEEILFGNSDMSTAVGVVGIKLVSAEGQRLVGVGYVDST  168



>gb|KFY03717.1| hypothetical protein O988_01278 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=922

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 92/140 (66%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK LP+ D+  +R F+R DYYTAHG++A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKGLPTEDSETIRIFNRGDYYTAHGDDASFIARTVYKTTSVLRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG S    + SV+M+  +F    R+ L  R    +E++E SG   +W++VK  +PGNL  
Sbjct  63   LGKSDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESSGGRMHWKVVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    ++  +P+++A+
Sbjct  122  IEDEL--GGQIDAAPIMLAV  139



>gb|KFX99088.1| hypothetical protein V490_01957 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=922

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 91/140 (65%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKGLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG S    + SV+M+  +F    R+ L  R    +E++E SG   +W++VK  +PGNL  
Sbjct  63   LGKSDHTGLPSVTMTVTVFRNFLREALF-RLSKRIEVWESSGGRMHWKVVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    ++  +P+++A+
Sbjct  122  IEDEL--GGQIDAAPIMLAV  139



>ref|XP_011341920.1| PREDICTED: DNA mismatch repair protein Msh2 [Cerapachys biroi]
Length=922

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 85/160 (53%), Gaps = 8/160 (5%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            +  +D    Q F+ FFK+LP   DT +  F     Y T HG++A F A+  + TT+  + 
Sbjct  8    QFSMDPPTQQSFVRFFKSLPEKLDTTIRFFNRSDYY-TVHGSDALFAAQEVFKTTSVCKM  66

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLG  501
            +G+ P     V +++  FET  RDLLL +  + +E+Y   GS    NW L   G+PGNL 
Sbjct  67   IGAEPHKTKGVILNKGHFETFVRDLLLVK-QYRVEVYINQGSSKNQNWVLEYKGSPGNLS  125

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
             FEDILF NN++     ++A+         +VGL  VD+ 
Sbjct  126  HFEDILFGNNDVAVGVSVIAVKLGAEGKSRIVGLSCVDVV  165



>gb|KIH88997.1| DNA mismatch repair protein MSH2 [Sporothrix brasiliensis 5110]
Length=939

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 96/160 (60%), Gaps = 11/160 (7%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ +FK+LP  D   +R FDR D+YTAHG+NA FIA+T Y TT+ +RQ
Sbjct  5    PELKVDDEH--GFIRYFKSLPVIDDDTIRIFDRGDWYTAHGDNANFIARTVYKTTSVVRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG      + SV+M+  +F    R+ L  +    +E+Y  SG   NW++VK  +PGNL  
Sbjct  63   LGRNDHTGLPSVTMTVTVFRQFLREALF-KLGKRIEIYASSGGRMNWKIVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVDLT  621
             ED L    +  ++P+I+A+  + R N    VG+ + D T
Sbjct  122  VEDDL---GQFDNAPMILAVKLSARANEARTVGVCFADAT  158



>ref|XP_007798315.1| putative dna mismatch repair protein msh-2 protein [Eutypa lata 
UCREL1]
 gb|EMR62591.1| putative dna mismatch repair protein msh-2 protein [Eutypa lata 
UCREL1]
Length=938

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 96/157 (61%), Gaps = 9/157 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PEL++D +   GF+ +FK+LP+ D   +R FDR D+YTAHG+NA FIA+T Y TT+ +RQ
Sbjct  5    PELRVDDEH--GFIRYFKSLPAVDAETIRIFDRGDWYTAHGDNANFIARTVYKTTSVVRQ  62

Query  334  LGSGPGA-ISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG    + + SV+M+  +F    R+ L  +    +E+Y  SG   NW++VK  +PGNL  
Sbjct  63   LGRNDASGLPSVTMTITVFRQFLREALF-KLGKRVEIYASSGGRMNWKVVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
             ED L    ++  +P+I+A+  + +     VG+ + D
Sbjct  122  VEDEL--GGQVDSAPMILAVKISAKAEVRTVGVCFAD  156



>ref|NP_001154964.1| mutS homolog 2 [Nasonia vitripennis]
Length=919

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 95/158 (60%), Gaps = 6/158 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D+   QGF+ FFK+LP   +  +RFF+R DYYT HG++A F A+  + TT+  +++
Sbjct  8    QFDMDSATQQGFVRFFKSLPEKPSSTIRFFNRSDYYTLHGSDALFAAQEVFKTTSVCKKI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G     I  V +++N FET  RDLLL +  + +E+Y   GS    +W +   G+PGNL  
Sbjct  68   GPEHNKIDGVILNKNNFETFVRDLLLVKQ-YRVEVYVNRGSHKNQDWIVEYKGSPGNLAQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDL  618
            FED+LF N+E+     ++A+  +   +  VVG+  +D+
Sbjct  127  FEDMLFNNSEVAVEAGVIAVKFSAEASSKVVGICCIDV  164



>gb|ERT02672.1| DNA mismatch repair protein msh-2 [Sporothrix schenckii ATCC 
58251]
Length=939

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 96/160 (60%), Gaps = 11/160 (7%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ +FK+LP  D   +R FDR D+YTAHG+NA FIA+T Y TT+ +RQ
Sbjct  5    PELKVDDEH--GFIRYFKSLPVIDDDTIRIFDRGDWYTAHGDNANFIARTVYKTTSVVRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG      + SV+M+  +F    R+ L  +    +E+Y  SG   NW++VK  +PGNL  
Sbjct  63   LGRNDHTGLPSVTMTVTVFRQFLREALF-KLGKRVEIYASSGGRMNWKIVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVDLT  621
             ED L    +  ++P+I+A+  + R N    VG+ + D T
Sbjct  122  VEDDL---GQFDNAPMILAVKLSARANEARTVGVCFADAT  158



>ref|XP_011169226.1| PREDICTED: DNA mismatch repair protein Msh2 isoform X1 [Solenopsis 
invicta]
Length=948

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 85/155 (55%), Gaps = 6/155 (4%)
 Frame = +1

Query  172  DAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLGSGP  348
            D    Q F+ FFK+LP        F +R DYYT HG++A F A+  + TT+  + +G+ P
Sbjct  38   DPPTQQSFVRFFKSLPEKLDTTIRFFNRSDYYTVHGSDALFAAQEIFKTTSVCKMIGAEP  97

Query  349  GAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGSFEDI  516
                 V ++++ FET  RDLLL +  + +E+Y   GS    NW L   G+PGNL  FEDI
Sbjct  98   HKTEGVILNKSHFETFVRDLLLVK-QYRVEVYVNQGSSKNQNWILEYKGSPGNLSHFEDI  156

Query  517  LFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            LF NN++     ++A+         VVGL  VD+ 
Sbjct  157  LFGNNDVAVGVSVIAVKLGTEGKSRVVGLSCVDVV  191



>gb|KFY44683.1| hypothetical protein V495_03312 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY60727.1| hypothetical protein V497_03404 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=1641

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 91/140 (65%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK LPS D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKGLPSEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG S    + SV+M+  +F    R+ L  R    +E++E SG   +W++VK  +PGNL  
Sbjct  63   LGKSDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESSGGRMHWKVVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    ++  +P+++A+
Sbjct  122  IEDEL--GGQIDAAPIMLAV  139



>ref|XP_003729116.1| PREDICTED: DNA mismatch repair protein Msh2 [Strongylocentrotus 
purpuratus]
Length=929

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG +A F A+  + T   ++ LGSG     SV +S+  FE++ RDLLL R  + +E+Y
Sbjct  42   TVHGQDAVFAAREVFKTLGVIKHLGSGANKTESVVLSKMNFESVVRDLLLVRQ-YRVEVY  100

Query  445  E----GSGSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYV  612
                 G  +NW L    +PGNL  FE+ILF NN+M  S  ++A+         +VG+GY 
Sbjct  101  SNQATGKANNWTLAYKASPGNLTQFEEILFGNNDMSSSASVMAVKVTGESGQRLVGVGYA  160

Query  613  DLT  621
            D T
Sbjct  161  DAT  163



>gb|KFY23866.1| hypothetical protein V491_02389 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=315

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 90/139 (65%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKSLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG      + SV+M+  +F    R+ L  R    +E++E +G  +W++ K  +PGNL   
Sbjct  63   LGRNDNTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMHWKVGKQASPGNLQDI  121

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  122  EDEL--GGQIDAAPIMLAV  138



>ref|XP_008210276.1| PREDICTED: mutS homolog 2 isoform X1 [Nasonia vitripennis]
Length=1521

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 95/158 (60%), Gaps = 6/158 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQL  336
            +  +D+   QGF+ FFK+LP   +  +RFF+R DYYT HG++A F A+  + TT+  +++
Sbjct  8    QFDMDSATQQGFVRFFKSLPEKPSSTIRFFNRSDYYTLHGSDALFAAQEVFKTTSVCKKI  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
            G     I  V +++N FET  RDLLL +  + +E+Y   GS    +W +   G+PGNL  
Sbjct  68   GPEHNKIDGVILNKNNFETFVRDLLLVK-QYRVEVYVNRGSHKNQDWIVEYKGSPGNLAQ  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDL  618
            FED+LF N+E+     ++A+  +   +  VVG+  +D+
Sbjct  127  FEDMLFNNSEVAVEAGVIAVKFSAEASSKVVGICCIDV  164



>gb|EPE03362.1| dna mismatch repair protein msh-2 [Ophiostoma piceae UAMH 11346]
Length=945

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 96/160 (60%), Gaps = 11/160 (7%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ +FK+LP+ D   +R FDR D+YTAHG +A FIA+T Y TT+ +RQ
Sbjct  5    PELKVDDEH--GFIRYFKSLPAVDGDTIRIFDRNDWYTAHGEDANFIARTVYKTTSVVRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG      + SV+M+  +F    R+ L  +    +E+Y  SG   NW++VK  +PGNL  
Sbjct  63   LGRNDHTGLPSVTMTVTVFRQFLREALF-KLGKRVEIYASSGGRMNWKIVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVDLT  621
             ED L    +  ++P+I+A+  + R N    VG+ + D T
Sbjct  122  VEDEL---GQFDNAPMILAVKLSARANEARAVGVCFADAT  158



>gb|KEQ74803.1| DNA mismatch repair protein [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=918

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D + A  F+ FFK LP  D   +R FDR DYYTAHG++A FIA+  Y TT+ ++Q
Sbjct  5    PELKVDDEYA--FIKFFKGLPGKDDDTIRLFDRNDYYTAHGDDANFIAQNQYKTTSVIKQ  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-WRLVKTGTPGNLGSFE  510
            LG  PG + SV++S+ +F    R+ L  R    +E+YE  G N + L KT +PGNL   E
Sbjct  63   LGRDPG-LPSVTLSQTVFRNFLREALF-RLGKRIEIYESVGKNKFNLTKTASPGNLQDVE  120

Query  511  DILFANNEMQDSPVIVAL  564
            D L   + M+ +P+I+A+
Sbjct  121  DEL--GSSMEAAPIILAV  136



>ref|XP_010576063.1| PREDICTED: DNA mismatch repair protein Msh2 [Haliaeetus leucocephalus]
Length=936

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPG--AISSVSMSRNMFETIARDLLLERTDHTLE  438
            TAHG +A   A+  + T   +RQL   PG   + SV +S+  FE+  RDLLL R  + +E
Sbjct  46   TAHGADARLAARELFRTRAVIRQLAGAPGTQKLESVVLSKMNFESFVRDLLLVR-HYRVE  104

Query  439  LYE---GSGS----NWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVV  597
            +Y+   GS S    +W L   G+PGNL  FE++LFANN+M  +  +V +  +  +   VV
Sbjct  105  VYKNKAGSKSIKENDWYLAYKGSPGNLAQFEEVLFANNDMSTAIGVVGVKLSTTDGQRVV  164

Query  598  GLGYVDLT  621
            G+GYVD T
Sbjct  165  GVGYVDAT  172



>ref|XP_005491525.1| PREDICTED: DNA mismatch repair protein Msh2 [Zonotrichia albicollis]
Length=936

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPG--AISSVSMSRNMFETIARDLLLERTDHTLE  438
            TAHG +A   A+  + T   +RQL   PG   + SV +S+  FE+  RDLLL R  + +E
Sbjct  46   TAHGADARLAARDLFRTRAVIRQLAGAPGTEKLESVVLSKMNFESFVRDLLLVR-HYRVE  104

Query  439  LYE---GSGS----NWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVV  597
            +Y+   GS S    +W L   G+PGNL  FE++LFANN+M  +  +V +  +  +   VV
Sbjct  105  VYKNKAGSKSVKENDWYLAYKGSPGNLAQFEEVLFANNDMSTAIGVVGVKLSAADGQRVV  164

Query  598  GLGYVDLT  621
            G+GYVD T
Sbjct  165  GVGYVDTT  172



>ref|XP_002113012.1| hypothetical protein TRIADDRAFT_56718 [Trichoplax adhaerens]
 gb|EDV25122.1| hypothetical protein TRIADDRAFT_56718 [Trichoplax adhaerens]
Length=934

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 81/159 (51%), Gaps = 6/159 (4%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdy-yTAHGNNATFIAKTYYHTTTALRQL  336
            +L LD     GF  F  +LP           R   +T HG++A F+A   + + + +R  
Sbjct  8    QLTLDGTNQNGFRRFLDSLPEKLETTIRIFDRSDWFTVHGSDAIFVANNIFRSKSVIRYY  67

Query  337  GSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGS  504
             +G   +  V ++   +E + RDLLL R  + +ELY+  G+     W L +  TPGNL  
Sbjct  68   RNGNEKLEYVVLNNANYEKVLRDLLLVR-QYRIELYKNKGTKTNQQWYLAEKATPGNLRC  126

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            FE+I+F NNEM +S  ++A+   +     ++G+ Y D T
Sbjct  127  FEEIIFGNNEMSESAPVIAIRLVVENGQRIIGVAYADAT  165



>ref|XP_007780867.1| DNA mismatch repair protein msh-2 [Coniosporium apollinis CBS 
100218]
 gb|EON65550.1| DNA mismatch repair protein msh-2 [Coniosporium apollinis CBS 
100218]
Length=920

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 8/138 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            P+LK+D +   GF+ FF+ LPS     VR FDR DYYTAHG +A F+A+T Y TT+ LRQ
Sbjct  5    PDLKVDDEV--GFIRFFRGLPSQGDDTVRLFDRGDYYTAHGEDALFVARTVYRTTSVLRQ  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSFE  510
            LG  PG + SV++S  +F    R+ L  R    +E++E SG  NW++ K  +PGNL   E
Sbjct  63   LGREPG-LDSVTLSVTVFRNFLREALF-RQGKRVEIWETSGRMNWKVTKQASPGNLQDIE  120

Query  511  DILFANNEMQDSPVIVAL  564
            D L    ++  +P+I+A+
Sbjct  121  DEL--GGQLDSAPIILAV  136



>gb|KFY99744.1| hypothetical protein V500_01272 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=921

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 89/139 (64%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKSLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG      + SV+M+  +F    R+ L  R    +E++E +G   W++ K  +PGNL   
Sbjct  63   LGRNDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMQWKIAKQASPGNLQDI  121

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  122  EDEL--GGQIDAAPIMLAV  138



>ref|XP_005824578.1| Msh2 mismatch repair muts-like protein, meiosis and mitosis [Guillardia 
theta CCMP2712]
 gb|EKX37598.1| Msh2 mismatch repair muts-like protein, meiosis and mitosis [Guillardia 
theta CCMP2712]
Length=982

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 91/174 (52%), Gaps = 10/174 (6%)
 Frame = +1

Query  124  MDEKFEEQNKLPELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdyy----TAHGNNATF  291
            MD   E     P L+LD  +AQGF++FFK +P        F  R       + HG +A +
Sbjct  31   MDGAEEAAQSQPSLQLDVGEAQGFIAFFKNMPEPASRTIRFFYRKKEGEFYSCHGEDAVY  90

Query  292  IAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY---EGSGSN  462
            IA+  +HT + L+ +G     + +V++S + F +    LL ER  + +E++   +G  + 
Sbjct  91   IAQECFHTMSVLKHIGKN-NELPAVAVSPSNFNSFVVQLLTERQ-YRVEVWADVKGGKNG  148

Query  463  WRLVKTGTPGNLGSFEDILF-ANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            W +++ G+PGNL  FE+I+F    E Q++P +V +       G  VGL Y D T
Sbjct  149  WTIIRQGSPGNLEEFEEIVFDTCGETQETPTVVCVQIVSDGAGWRVGLAYCDNT  202



>gb|KFY53035.1| hypothetical protein V496_07961 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY90484.1| hypothetical protein V498_05928 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=921

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 91/139 (65%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKSLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG S    + SV+M+  +F    R+ L  R    +E++E +G  +W++ K  +PGNL   
Sbjct  63   LGRSDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMHWKVGKQASPGNLQDI  121

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  122  EDEL--GGQIDAAPIMLAV  138



>gb|ESZ90350.1| DNA mismatch repair protein msh-2 [Sclerotinia borealis F-4157]
Length=935

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 88/138 (64%), Gaps = 7/138 (5%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ FFK LPS D   +R FDR D+YTAHG++A+FIA+T Y TT+ LR 
Sbjct  5    PELKVDDEL--GFIKFFKNLPSRDGETLRVFDRGDFYTAHGDDASFIARTVYKTTSVLRD  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-SNWRLVKTGTPGNLGSFE  510
            LGS    I SV+M+  +++   R+ L  R    +E++  SG +NW++ KT +PGNL   E
Sbjct  63   LGSSSTKIPSVTMTITVYKNFLREALY-RMGKRVEIFTTSGKNNWKVTKTASPGNLQDVE  121

Query  511  DILFANNEMQDSPVIVAL  564
            + L        +P+I+A+
Sbjct  122  EEL--GGSFDAAPIILAV  137



>gb|AAB59566.1| mutation causes premature stop [Homo sapiens]
Length=287

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|KFY40284.1| hypothetical protein V494_03584 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=921

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 91/139 (65%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKSLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG S    + SV+M+  +F    R+ L  R    +E++E +G  +W++ K  +PGNL   
Sbjct  63   LGRSDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMHWKVGKQASPGNLQDI  121

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  122  EDEL--GGQIDAAPIMLAV  138



>ref|XP_006682779.1| hypothetical protein BATDEDRAFT_21067 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76509.1| hypothetical protein BATDEDRAFT_21067 [Batrachochytrium dendrobatidis 
JAM81]
Length=923

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 93/160 (58%), Gaps = 9/160 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTL--PSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALR  330
            P++ LD      F  FF++L     T  +   +  DYY+ HG +A F+++  Y T T L+
Sbjct  8    PDMALDKSSETSFCRFFESLVQTQGTLRLFERNGGDYYSVHGIDAVFVSEHVYRTATVLK  67

Query  331  QLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY---EGSGSNWRLVKTGTPGNLG  501
            QLGSG   + S ++S+    +  ++LL E+  + +E++    G  ++W++ K  +PGNL 
Sbjct  68   QLGSG---LQSCTLSKLNAMSFLKELLTEK-QYRIEIWCPDSGKNNSWKISKQASPGNLQ  123

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            S ED+LF N ++  +PV++A+   ++ +  +VG+GY D T
Sbjct  124  SVEDMLFVNTDVGSAPVVLAVTVTVKGSDKIVGVGYTDAT  163



>dbj|BAG28295.1| mismatch repair protein [Mesocricetus auratus]
Length=782

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L+      F+ FF+ +P   +  VR FDR D+YTAHG +A   A+  + T   ++ LG
Sbjct  9    LQLEGAAEAAFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYLG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNKAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M DS  IV +  ++ +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSDSVGIVGVKMSMVDGQRHVGVGYVD  167



>gb|KEY67948.1| hypothetical protein S7711_02156 [Stachybotrys chartarum IBT 
7711]
Length=923

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELKLD +   GF+ FFK+LP+ D   +R FDR D+YTAHG +ATFIAKT Y TT+ +RQ
Sbjct  5    PELKLDDEG--GFIRFFKSLPAVDGDTIRIFDRSDWYTAHGQDATFIAKTVYKTTSVVRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG S    + SV+M+  +F    R+ LL +    +E+++      NW+ VK  +PGNL  
Sbjct  63   LGRSDHTGLPSVTMTMTVFRQFLREALL-KLGKRIEIWQSQSGRMNWKCVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    ++  +P+I+A+
Sbjct  122  VEDDL--GGQIDSAPMILAV  139



>gb|AAB59567.1| premature stop codon due to mutation [Homo sapiens]
Length=341

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|KFA72895.1| hypothetical protein S40288_02138 [Stachybotrys chartarum IBT 
40288]
Length=923

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELKLD +   GF+ FFK+LP+ D   +R FDR D+YTAHG +ATFIAKT Y TT+ +RQ
Sbjct  5    PELKLDDEG--GFIRFFKSLPAVDGDTIRIFDRSDWYTAHGQDATFIAKTVYKTTSVVRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG S    + SV+M+  +F    R+ LL +    +E+++      NW+ VK  +PGNL  
Sbjct  63   LGRSDHTGLPSVTMTMTVFRQFLREALL-KLGKRIEIWQSQSGRMNWKCVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    ++  +P+I+A+
Sbjct  122  VEDDL--GGQIDSAPMILAV  139



>gb|KFA48013.1| hypothetical protein S40293_02678 [Stachybotrys chartarum IBT 
40293]
Length=923

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELKLD +   GF+ FFK+LP+ D   +R FDR D+YTAHG +ATFIAKT Y TT+ +RQ
Sbjct  5    PELKLDDEG--GFIRFFKSLPAVDGDTIRIFDRSDWYTAHGQDATFIAKTVYKTTSVVRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG S    + SV+M+  +F    R+ LL +    +E+++      NW+ VK  +PGNL  
Sbjct  63   LGRSDHTGLPSVTMTMTVFRQFLREALL-KLGKRIEIWQSQSGRMNWKCVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    ++  +P+I+A+
Sbjct  122  VEDDL--GGQIDSAPMILAV  139



>gb|KFA66863.1| hypothetical protein S40285_02325 [Stachybotrys chlorohalonata 
IBT 40285]
Length=923

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELKLD +   GF+ FFK+LP+ D   +R FDR D+YTAHG +ATFIAKT Y TT+ +RQ
Sbjct  5    PELKLDDEG--GFIRFFKSLPAVDGDTIRIFDRSDWYTAHGQDATFIAKTVYKTTSVVRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG S    + SV+M+  +F    R+ LL +    +E+++      NW+ VK  +PGNL  
Sbjct  63   LGRSDHTGLPSVTMTMTVFRQFLREALL-KLGKRIEIWQSQSGRMNWKCVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    ++  +P+I+A+
Sbjct  122  VEDDL--GGQIDSAPMILAV  139



>gb|KFZ23680.1| hypothetical protein V502_01863 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=1968

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 89/139 (64%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKSLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG      + SV+M+  +F    R+ L  R    +E++E +G   W++ K  +PGNL   
Sbjct  63   LGRNDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMQWKIAKQASPGNLQDI  121

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  122  EDEL--GGQIDAAPIMLAV  138



>gb|EKG21122.1| hypothetical protein MPH_01541 [Macrophomina phaseolina MS6]
Length=933

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 83/140 (59%), Gaps = 12/140 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTL---PSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELK++ +   GF+ FF+ L   P DT  +         TAHG++A FIA+T Y TT+ L
Sbjct  5    PELKVEDEP--GFIRFFRNLATKPDDTVRIFDRGDFY--TAHGDDAVFIARTVYRTTSVL  60

Query  328  RQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-SNWRLVKTGTPGNLGS  504
            RQLG  PG + SV++S  +F    R+ L  R    +E++E +G SNW++ K  +PGNL  
Sbjct  61   RQLGREPG-LESVTLSITVFRNFLREALF-RLGKRIEIWESTGRSNWKVSKQASPGNLQD  118

Query  505  FEDILFANNEMQDSPVIVAL  564
             E+ L    ++  +P+I+A+
Sbjct  119  VEEDL--GGQLDSAPIILAV  136



>gb|KDN48308.1| LOW QUALITY PROTEIN: hypothetical protein RSAG8_02900, partial 
[Rhizoctonia solani AG-8 WAC10335]
Length=791

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 91/159 (57%), Gaps = 11/159 (7%)
 Frame = +1

Query  169  LDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLGSG  345
            +D     GF SF   LP          +R+DYY+AHG +ATF+A   YHT + ++QLGSG
Sbjct  12   IDNAVTSGFCSFIANLPPKPEDTIRLFERQDYYSAHGPDATFVATHVYHTLSVIKQLGSG  71

Query  346  PGAISSVSMSRNMFETIARDLLLERTDHTLELY--EG------SGSNWRLVKTGTPGNLG  501
              ++ SV++S  + +   R+ L  R    +E++  EG      SGS W L +  +PGNL 
Sbjct  72   KNSLPSVTLSSAVAKIFLREALTTR-QLRIEIWTPEGGKGKSASGSRWELSRKASPGNLQ  130

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVD  615
              ED+LF+N +++ +P+++A+    ++ G  VVG+ + D
Sbjct  131  DVEDLLFSNTDLESAPIVMAVRLGKKDAGSKVVGVAFAD  169



>gb|KFY21952.1| hypothetical protein V493_06965 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=1774

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 90/139 (65%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKSLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG      + SV+M+  +F    R+ L  R    +E++E +G  +W++ K  +PGNL   
Sbjct  63   LGRNDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMHWKVAKQASPGNLQDI  121

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  122  EDEL--GGQIDAAPIMLAV  138



>gb|KFY06630.1| hypothetical protein V492_07892 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=921

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 90/139 (65%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKSLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG      + SV+M+  +F    R+ L  R    +E++E +G  +W++ K  +PGNL   
Sbjct  63   LGRNDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMHWKVGKQASPGNLQDI  121

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  122  EDEL--GGQIDAAPIMLAV  138



>gb|KFB45519.1| AGAP010282-PA-like protein [Anopheles sinensis]
Length=903

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 89/161 (55%), Gaps = 12/161 (7%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTL---PSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            L LD  Q + F+ F+K+L   P+ T  +         + HG +A ++AK  + +T  ++ 
Sbjct  10   LNLDKPQQKAFIEFYKSLGEKPATTVRLFDRIDYY--SCHGEDAAYVAKLLFKSTNFVKI  67

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGS-----GSNWRLVKTGTPGNL  498
            + S    ++ VS+S+N FE + R+LLL R ++ +E+Y  S     G+ W +   G+PGNL
Sbjct  68   MESDGQQLAYVSLSKNNFEALIRELLLVR-NYRVEVYTKSSQKKLGNEWTVEFKGSPGNL  126

Query  499  GSFEDILF-ANNEMQDSPVIVALVPNIRENGCVVGLGYVDL  618
              FED+LF +NN+M     ++AL          +GLG++D+
Sbjct  127  AHFEDVLFNSNNDMISGSALIALQVRQESKHRTIGLGFIDV  167



>ref|XP_005324544.1| PREDICTED: DNA mismatch repair protein Msh2 [Ictidomys tridecemlineatus]
Length=934

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 91/160 (57%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+++P   T  VR FDR D+YTAHG +A   A+  + T   ++ LG
Sbjct  9    LQLESAAEVGFVRFFQSMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYLG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVD  167



>sp|Q5XXB5.1|MSH2_CHLAE RecName: Full=DNA mismatch repair protein Msh2; AltName: Full=MutS 
protein homolog 2 [Chlorocebus aethiops]
 gb|AAU85549.1| mismatch repair protein [Chlorocebus aethiops]
Length=933

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 92/162 (57%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+++P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQSMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDST  169



>ref|XP_009235603.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein Msh2-like 
[Pongo abelii]
 gb|AAB59568.1| Frameshift mutation results in premature stop [Homo sapiens]
Length=410

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_007811006.1| DNA mismatch repair protein MSH2 [Metarhizium acridum CQMa 102]
 gb|EFY89285.1| DNA mismatch repair protein MSH2 [Metarhizium acridum CQMa 102]
Length=922

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP---SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELKLD +   GF+ F+K+LP    DT  +         TAHG+NA+FIAKT Y TT+ L
Sbjct  5    PELKLDDEG--GFIRFYKSLPDVGEDTIRIFDRGDWY--TAHGDNASFIAKTVYKTTSVL  60

Query  328  RQLGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEG-SGS-NWRLVKTGTPGNL  498
            RQLG      + SV+M+  +F    R+ L  +    +E++E  SG  NW+ VK  +PGNL
Sbjct  61   RQLGRNDHTGLPSVTMTVTVFRQFLREALF-KLGKRIEIWESPSGRMNWKCVKQASPGNL  119

Query  499  GSFEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVD  615
               ED L    +++ +P+I+A+  + + +   +VG+ + D
Sbjct  120  QDIEDDL--GGQIESAPMIIAVKISAKASEARIVGVCFAD  157



>ref|XP_003473123.1| PREDICTED: DNA mismatch repair protein Msh2 [Cavia porcellus]
Length=934

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ LG
Sbjct  9    LQLESVAEAGFVRFFQAMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYLG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNKAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMAASIGVVGIKMSAVDGQRQVGVGYVD  167



>ref|XP_007968903.1| PREDICTED: DNA mismatch repair protein Msh2 [Chlorocebus sabaeus]
Length=933

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 92/162 (57%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+++P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQSMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDST  169



>ref|XP_008553059.1| PREDICTED: DNA mismatch repair protein Msh2 [Microplitis demolitor]
Length=933

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 90/158 (57%), Gaps = 10/158 (6%)
 Frame = +1

Query  169  LDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLGSG  345
            +D    Q F+ FFKTLP  +     F  R DYYT HG +A F++   + TT++ + +G+ 
Sbjct  10   MDQNGQQTFVRFFKTLPEKSSSTIRFFKRNDYYTCHGEDALFVSNEVFKTTSSCKMIGAD  69

Query  346  PGAISSVSMSRNMFETIARDLLLERTDHTLELYE--GSGSN--WRLVKTGTPGNLGSFED  513
            P  + SV +++  FE + +DLLL +  + +E+YE  G+G N  W +   G+PGNL  FE+
Sbjct  70   PNKLESVLVNKANFENLIKDLLLVKR-YRVEVYEDKGTGRNRCWEVEYKGSPGNLSQFEE  128

Query  514  ILFANNEMQDSPV----IVALVPNIRENGCVVGLGYVD  615
            ILF + + Q   +    I+A++  +     VVGL  +D
Sbjct  129  ILFDSGDSQADVIANGAIMAVIMGMEGKSKVVGLSCID  166



>gb|KEQ61140.1| DNA mismatch repair protein-like protein msh-2 [Aureobasidium 
melanogenum CBS 110374]
Length=918

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 8/138 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK++ +   GF+ FF+ L  +D   +R FDR DYYTAHG++ATFIA+  Y TT+ L+Q
Sbjct  5    PELKVEDEY--GFIKFFRNLSGTDDDTIRLFDRNDYYTAHGDDATFIAQNQYKTTSVLKQ  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-WRLVKTGTPGNLGSFE  510
            LG  PG + SV++S+ +F    R+ L  R    +E++E +G N + L K  +PGNL   E
Sbjct  63   LGRDPG-LPSVTLSQTVFRNFLREALF-RLGKRIEIWESTGKNKFTLAKQASPGNLQDVE  120

Query  511  DILFANNEMQDSPVIVAL  564
            D L +N  M+ +P+I+A+
Sbjct  121  DELGSN--MEAAPIILAV  136



>gb|AAB59569.1| mutation causes premature stop [Homo sapiens]
Length=428

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|ELR08238.1| hypothetical protein GMDG_03040 [Pseudogymnoascus destructans 
20631-21]
Length=1765

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 89/139 (64%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP+ D+  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  849  PELKVDDEQ--GFIKFFKSLPTEDSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  906

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG      + SV+M+  +F    R+ L  R    +E++E +G   W++ K  +PGNL   
Sbjct  907  LGRNDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMQWKVGKQASPGNLQDI  965

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  966  EDEL--GGQIDAAPIMLAV  982



>gb|EHH55555.1| hypothetical protein EGM_04786 [Macaca fascicularis]
Length=962

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 91/160 (57%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+++P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQSMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVD  167



>gb|EUC61162.1| DNA mismatch repair protein msh-2 [Rhizoctonia solani AG-3 Rhs1AP]
Length=955

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 91/159 (57%), Gaps = 11/159 (7%)
 Frame = +1

Query  169  LDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLGSG  345
            +D     GF SF   LP          +R+DYY+AHG +ATF+A   YHT + ++QLGSG
Sbjct  13   IDNAVTSGFCSFIAGLPPKPEDTIRLFERQDYYSAHGPDATFVATHVYHTLSVIKQLGSG  72

Query  346  PGAISSVSMSRNMFETIARDLLLERTDHTLELY--EG------SGSNWRLVKTGTPGNLG  501
              ++ SV++S  + +   R+ L  R    +E++  EG      SGS W L +  +PGNL 
Sbjct  73   KNSLPSVTLSSAVAKIFLREALTTR-QLRIEIWTPEGGKGKNASGSRWELSRKASPGNLQ  131

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVD  615
              ED+LF+N +++ +P+++A+    ++ G  VVG+ + D
Sbjct  132  DVEDLLFSNTDLESAPIVMAVRLGKKDAGSKVVGVAFAD  170



>gb|EHH22108.1| hypothetical protein EGK_05309 [Macaca mulatta]
Length=962

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 91/160 (57%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+++P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQSMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVD  167



>ref|XP_010362595.1| PREDICTED: DNA mismatch repair protein Msh2 [Rhinopithecus roxellana]
Length=934

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 91/160 (57%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+++P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQSMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVD  167



>ref|XP_004590831.1| PREDICTED: DNA mismatch repair protein Msh2 [Ochotona princeps]
Length=963

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 86/160 (54%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSDTrvvrffdrr-dyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P           R D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPATTVRLFDRGDFYTAHGEDAQLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             SG   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PSGAKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKAAKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  ++ +    VG+GYVD
Sbjct  128  LAQFEDILFGNNDMSASIGVVGVKMSVIDGQRQVGVGYVD  167



>ref|XP_011305124.1| PREDICTED: DNA mismatch repair protein Msh2 [Fopius arisanus]
Length=924

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 90/154 (58%), Gaps = 6/154 (4%)
 Frame = +1

Query  169  LDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLGSG  345
            +DA   Q F+  FK LP   +  +R F+R DYY+AHG +A F+A   + TT+A + +G  
Sbjct  14   MDAVAQQIFVRMFKGLPEKPSTTIRLFNRVDYYSAHGEDAIFVANEVFKTTSACKSIGVE  73

Query  346  PGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN----WRLVKTGTPGNLGSFED  513
            P  I  V +++  FE+I ++LLL +  + +E+Y  +G+N    W +   G+PGNL  FED
Sbjct  74   PNQIDGVILNKARFESIIKELLLVKR-YRVEVYINNGTNRNQDWTVEYKGSPGNLTQFED  132

Query  514  ILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            ILFAN+++     I+A+         +VG+  +D
Sbjct  133  ILFANSDIAVRASIMAVKLGTEGKSKIVGVSVID  166



>ref|XP_007428533.1| PREDICTED: DNA mismatch repair protein Msh2 [Python bivittatus]
Length=939

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 8/124 (6%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG +A   A   + T   +R LG+G   + SV++S+  FE+  R+LLL R  +  E+Y
Sbjct  52   TVHGEDAKLAAAEVFKTRAIIRMLGTGTQKLESVALSKMNFESFLRNLLLVRQ-YRAEVY  110

Query  445  EGSGSN-------WRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGL  603
            +    N       W L   G+PGNL  FED+LF+N++M  S  +VA+  +  +   V+G+
Sbjct  111  KNKAGNKSTKETEWYLAYKGSPGNLAQFEDVLFSNHDMSSSVGVVAIKLSSVDGQKVIGV  170

Query  604  GYVD  615
            GYVD
Sbjct  171  GYVD  174



>emb|CCD50782.1| similar to DNA mismatch repair protein msh-2 [Botrytis cinerea 
T4]
Length=923

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 86/138 (62%), Gaps = 7/138 (5%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ FF  LP  D   +R FDR D+YTAHG++ATFIA+T Y TT+ LR 
Sbjct  5    PELKVDDEL--GFIKFFTNLPQRDGETIRVFDRGDFYTAHGDDATFIARTVYKTTSVLRD  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-SNWRLVKTGTPGNLGSFE  510
            LGS    I SV+M+  +++   R+ L  R    +E++  SG +NW++ KT +PGNL   E
Sbjct  63   LGSNSTKIPSVTMTVTVYKNFLREALY-RMGKRVEIFTTSGRNNWKVTKTASPGNLQDVE  121

Query  511  DILFANNEMQDSPVIVAL  564
            + L        +P+I+A+
Sbjct  122  EEL--GGSFDAAPIILAV  137



>gb|EMR86681.1| putative dna mismatch repair protein [Botrytis cinerea BcDW1]
Length=923

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 86/138 (62%), Gaps = 7/138 (5%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ FF  LP  D   +R FDR D+YTAHG++ATFIA+T Y TT+ LR 
Sbjct  5    PELKVDDEL--GFIKFFTNLPQRDGETIRVFDRGDFYTAHGDDATFIARTVYKTTSVLRD  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-SNWRLVKTGTPGNLGSFE  510
            LGS    I SV+M+  +++   R+ L  R    +E++  SG +NW++ KT +PGNL   E
Sbjct  63   LGSNSTKIPSVTMTVTVYKNFLREALY-RMGKRVEIFTTSGRNNWKVTKTASPGNLQDVE  121

Query  511  DILFANNEMQDSPVIVAL  564
            + L        +P+I+A+
Sbjct  122  EEL--GGSFDAAPIILAV  137



>gb|EAX00215.1| mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), 
isoform CRA_c [Homo sapiens]
Length=491

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|KDB14691.1| DNA mismatch repair protein MSH2 [Ustilaginoidea virens]
Length=922

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 89/140 (64%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELKLD +   GF+ F+K+LP +    +R FDR D+YTAHG+NA FIAKT Y TT+ +RQ
Sbjct  5    PELKLDDEG--GFIRFYKSLPDAGDETIRIFDRGDWYTAHGDNAFFIAKTVYKTTSVIRQ  62

Query  334  LG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG +    + SV+M+  +F    R+ L  +    +E++E +G   NW+ VK  +PGNL  
Sbjct  63   LGRNDQSGLPSVTMTVTVFRQFLREALF-KLGKRIEIWESAGGRVNWKCVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    +++ +P+I+A+
Sbjct  122  VEDDL--GGQVESAPMIMAV  139



>gb|AAB59570.1| The base insertion results in premature stop [Homo sapiens]
Length=486

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|EZA46081.1| DNA mismatch repair protein Msh2-like protein [Microplitis demolitor]
Length=1468

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 90/158 (57%), Gaps = 10/158 (6%)
 Frame = +1

Query  169  LDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLGSG  345
            +D    Q F+ FFKTLP  +     F  R DYYT HG +A F++   + TT++ + +G+ 
Sbjct  10   MDQNGQQTFVRFFKTLPEKSSSTIRFFKRNDYYTCHGEDALFVSNEVFKTTSSCKMIGAD  69

Query  346  PGAISSVSMSRNMFETIARDLLLERTDHTLELYE--GSGSN--WRLVKTGTPGNLGSFED  513
            P  + SV +++  FE + +DLLL +  + +E+YE  G+G N  W +   G+PGNL  FE+
Sbjct  70   PNKLESVLVNKANFENLIKDLLLVKR-YRVEVYEDKGTGRNRCWEVEYKGSPGNLSQFEE  128

Query  514  ILFANNEMQDSPV----IVALVPNIRENGCVVGLGYVD  615
            ILF + + Q   +    I+A++  +     VVGL  +D
Sbjct  129  ILFDSGDSQADVIANGAIMAVIMGMEGKSKVVGLSCID  166



>emb|CEL63099.1| DNA mismatch repair protein msh-2 OS=Neurospora crassa (strain 
ATCC 24698 / 74-OR23-1A / CBS 708,71 / DSM 1257 / FGSC 987) 
GN=msh-2 PE=3 SV=1 [Rhizoctonia solani AG-1 IB]
Length=838

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 91/159 (57%), Gaps = 11/159 (7%)
 Frame = +1

Query  169  LDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLGSG  345
            LD+    GF SF  +LP          +R+DYY+AHG +ATF+A   YHT + ++QLG G
Sbjct  13   LDSAVTSGFCSFIASLPPKPEDTIRLFERQDYYSAHGPDATFVATHVYHTLSVIKQLGKG  72

Query  346  PGAISSVSMSRNMFETIARDLLLERTDHTLELY--EG------SGSNWRLVKTGTPGNLG  501
              A+ SV++S  + +   R+ L  R    +E++  EG      SG+ W L +  +PGNL 
Sbjct  73   KDALPSVTLSSTVAKIFLREALTTR-QLRIEIWTPEGSKGKSASGTRWELSRRASPGNLQ  131

Query  502  SFEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVD  615
              ED+LF+N +++ +P+++++    ++ G   VG+ + D
Sbjct  132  DVEDLLFSNTDLESAPIVMSVRLGKKDAGTKTVGVAFAD  170



>gb|AAB59571.1| Insertion mutation results in premature stop [Homo sapiens]
Length=534

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_007820842.2| DNA mismatch repair protein MSH2 [Metarhizium robertsii ARSEF 
23]
 gb|EXV06304.1| mismatch repair ATPase (MutS family) [Metarhizium robertsii]
 gb|EFY99626.2| DNA mismatch repair protein MSH2 [Metarhizium robertsii ARSEF 
23]
Length=922

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 13/142 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP---SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELKLD +   GF+ F+K+LP    DT  +         TAHG+NA+FIAKT Y TT+ L
Sbjct  5    PELKLDDEG--GFIRFYKSLPDVGEDTIRIFDRGDWY--TAHGDNASFIAKTVYKTTSVL  60

Query  328  RQLGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEG-SGS-NWRLVKTGTPGNL  498
            RQLG      + SV+M+  +F    R+ L  +    +E++E  SG  NW+ VK  +PGNL
Sbjct  61   RQLGRNDHTGLPSVTMTVTVFRQFLREALF-KLGKRIEIWESPSGRMNWKCVKQASPGNL  119

Query  499  GSFEDILFANNEMQDSPVIVAL  564
               ED L    +++ +P+I+A+
Sbjct  120  QDIEDDL--GGQIESAPMIIAV  139



>ref|XP_319476.4| AGAP010282-PA [Anopheles gambiae str. PEST]
 gb|EAA14192.4| AGAP010282-PA [Anopheles gambiae str. PEST]
Length=881

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 88/161 (55%), Gaps = 12/161 (7%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTL---PSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            L LD  Q + F+ F+K+L   P+ T  +         + HG +A F+AKT + ++ A++ 
Sbjct  10   LNLDKAQQRTFIEFYKSLGEKPATTVRIFDRTDYY--SCHGVDAAFVAKTLFKSSNAIKI  67

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-----SNWRLVKTGTPGNL  498
            +      +  VS+S+N FE + RDLLL R ++ +E+Y         ++W +   G+PGNL
Sbjct  68   MEVDNQQLPYVSLSKNNFEGLIRDLLLVR-NYRIEVYSKESKRKHENDWSIQYKGSPGNL  126

Query  499  GSFEDILF-ANNEMQDSPVIVALVPNIRENGCVVGLGYVDL  618
              FED+LF  NNEM     ++AL         ++GLG++++
Sbjct  127  AHFEDVLFNNNNEMVIGSALIALHIRHESKQRMIGLGFIEV  167



>pdb|2O8E|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, WITH 
ADP BOUND TO Msh2 Only
Length=934

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDAYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|AAY15096.1| unknown [Homo sapiens]
Length=586

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVRQ-YRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_008529130.1| PREDICTED: DNA mismatch repair protein Msh2 [Equus przewalskii]
Length=934

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEAGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGIKMSTVDGQRQVGVGYVD  167



>gb|KID96642.1| DNA mismatch repair protein MSH2, partial [Metarhizium majus 
ARSEF 297]
Length=922

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 13/142 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP---SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELKLD +   GF+ F+K+LP    DT  +         TAHG+NA+FIAKT Y TT+ L
Sbjct  5    PELKLDDEG--GFIRFYKSLPDVGEDTIRIFDRGDWY--TAHGDNASFIAKTVYKTTSVL  60

Query  328  RQLGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEG-SGS-NWRLVKTGTPGNL  498
            RQLG      + SV+M+  +F    R+ L  +    +E++E  SG  NW+ VK  +PGNL
Sbjct  61   RQLGRNDHTGLPSVTMTVTVFRQFLREALF-KLGKRIEIWESPSGRMNWKCVKQASPGNL  119

Query  499  GSFEDILFANNEMQDSPVIVAL  564
               ED L    +++ +P+I+A+
Sbjct  120  QDIEDDL--GGQIESAPMIIAV  139



>ref|XP_005077361.1| PREDICTED: DNA mismatch repair protein Msh2 [Mesocricetus auratus]
Length=934

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L+      F+ FF+ +P   +  VR FDR D+YTAHG +A   A+  + T   ++ LG
Sbjct  9    LQLEGAAEAAFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYLG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNKAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M DS   V +  ++ +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSDSVGTVGVKMSMVDGQRHVGVGYVD  167



>ref|XP_008252950.1| PREDICTED: DNA mismatch repair protein Msh2 [Oryctolagus cuniculus]
Length=870

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGSKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSSSIGVVGVKMSTVDGQRQVGVGYVD  167



>gb|KID92464.1| DNA mismatch repair protein MSH2 [Metarhizium guizhouense ARSEF 
977]
Length=922

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 13/142 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP---SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELKLD +   GF+ F+K+LP    DT  +         TAHG+NA+FIAKT Y TT+ L
Sbjct  5    PELKLDDEG--GFIRFYKSLPDVGEDTIRIFDRGDWY--TAHGDNASFIAKTVYKTTSVL  60

Query  328  RQLGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEG-SGS-NWRLVKTGTPGNL  498
            RQLG      + SV+M+  +F    R+ L  +    +E++E  SG  NW+ VK  +PGNL
Sbjct  61   RQLGRNDHTGLPSVTMTVTVFRQFLREALF-KLGKRIEIWESPSGRMNWKCVKQASPGNL  119

Query  499  GSFEDILFANNEMQDSPVIVAL  564
               ED L    +++ +P+I+A+
Sbjct  120  QDIEDDL--GGQIESAPMIIAV  139



>gb|KID78510.1| DNA mismatch repair protein MSH2, partial [Metarhizium brunneum 
ARSEF 3297]
Length=922

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 13/142 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP---SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELKLD +   GF+ F+K+LP    DT  +         TAHG+NA+FIAKT Y TT+ L
Sbjct  5    PELKLDDEG--GFIRFYKSLPDVGEDTIRIFDRGDWY--TAHGDNASFIAKTVYKTTSVL  60

Query  328  RQLGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEG-SGS-NWRLVKTGTPGNL  498
            RQLG      + SV+M+  +F    R+ L  +    +E++E  SG  NW+ VK  +PGNL
Sbjct  61   RQLGRNDHTGLPSVTMTVTVFRQFLREALF-KLGKRIEIWESPSGRMNWKCVKQASPGNL  119

Query  499  GSFEDILFANNEMQDSPVIVAL  564
               ED L    +++ +P+I+A+
Sbjct  120  QDIEDDL--GGQIESAPMIIAV  139



>gb|KFY74848.1| hypothetical protein V499_05146 [Pseudogymnoascus pannorum VKM 
F-103]
Length=921

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 89/139 (64%), Gaps = 8/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +Q  GF+ FFK+LP++ +  +R F+R DYYTAHG +A+FIA+T Y TT+ LRQ
Sbjct  5    PELKVDDEQ--GFIKFFKSLPTEGSETIRIFNRGDYYTAHGEDASFIARTVYKTTSVLRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-NWRLVKTGTPGNLGSF  507
            LG      + SV+M+  +F    R+ L  R    +E++E +G   W++ K  +PGNL   
Sbjct  63   LGRNDHTGLPSVTMTVTVFRNFLREALF-RLGKRIEVWESTGRMQWKVGKQASPGNLQDI  121

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    ++  +P+++A+
Sbjct  122  EDEL--GGQIDAAPIMLAV  138



>gb|KFG82318.1| DNA mismatch repair protein MSH2 [Metarhizium anisopliae]
 gb|KID62441.1| DNA mismatch repair protein MSH2, partial [Metarhizium anisopliae 
ARSEF 549]
Length=922

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 13/142 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP---SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELKLD +   GF+ F+K+LP    DT  +         TAHG+NA+FIAKT Y TT+ L
Sbjct  5    PELKLDDEG--GFIRFYKSLPDVGEDTIRIFDRGDWY--TAHGDNASFIAKTVYKTTSVL  60

Query  328  RQLGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEG-SGS-NWRLVKTGTPGNL  498
            RQLG      + SV+M+  +F    R+ L  +    +E++E  SG  NW+ VK  +PGNL
Sbjct  61   RQLGRNDHTGLPSVTMTITVFRQFLREALF-KLGKRIEIWESPSGRMNWKCVKQASPGNL  119

Query  499  GSFEDILFANNEMQDSPVIVAL  564
               ED L    +++ +P+I+A+
Sbjct  120  QDIEDDL--GGQIESAPMIIAV  139



>dbj|BAD97004.1| mutS homolog 2 variant [Homo sapiens]
Length=878

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>dbj|BAD96580.1| mutS homolog 2 variant [Homo sapiens]
Length=878

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|KEQ95008.1| hypothetical protein AUEXF2481DRAFT_40270 [Aureobasidium subglaciale 
EXF-2481]
Length=918

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ FFK L  +D   +R FDR DYYTAHG++A FIA+  Y TT+ ++Q
Sbjct  5    PELKVDDEY--GFIKFFKNLSGTDDDTIRLFDRNDYYTAHGDDAKFIAQNQYKTTSVIKQ  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-WRLVKTGTPGNLGSFE  510
            LG  PG + SV++S+ +F    R+ L  R    +E++E +G N + L K  +PGNL   E
Sbjct  63   LGRDPG-LPSVTLSQTVFRNFLREALF-RLGKRIEIWESAGKNKFTLAKQASPGNLQDVE  120

Query  511  DILFANNEMQDSPVIVAL  564
            D L   + M+ +P+I+A+
Sbjct  121  DEL--GSSMEAAPIILAV  136



>emb|CAH93337.1| hypothetical protein [Pongo abelii]
Length=886

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|AAB59572.1| The deletion results in premature stop [Homo sapiens]
Length=810

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_009235602.1| PREDICTED: DNA mismatch repair protein Msh2 [Pongo abelii]
Length=852

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|AAA82080.1| similar to S. cerevisiae Msh2p (Swiss-Prot accession number P25847) 
and bacterial MutS proteins (Swiss-Prot accession numbers 
P23909, P10339, and P27345) [Homo sapiens]
Length=887

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_003262405.1| PREDICTED: DNA mismatch repair protein Msh2 isoform 1 [Nomascus 
leucogenys]
Length=934

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_005264389.1| PREDICTED: DNA mismatch repair protein Msh2 isoform X1 [Homo 
sapiens]
Length=921

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_003839541.1| similar to DNA mismatch repair protein msh-2 [Leptosphaeria maculans 
JN3]
 emb|CBX96062.1| similar to DNA mismatch repair protein msh-2 [Leptosphaeria maculans 
JN3]
Length=922

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 85/139 (61%), Gaps = 9/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PE++   +   GF  FF+ LP  DT  +R FDR DYY+AHG +A FIA T Y TT  +R+
Sbjct  5    PEMR--EEDESGFCKFFRNLPEKDTDTIRIFDRGDYYSAHGGDAVFIANTVYKTTAVIRR  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGSF  507
            LG  PG + SV+M+  +F +  RD L  R    +E+++ S    +W +VK  +PGNL   
Sbjct  63   LGREPG-LESVTMTVTVFRSFLRDALF-RLSKRIEIWQSSAKRMDWIMVKQASPGNLQDL  120

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    +++++P+I+A+
Sbjct  121  EDDL--GGQIENAPIILAV  137



>ref|XP_006012929.1| PREDICTED: DNA mismatch repair protein Msh2-like, partial [Latimeria 
chalumnae]
Length=502

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 89/163 (55%), Gaps = 11/163 (7%)
 Frame = +1

Query  160  ELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            +L +D     GF++F+ ++    DT V  F     Y T HG +A F AK  + T   ++ 
Sbjct  8    KLAVDNATENGFINFYFSMAEKPDTTVRVFDRNEFY-TVHGKDAIFAAKEVFKTNGVIKY  66

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEG-SGS------NWRLVKTGTPG  492
            LGSG   +  V +S+  FE++ RDLLL R  + +E+Y+  +GS      +W L    +PG
Sbjct  67   LGSGNRKLEGVVLSKMNFESVVRDLLLVRQ-YRVEVYKNKTGSKTSKDNDWFLAYKASPG  125

Query  493  NLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            NL  FE+ILF NN+M  +  +V +     +   +VG+GYVD T
Sbjct  126  NLSQFEEILFGNNDMSTAIGVVGIKLGTVDGQRLVGVGYVDST  168



>ref|NP_000242.1| DNA mismatch repair protein Msh2 isoform 1 [Homo sapiens]
 sp|P43246.1|MSH2_HUMAN RecName: Full=DNA mismatch repair protein Msh2; Short=hMSH2; 
AltName: Full=MutS protein homolog 2 [Homo sapiens]
 pdb|2O8B|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR
 pdb|2O8C|A Chain A, Human Mutsalpha (msh2/msh6) Bound To Adp And An O6-methyl-guanine 
T Mispair
 pdb|2O8D|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G DU MISPAIR
 pdb|2O8F|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO DNA WITH A SINGLE 
BASE T INSERT
 pdb|3THW|A Chain A, Human Mutsbeta Complexed With An Idl Of 4 Bases (loop4) 
And Adp
 pdb|3THX|A Chain A, Human Mutsbeta Complexed With An Idl Of 3 Bases (loop3) 
And Adp
 pdb|3THY|A Chain A, Human Mutsbeta Complexed With An Idl Of 2 Bases (loop2) 
And Adp
 pdb|3THZ|A Chain A, Human Mutsbeta Complexed With An Idl Of 6 Bases (loop6) 
And Adp
 gb|AAA61870.1| homolog of bacterial MutS proteins [Swiss-Prot accession numbers 
P23909, P10339, and P27345]; germline mutations are responsible 
for hereditary nonpolyposis colon cancer (HNPCC) [Homo 
sapiens]
 gb|AAA18643.1| homolog of S. cerevisiae Msh2p [Swiss-Prot accession number P25847] 
and bacterial MutS proteins [Swiss-Prot accession numbers 
P23909, P10339, and P27345] [Homo sapiens]
 gb|AAB59564.1| DNA mismatch repair protein [Homo sapiens]
 gb|AAB59565.1| DNA mismatch repair protein [Homo sapiens]
 gb|AAA76858.1| DNA mismatch repair protein [Homo sapiens]
 gb|AAH21566.1| MutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [Homo 
sapiens]
 gb|AAS99351.1| mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [Homo 
sapiens]
 gb|EAX00214.1| mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), 
isoform CRA_b [Homo sapiens]
 gb|ABM83484.1| mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [synthetic 
construct]
 gb|ABM86698.1| mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [synthetic 
construct]
 dbj|BAH24113.1| mutS homolog 2, colon cancer, nonpolyposis type 1 [synthetic 
construct]
 gb|AIC49227.1| MSH2, partial [synthetic construct]
Length=934

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_004029250.1| PREDICTED: DNA mismatch repair protein Msh2 [Gorilla gorilla 
gorilla]
Length=934

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_003822726.1| PREDICTED: DNA mismatch repair protein Msh2 [Pan paniscus]
Length=934

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>gb|EAX00213.1| mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), 
isoform CRA_a [Homo sapiens]
Length=924

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAYKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSAVDGQRQVGVGYVD  167



>ref|XP_008584424.1| PREDICTED: DNA mismatch repair protein Msh2 [Galeopterus variegatus]
Length=934

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 90/161 (56%), Gaps = 12/161 (7%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L+     GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLEGAAEAGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVVKYMG  68

Query  340  SGPGA--ISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPG  492
              PGA  + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PG
Sbjct  69   P-PGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPG  126

Query  493  NLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            NL  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  127  NLSQFEDILFGNNDMSASIGVVGIKMSTVDGQRQVGVGYVD  167



>gb|ETE61002.1| DNA mismatch repair protein Msh2, partial [Ophiophagus hannah]
Length=939

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG +A   A   + T   +R LGSG   + SV++S+  FE   R+LLL R  +  E+Y
Sbjct  52   TVHGEDAKLAATEVFKTRAIIRILGSGAQKLESVALSKMNFEYFLRNLLLIR-QYRAEVY  110

Query  445  EGSGSN-------WRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGL  603
            +    N       W L   G+PGNL  FED LF+N++M  S  +VA+  +  +   VVG+
Sbjct  111  KNKAGNKSTKETEWYLAYKGSPGNLAQFEDTLFSNHDMSSSAGVVAIKLSSVDGQKVVGV  170

Query  604  GYVD  615
            GYVD
Sbjct  171  GYVD  174



>ref|XP_003788028.1| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein Msh2 
[Otolemur garnettii]
Length=905

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKNLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKISTVDGQRQVGVGYVD  167



>ref|XP_003051522.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU45809.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=926

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 82/140 (59%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPSDTrvvrffdrrdy-yTAHGNNATFIAKTYYHTTTALRQ  333
            PELKLD +   GF+ FFK+LPS+         R   YT+HG +A FIAKT Y TT+ +RQ
Sbjct  5    PELKLDDEG--GFIRFFKSLPSENDDTIRIFDRGDWYTSHGEDAMFIAKTVYKTTSVVRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG      + SV+M+  +F    R+ LL +    +E+++ +    NW+ VK  +PGNL  
Sbjct  63   LGRNDHTGLPSVTMTMTVFRQFLREALL-KLGKRIEIWQSASGRMNWKCVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             ED L    +++ +P+I+A+
Sbjct  122  VEDDL--GGQIESAPMILAV  139



>emb|CCE29857.1| probable DNA mismatch repair protein MSH2 [Claviceps purpurea 
20.1]
Length=924

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 82/142 (58%), Gaps = 13/142 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS---DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELKLD +   GF+ FFK+LP+   DT  +         TAHG +A FIAKT Y TT+ +
Sbjct  5    PELKLDDEG--GFIRFFKSLPAVGEDTVRIFDRGDWY--TAHGEDAFFIAKTVYKTTSVV  60

Query  328  RQLGSGPGA-ISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNL  498
            RQLG    + + SV+M+  +F    R+ LL +    +E++E      NW+ VK  +PGNL
Sbjct  61   RQLGRNDASGLPSVTMTMTVFRQFLREALL-KLGKRVEIWESQSGRMNWKCVKKASPGNL  119

Query  499  GSFEDILFANNEMQDSPVIVAL  564
               ED L    +++ +P+I+A+
Sbjct  120  QDVEDDL--GGQIESAPMIMAV  139



>ref|XP_004792790.1| PREDICTED: DNA mismatch repair protein Msh2 [Mustela putorius 
furo]
Length=934

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   ++ +G
Sbjct  9    LQLESASEVGFVRFFQAMPEKPTTTVRLFDRGDFYTAHHEDALLAAREVFKTQGVIKYIG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  RDLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGTKTLESVVLSKMNFESFVRDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGIKMSTVDGQRQVGVGYVD  167



>ref|XP_007913266.1| putative dna mismatch repair protein msh-2 protein [Togninia 
minima UCRPA7]
 gb|EOO01996.1| putative dna mismatch repair protein msh-2 protein [Togninia 
minima UCRPA7]
Length=901

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 87/140 (62%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ FFK+LP+ D   +R FDR D+YTAHG +A FIA+T Y TT+ +RQ
Sbjct  5    PELKVDDEH--GFIRFFKSLPALDDDTIRIFDRGDWYTAHGEDANFIARTVYKTTSVVRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG      + SV+M+  +F    R+ L  +    +E+Y  SG   NW++VK  +PGNL  
Sbjct  63   LGRNDHTGLPSVTMTITVFRQFLREALY-KLGKRVEIYASSGGRMNWKIVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             E+ L    + + +P+I+A+
Sbjct  122  VEEDL--GGQFESAPMILAV  139



>ref|XP_004752924.1| PREDICTED: DNA mismatch repair protein Msh2 [Mustela putorius 
furo]
Length=934

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   ++ +G
Sbjct  9    LQLESASEVGFVRFFQAMPEKPTTTVRLFDRGDFYTAHHEDALLAAREVFKTQGVIKYIG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  RDLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGTKTLESVVLSKMNFESFVRDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGIKMSTVDGQRQVGVGYVD  167



>ref|XP_006986547.1| PREDICTED: DNA mismatch repair protein Msh2 [Peromyscus maniculatus 
bairdii]
Length=933

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 91/160 (57%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L+     GF+ FF+ +P   +  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLEGPAEAGFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-------SNWRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+          ++W L    +PGN
Sbjct  69   PAGAKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNKAGSKATKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  ++ +    VG+GYVD
Sbjct  128  LAQFEDILFGNNDMSASVGVVGIKMSMVDGQRQVGVGYVD  167



>ref|XP_008183903.1| PREDICTED: DNA mismatch repair protein Msh2 [Acyrthosiphon pisum]
Length=879

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 69/119 (58%), Gaps = 4/119 (3%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG +ATF AK +Y T  +++ +GS    + S+  ++  FE   + LLL    + +E++
Sbjct  32   TVHGQDATFAAKDFYKTNHSIKIIGSDDDTLESLIFNKANFEAYIKQLLL-VNHYRVEIF  90

Query  445  EGSGSNWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALV--PNIRENGCVVGLGYVD  615
               G  W L   G+PGNL  FED+LF N E  ++ +++AL   P+ R N  ++GLG VD
Sbjct  91   VNKGGKWALDYKGSPGNLSQFEDLLFGNVEQIEANIVIALKLSPDFRNNK-IIGLGAVD  148



>gb|EFZ12092.1| hypothetical protein SINV_12798 [Solenopsis invicta]
Length=895

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG++A F A+  + TT+  + +G+ P     V ++++ FET  RDLLL +  + +E+Y
Sbjct  17   TVHGSDALFAAQEIFKTTSVCKMIGAEPHKTEGVILNKSHFETFVRDLLLVKQ-YRVEVY  75

Query  445  EGSGS----NWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYV  612
               GS    NW L   G+PGNL  FEDILF NN++     ++A+         VVGL  V
Sbjct  76   VNQGSSKNQNWILEYKGSPGNLSHFEDILFGNNDVAVGVSVIAVKLGTEGKSRVVGLSCV  135

Query  613  DLT  621
            D+ 
Sbjct  136  DVV  138



>ref|XP_004989716.1| MSH2-Ex5 isoform [Salpingoeca rosetta]
 gb|EGD78393.1| MSH2-Ex5 isoform [Salpingoeca rosetta]
Length=904

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 86/151 (57%), Gaps = 8/151 (5%)
 Frame = +1

Query  181  QAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLGSGPGAI  357
            Q QGF  FF++LP        F DR DYYT HG++A F+AKT + T   ++  G  P  +
Sbjct  8    QKQGFCRFFQSLPEKPATTIRFFDRNDYYTLHGDDALFMAKTVFKTMGVVKHWG--PQKL  65

Query  358  SSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN---WRLVKTGTPGNLGSFEDILFAN  528
             SV+MS  +FE   +DLLL + ++ +++Y   G+    W LVK  +PGN   FEDIL+A 
Sbjct  66   PSVNMSHMVFENTVKDLLLIK-NYRVQVYSTKGNKSGKWELVKKASPGNTQMFEDILYAG  124

Query  529  NEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
              +  S +++A+         VVGL + D+T
Sbjct  125  G-VNSSSIVMAVKLATEGQERVVGLAFCDVT  154



>ref|XP_005895687.1| PREDICTED: DNA mismatch repair protein Msh2 [Bos mutus]
 ref|XP_010836950.1| PREDICTED: DNA mismatch repair protein Msh2 [Bison bison bison]
Length=934

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 90/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+LD+    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   ++ +G
Sbjct  9    LQLDSAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHREDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDST  169



>ref|NP_001029756.1| DNA mismatch repair protein Msh2 [Bos taurus]
 sp|Q3MHE4.1|MSH2_BOVIN RecName: Full=DNA mismatch repair protein Msh2; AltName: Full=MutS 
protein homolog 2 [Bos taurus]
 gb|AAI05269.1| MutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) [Bos 
taurus]
 tpg|DAA24710.1| TPA: DNA mismatch repair protein Msh2 [Bos taurus]
Length=934

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 90/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+LD+    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   ++ +G
Sbjct  9    LQLDSAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHREDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDST  169



>ref|XP_006273985.1| PREDICTED: DNA mismatch repair protein Msh2 [Alligator mississippiensis]
Length=937

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 72/128 (56%), Gaps = 10/128 (8%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPG--AISSVSMSRNMFETIARDLLLERTDHTLE  438
            TAHG +A   A+  + T   +R L   PG   + SV +S+  FE+  RDLLL    + +E
Sbjct  47   TAHGTDAQLAARRLFRTRAVIRHLPGAPGNQKLESVVLSKMNFESFVRDLLL-VCHYRVE  105

Query  439  LYE---GSGS----NWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVV  597
            +Y+   GS S    +W L   G+PGNL  FE+ILF NN+M  +  +V +  +  E   ++
Sbjct  106  VYKNRAGSKSTKENDWYLAYKGSPGNLAQFEEILFGNNDMSTAIGVVGVKLSAAEGQRII  165

Query  598  GLGYVDLT  621
            G+GYVD T
Sbjct  166  GVGYVDTT  173



>gb|AAA75027.1| MutS homolog 2 [Mus musculus]
Length=935

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 90/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L+     GF+ FF+ +P   +  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLEGAAEAGFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGSKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNKAGNKASKENEWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  ++ +   + +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASVGVMGIKMAVVDGQRHVGVGYVDST  169



>ref|XP_001248166.1| hypothetical protein CIMG_01937 [Coccidioides immitis RS]
 gb|EAS36583.3| DNA mismatch repair protein msh-2 [Coccidioides immitis RS]
Length=941

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 95/162 (59%), Gaps = 12/162 (7%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALR  330
            PELK+D +   GF+ FF++LPS  D+  VR FDR D+YTAHG +A +IA+T Y TT+ LR
Sbjct  5    PELKVDDEV--GFIRFFRSLPSKDDSTTVRVFDRGDWYTAHGTDAEYIARTVYKTTSVLR  62

Query  331  QLG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN----WRLVKTGTPGN  495
             LG S    + SV+M+  +F    R+ L  R    +E++   G      W+LVK  +PGN
Sbjct  63   TLGRSDTSGLPSVTMTVTVFRNFLREALF-RLGKRIEIWSSQGGMGKGVWKLVKQASPGN  121

Query  496  LGSFEDILFANNEMQD-SPVIVALVPNIRENGCV-VGLGYVD  615
            L   ED L +   M D +P+I+A+  + R +    VG+ + D
Sbjct  122  LQDVEDELGSGGGMMDTAPIILAVKISARASETRHVGVCFAD  163



>gb|AAH50897.1| MutS homolog 2 (E. coli) [Mus musculus]
Length=935

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 90/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L+     GF+ FF+ +P   +  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLEGAAEAGFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGSKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNKAGNKASKENEWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  ++ +   + +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASVGVMGIKMAVVDGQRHVGVGYVDST  169



>ref|NP_032654.1| DNA mismatch repair protein Msh2 [Mus musculus]
 sp|P43247.1|MSH2_MOUSE RecName: Full=DNA mismatch repair protein Msh2; AltName: Full=MutS 
protein homolog 2 [Mus musculus]
 emb|CAA57049.1| MSH2 [Mus musculus]
 gb|AAH47117.1| MutS homolog 2 (E. coli) [Mus musculus]
 dbj|BAE34223.1| unnamed protein product [Mus musculus]
 gb|EDL38635.1| mutS homolog 2 (E. coli) [Mus musculus]
Length=935

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 90/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L+     GF+ FF+ +P   +  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLEGAAEAGFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGSKTLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNKAGNKASKENEWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  ++ +   + +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASVGVMGIKMAVVDGQRHVGVGYVDST  169



>gb|KHO01041.1| DNA mismatch repair protein MSH2 [Metarhizium album ARSEF 1941]
Length=923

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 89/160 (56%), Gaps = 14/160 (9%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP---SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELKLD +   GF+ F+K+LP    DT  +         TAHG+NA+FIA+T Y TT+ L
Sbjct  5    PELKLDDEG--GFIRFYKSLPDVGEDTIRIFDRGDWY--TAHGDNASFIARTVYKTTSVL  60

Query  328  RQLGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNL  498
            RQLG      + SV+M+  +F    R+ L  +    +E++E      NW+ VK  +PGNL
Sbjct  61   RQLGRNDHTGLPSVTMTITVFRQFLREALF-KLGRRIEIWESPNGRMNWKCVKQASPGNL  119

Query  499  GSFEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVD  615
               ED L    +++ +P+I+A+  + R +    VG+ + D
Sbjct  120  QDVEDDL--GGQIESAPMIMAVKISARASEARSVGVCFAD  157



>emb|CDP30063.1| Putative DNA mismatch repair protein msh-2 [Podospora anserina 
S mat+]
Length=919

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 93/158 (59%), Gaps = 10/158 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ ++K+LP  D  V+R FDR D+YTAHG +A FIA+T Y TT+ +RQ
Sbjct  5    PELKVDDEH--GFIRYYKSLPKVDEDVIRIFDRGDWYTAHGEDANFIARTVYKTTSVVRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG      + SV+M+  +F    R+ L  +    +E+Y       NW++VK  +PGNL  
Sbjct  63   LGKNDHTGLPSVTMTVTVFRQFLREALY-KLGKRIEIYASPNGRMNWKIVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVALVPNIR-ENGCVVGLGYVD  615
             ED L    + + +PVI+A+   ++   G  VG+ + D
Sbjct  122  VEDEL--GGQFEGAPVILAVKITVKASEGRTVGVCFAD  157



>ref|XP_006048104.1| PREDICTED: DNA mismatch repair protein Msh2 [Bubalus bubalis]
Length=934

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 90/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+LD+    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   ++ +G
Sbjct  9    LQLDSAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHREDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PTGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDST  169



>ref|XP_004479774.1| PREDICTED: DNA mismatch repair protein Msh2 [Dasypus novemcinctus]
Length=913

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ LG
Sbjct  9    LQLESVAEFGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKFLG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNKAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  ++ +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSSSIGVLGIKMSTTDGQRQVGVGYVD  167



>ref|XP_006638841.1| PREDICTED: DNA mismatch repair protein Msh2-like [Lepisosteus 
oculatus]
Length=932

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 85/161 (53%), Gaps = 9/161 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSDTrvvrff-drrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L +D+    GF+ F+ ++P          DR +YYT HG +A F AK  + T   ++ LG
Sbjct  9    LSMDSAAENGFVHFYYSMPEKPDTTVRVFDRNEYYTVHGKDALFAAKEVFKTNGVIKNLG  68

Query  340  SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS-------NWRLVKTGTPGNL  498
            SG   + SV +S+  FE+  RDLLL R  + +E+Y    S       +W+L    +PGNL
Sbjct  69   SGSRKLESVVLSKMNFESFMRDLLLVR-QYRVEVYRNKASSKSGKDHDWQLACKASPGNL  127

Query  499  GSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
              FE+ILF ++  + +  +V +     +    VG+GYVD T
Sbjct  128  TQFEEILFGSSSPEGAAGVVGIRLGSGDGQRTVGVGYVDST  168



>ref|XP_005523323.1| PREDICTED: DNA mismatch repair protein Msh2 [Pseudopodoces humilis]
Length=936

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 10/128 (8%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPG--AISSVSMSRNMFETIARDLLLERTDHTLE  438
            T HG +A   A+  + T   +RQL   PG   + SV +S+  FE+  RDLLL R  + +E
Sbjct  46   TVHGADARLAARDLFRTRAVIRQLAGAPGTQKLESVVLSKMNFESFVRDLLLVR-HYRVE  104

Query  439  LYE---GSGS----NWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVV  597
            +Y+   GS S    +W L   G+PGNL  FE++LFANN+M  +  +V +  +  +   VV
Sbjct  105  VYKNKAGSKSVKENDWYLAYKGSPGNLSQFEEVLFANNDMSTAIGVVGVKLSAADGQRVV  164

Query  598  GLGYVDLT  621
            G+G VD T
Sbjct  165  GVGCVDTT  172



>ref|XP_003654300.1| hypothetical protein THITE_2117183 [Thielavia terrestris NRRL 
8126]
 gb|AEO67964.1| hypothetical protein THITE_2117183 [Thielavia terrestris NRRL 
8126]
Length=925

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 94/158 (59%), Gaps = 10/158 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ FFK+LP  D  V+R FDR D+YTAHG+NA FIA+T Y TT+ +RQ
Sbjct  5    PELKVDDEH--GFIRFFKSLPRVDEDVIRIFDRGDWYTAHGDNANFIARTVYKTTSVVRQ  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG      + SV+M+  +F    R+ L  +    +E+Y       NW++VK  +PGNL  
Sbjct  63   LGRNDHTGLPSVTMTVTVFRQFLREALY-KLGKRVEIYASPNGRMNWKIVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVALVPNIRENGC-VVGLGYVD  615
             ED L +  E   +PVI+A+  + + +    VG+ + D
Sbjct  122  VEDDLGSLAEA--APVILAVKISAKASEARAVGVCFAD  157



>ref|XP_004313192.1| PREDICTED: DNA mismatch repair protein Msh2-like, partial [Tursiops 
truncatus]
Length=366

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHREDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG-------SNWRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+          ++W L    +PGN
Sbjct  69   PAGAKTVESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGSKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LAQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVD  167



>ref|XP_011252842.1| PREDICTED: DNA mismatch repair protein Msh2 isoform X2 [Camponotus 
floridanus]
Length=918

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG++A F A+  + TT+  + +G+ P     V +++  FET  RDLLL +  + +E+Y
Sbjct  38   TLHGSDALFAAQEVFKTTSVCKMIGAEPHKTEGVILNKGHFETFVRDLLLVK-QYRVEVY  96

Query  445  EGSGS----NWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYV  612
               GS    NW L   G+PGNL  FEDILF NN++     ++A+         VVGL  V
Sbjct  97   VNQGSSKNQNWVLEHKGSPGNLSHFEDILFGNNDIAVGVSVIAVKLGTEGKSRVVGLSCV  156

Query  613  DLT  621
            D+ 
Sbjct  157  DVV  159



>gb|EFN70623.1| DNA mismatch repair protein Msh2 [Camponotus floridanus]
Length=895

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELY  444
            T HG++A F A+  + TT+  + +G+ P     V +++  FET  RDLLL +  + +E+Y
Sbjct  16   TLHGSDALFAAQEVFKTTSVCKMIGAEPHKTEGVILNKGHFETFVRDLLLVKQ-YRVEVY  74

Query  445  EGSGS----NWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYV  612
               GS    NW L   G+PGNL  FEDILF NN++     ++A+         VVGL  V
Sbjct  75   VNQGSSKNQNWVLEHKGSPGNLSHFEDILFGNNDIAVGVSVIAVKLGTEGKSRVVGLSCV  134

Query  613  DLT  621
            D+ 
Sbjct  135  DVV  137



>ref|XP_001917820.2| PREDICTED: LOW QUALITY PROTEIN: DNA mismatch repair protein Msh2 
[Equus caballus]
Length=937

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  +     ++ +G
Sbjct  9    LQLESAAEAGFVRFFQGMPEKPTXTVRLFDRGDFYTAHGEDALLAAREVFKXQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGIKMSTVDGQRQVGVGYVD  167



>ref|XP_010763729.1| DNA mismatch repair protein msh-2 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH43563.1| DNA mismatch repair protein msh-2 [Paracoccidioides brasiliensis 
Pb18]
Length=941

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 97/163 (60%), Gaps = 11/163 (7%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALR  330
            PELK+D +   GF+ FF++LP+  D+  VR FDR D+YTAHG +A +IA+T Y TT+ L+
Sbjct  5    PELKVDDEG--GFIRFFRSLPAKDDSSTVRVFDRGDFYTAHGPDAEYIARTVYKTTSVLK  62

Query  331  QLG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG---SNWRLVKTGTPGNL  498
             LG S  G + SV+M+  +F    R+ L  R    +E++   G   +NW L K  +PGNL
Sbjct  63   SLGRSDSGGLPSVTMTVTVFRNFLREALF-RLSMRVEIWVSQGGGKANWTLAKQASPGNL  121

Query  499  GSFEDILFANN-EMQDSPVIVALVPNIRENGC-VVGLGYVDLT  621
               E+ L A+   M  SP+I+A+  + + +    VG+ + D T
Sbjct  122  QDVEEDLGASGAAMDSSPIILAVKISAKASEARYVGVCFADAT  164



>ref|XP_005307393.1| PREDICTED: DNA mismatch repair protein Msh2 [Chrysemys picta 
bellii]
Length=939

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 10/128 (8%)
 Frame = +1

Query  265  TAHGNNATFIAKTYYHTTTALRQLGSGPG--AISSVSMSRNMFETIARDLLLERTDHTLE  438
            T HG +A   A+  + T   +R L  GPG   + SV +S+  FE+  RDLLL R  + +E
Sbjct  49   TVHGGDAQLAARELFRTRGVIRLLAGGPGNQKLESVVLSKMNFESFLRDLLLVR-QYRVE  107

Query  439  LYE---GSGS----NWRLVKTGTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVV  597
            +Y+   GS S    +W L   G+PGNL  FE+ILF NN+M  +  +V +     +   +V
Sbjct  108  IYKNKAGSKSTKENDWYLAYKGSPGNLAQFEEILFGNNDMSTAIGVVGVKLYTADGQRIV  167

Query  598  GLGYVDLT  621
            G+GYVD T
Sbjct  168  GVGYVDTT  175



>ref|XP_003065360.1| DNA mismatch repair protein msh-2, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER23215.1| DNA mismatch repair protein msh-2, putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EFW16729.1| DNA mismatch repair protein Msh2 [Coccidioides posadasii str. 
Silveira]
Length=941

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 94/162 (58%), Gaps = 12/162 (7%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALR  330
            PELK+D +   GF+ FF +LPS  D+  VR FDR D+YTAHG +A +IA+T Y TT+ LR
Sbjct  5    PELKVDDEV--GFIRFFHSLPSKDDSTTVRVFDRGDWYTAHGTDAEYIARTVYKTTSVLR  62

Query  331  QLG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN----WRLVKTGTPGN  495
             LG S    + SV+M+  +F    R+ L  R    +E++   G      W+LVK  +PGN
Sbjct  63   TLGRSDTSGLPSVTMTVTVFRNFLREALF-RLSKRIEIWSSQGGMGKGVWKLVKQASPGN  121

Query  496  LGSFEDILFANNEMQD-SPVIVALVPNIRENGCV-VGLGYVD  615
            L   ED L +   M D +P+I+A+  + R +    VG+ + D
Sbjct  122  LQDVEDELGSGGGMMDTAPIILAVKISARASETRHVGVCFAD  163



>ref|XP_010862818.1| PREDICTED: DNA mismatch repair protein Msh2 [Esox lucius]
Length=929

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 88/159 (55%), Gaps = 9/159 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSDTrvvrffdrr-dyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L +DA    GFL+++ ++P           R +YYT HG +A F+AK  + T   ++ LG
Sbjct  9    LSMDAAAEHGFLNYYFSMPEKPDTTFRIFDRGEYYTVHGTDALFVAKEVFKTNGVIKTLG  68

Query  340  SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS----NWRLVKTGTPGNLGSF  507
            SG   + SV +S+  FE + RDLLL +  + +E+Y         +W+L    +PGNL  F
Sbjct  69   SGSRKLESVVLSKANFEALVRDLLLVK-QYRVEVYRNHSKTKDHSWQLEYKASPGNLTQF  127

Query  508  EDILF--ANNEMQDSPVIVALVPNIRENGC-VVGLGYVD  615
            E++LF  A  ++  S  +VA+   +  +G  V+G+GYVD
Sbjct  128  EEVLFGGAEGKLAQSAGVVAVRLAVGSDGHRVLGVGYVD  166



>ref|XP_005980704.1| PREDICTED: DNA mismatch repair protein Msh2 [Pantholops hodgsonii]
Length=934

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 90/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHQEDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASIGVVGIKMSTVDGQRQVGVGYVDAT  169



>gb|KIW89382.1| DNA mismatch repair protein msh-2 [Cladophialophora bantiana 
CBS 173.52]
Length=938

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 93/160 (58%), Gaps = 10/160 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPSD---TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTAL  327
            PELK+D +   GF+  F++LP     +  +R  DR D+Y+AHG +A FIA+T Y TT  +
Sbjct  5    PELKVDDET--GFIRSFRSLPPKPGGSNTIRVIDRVDWYSAHGEDAEFIARTVYKTTAVI  62

Query  328  RQLGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-WRLVKTGTPGNLGS  504
            R LG    A+ SV+MS  +F  + R+ L  +    +E++E SG   W+L++  +PGNL +
Sbjct  63   RNLGRSENALPSVTMSTTVFRNLLREALF-KLGKRVEIWEASGKGPWKLIRQASPGNLQA  121

Query  505  FEDILFANNEMQ--DSPVIVALVPNIRE-NGCVVGLGYVD  615
             E+ L +  + Q   +P+I+A+  N +      VG+ + D
Sbjct  122  VEEELGSGMDSQGDSAPIILAVKVNAKAGEARSVGVCFAD  161



>ref|XP_005686632.1| PREDICTED: DNA mismatch repair protein Msh2 [Capra hircus]
Length=934

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 90/162 (56%), Gaps = 10/162 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHQEDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PTGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVDLT  621
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD T
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDAT  169



>ref|XP_007084767.1| PREDICTED: DNA mismatch repair protein Msh2 [Panthera tigris 
altaica]
Length=934

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 92/165 (56%), Gaps = 12/165 (7%)
 Frame = +1

Query  154  LPE--LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTA  324
            LP+  L+L++    GF+ FF+T+P   T  VR FDR D+YTAH  +A   A+  + T   
Sbjct  4    LPKETLQLESAAEIGFVRFFQTMPEKPTTTVRLFDRGDFYTAHHEDALLAAREVFKTQGV  63

Query  325  LRQLGS-GPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKT  480
            ++ +G  G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L   
Sbjct  64   VKYIGPPGTKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFK  122

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
             +PGNL  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  123  ASPGNLSQFEDILFGNNDMSASIGVVGVKISTVDGQRQVGVGYVD  167



>ref|XP_003984016.2| PREDICTED: DNA mismatch repair protein Msh2 [Felis catus]
Length=934

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 92/165 (56%), Gaps = 12/165 (7%)
 Frame = +1

Query  154  LPE--LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTA  324
            LP+  L+L++    GF+ FF+T+P   T  VR FDR D+YTAH  +A   A+  + T   
Sbjct  4    LPKETLQLESAAEIGFVRFFQTMPEKPTTTVRLFDRGDFYTAHHEDALLAAREVFKTQGV  63

Query  325  LRQLGS-GPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKT  480
            ++ +G  G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L   
Sbjct  64   VKYIGPPGTKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFK  122

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
             +PGNL  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  123  ASPGNLSQFEDILFGNNDMSASIGVVGVKISTVDGQRQVGVGYVD  167



>ref|XP_007460039.1| PREDICTED: DNA mismatch repair protein Msh2 isoform X2 [Lipotes 
vexillifer]
Length=884

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   L+ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHREDALLAAREVFKTQGVLKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVD  167



>ref|XP_002790205.1| DNA mismatch repair protein msh-2 [Paracoccidioides sp. 'lutzii' 
Pb01]
 gb|EEH37476.1| DNA mismatch repair protein msh-2 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=941

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 97/161 (60%), Gaps = 11/161 (7%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS--DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALR  330
            PELK+D +   GF+ FF++LP+  D+  VR FDR D+YTAHG +A +IA+T Y TT+ L+
Sbjct  5    PELKVDDEG--GFIRFFRSLPAKDDSSTVRVFDRGDFYTAHGPDAEYIARTVYKTTSVLK  62

Query  331  QLG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSG---SNWRLVKTGTPGNL  498
             LG S  G + SV+M+  +F    R+ L  R    +E++   G   +NW L K  +PGNL
Sbjct  63   SLGRSDTGGLPSVTMTVTVFRNFLREALF-RLSMRVEIWVSQGGGKANWTLAKQASPGNL  121

Query  499  GSFEDILFANN-EMQDSPVIVALVPNIRENGC-VVGLGYVD  615
               E+ L A+   M  SP+I+A+  + + +   +VG+ + D
Sbjct  122  QDVEEDLGASGAAMDSSPIILAVKVSAKASEARLVGVCFAD  162



>gb|EMD92836.1| hypothetical protein COCHEDRAFT_1154553 [Bipolaris maydis C5]
 gb|ENI04775.1| hypothetical protein COCC4DRAFT_170220 [Bipolaris maydis ATCC 
48331]
Length=931

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 83/139 (60%), Gaps = 9/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PE+K   +   GF  FF+ L   D   VR FDR DYY+AHG +A FIA T Y TT  +R+
Sbjct  5    PEIK--EEDESGFCKFFRNLEEKDNETVRIFDRGDYYSAHGEDAKFIANTVYKTTAVIRK  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGSF  507
            LG  PG + SV+M+  +F    RD L  R    +E+++ +G   +W++VK  +PGNL   
Sbjct  63   LGREPG-LESVTMTVTVFRNFLRDALF-RLSKRIEIWQSTGKRMDWKVVKQASPGNLQDL  120

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    +++ +P+I+A+
Sbjct  121  EDEL--GGQIESAPIILAV  137



>ref|XP_007460038.1| PREDICTED: DNA mismatch repair protein Msh2 isoform X1 [Lipotes 
vexillifer]
Length=934

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAH  +A   A+  + T   L+ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHREDALLAAREVFKTQGVLKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVD  167



>ref|XP_007700699.1| hypothetical protein COCSADRAFT_118766 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD63647.1| hypothetical protein COCSADRAFT_118766 [Bipolaris sorokiniana 
ND90Pr]
Length=931

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 83/139 (60%), Gaps = 9/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTL-PSDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PE+K   +   GF  FF+ L   D   VR FDR DYY+AHG +A FIA T Y TT  +R+
Sbjct  5    PEIK--EEDESGFCKFFRNLDEKDNETVRIFDRGDYYSAHGEDAKFIANTVYKTTAVIRK  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGSF  507
            LG  PG + SV+M+  +F    RD L  R    +E+++ +G   +W++VK  +PGNL   
Sbjct  63   LGREPG-LESVTMTVTVFRNFLRDALF-RLSKRIEIWQSTGKRMDWKVVKQASPGNLQDL  120

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    +++ +P+I+A+
Sbjct  121  EDEL--GGQIESAPIILAV  137



>ref|XP_008028868.1| hypothetical protein SETTUDRAFT_43199 [Setosphaeria turcica Et28A]
 gb|EOA83399.1| hypothetical protein SETTUDRAFT_43199 [Setosphaeria turcica Et28A]
Length=934

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 83/139 (60%), Gaps = 9/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PE+K   +   GF  FF+ L   D   VR FDR DYY+AHG +A FIA T Y TT  +R+
Sbjct  5    PEIK--EEDESGFCKFFRNLADKDNETVRIFDRGDYYSAHGEDAKFIANTVYKTTAVIRK  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGSF  507
            LG  PG + SV+M+  +F    RD L  R    +E+++ +G   +W++VK  +PGNL   
Sbjct  63   LGREPG-LESVTMTVTVFRNFLRDALF-RLSKRIEIWQSTGKRMDWKVVKQASPGNLQDL  120

Query  508  EDILFANNEMQDSPVIVAL  564
            E+ L    +M+ +P+I+A+
Sbjct  121  EEEL--GGQMESAPIILAV  137



>ref|XP_002583908.1| DNA mismatch repair protein msh-2 [Uncinocarpus reesii 1704]
 gb|EEP82010.1| DNA mismatch repair protein msh-2 [Uncinocarpus reesii 1704]
Length=1447

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 91/152 (60%), Gaps = 12/152 (8%)
 Frame = +1

Query  136  FEEQ-NKLPELKLDAKQAQGFLSFFKTLP--SDTrvvrffdrrdyyTAHGNNATFIAKTY  306
            FE++ +  PELK+D +   GF+ FF++LP   D+  VR FDR D+YTAHG++A +IA+T 
Sbjct  502  FEQKMSSRPELKVDDEV--GFIRFFRSLPPKDDSATVRVFDRGDWYTAHGSDAEYIARTV  559

Query  307  YHTTTALRQLG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN----WRL  471
            Y TT+ LR LG S    + SV+M+  +F    R+ L  R    LE++   G      W+L
Sbjct  560  YKTTSVLRTLGRSDTSGLPSVTMTVTVFRNFLREALF-RLSMRLEIWSSQGGAGKGAWKL  618

Query  472  VKTGTPGNLGSFEDILFANNEMQD-SPVIVAL  564
             K  +PGNL   ED L +   M D SP+I+A+
Sbjct  619  AKQASPGNLQDVEDELGSAGGMMDTSPIILAV  650



>ref|XP_007691816.1| hypothetical protein COCMIDRAFT_8663 [Bipolaris oryzae ATCC 44560]
 gb|EUC41661.1| hypothetical protein COCMIDRAFT_8663 [Bipolaris oryzae ATCC 44560]
Length=933

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 83/139 (60%), Gaps = 9/139 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PE+K   +   GF  FF+ L   D   VR FDR DYY+AHG +A FIA T Y TT  +R+
Sbjct  5    PEIK--EEDESGFCKFFRNLEGKDNETVRIFDRGDYYSAHGEDAKFIANTVYKTTAVIRK  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGSF  507
            LG  PG + SV+M+  +F    RD L  R    +E+++ +G   +W++VK  +PGNL   
Sbjct  63   LGREPG-LESVTMTVTVFRNFLRDALF-RLSKRIEIWQSTGKRMDWKVVKQASPGNLQDL  120

Query  508  EDILFANNEMQDSPVIVAL  564
            ED L    +++ +P+I+A+
Sbjct  121  EDEL--GGQIESAPIILAV  137



>ref|XP_010966048.1| PREDICTED: DNA mismatch repair protein Msh2 [Camelus bactrianus]
 ref|XP_010982332.1| PREDICTED: DNA mismatch repair protein Msh2 [Camelus dromedarius]
Length=934

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 92/165 (56%), Gaps = 12/165 (7%)
 Frame = +1

Query  154  LPE--LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTA  324
            LP+  L+LD     GF+ FF+ +P   T  VR FDR D+Y+AH  +A   A+  + T   
Sbjct  4    LPKETLQLDGAAELGFVRFFQAMPEKPTTTVRLFDRGDFYSAHSEDALLAAREVFKTQGV  63

Query  325  LRQLG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKT  480
            ++ +G +G  A+ SV +S+  FE+  +DLLL R  + +E+Y+    N       W L   
Sbjct  64   VKYMGPAGTKALESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKTSKENDWYLAFK  122

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
             +PGNL  FEDILF NN++  S  +V +  +  +    VG+GYVD
Sbjct  123  ASPGNLSQFEDILFGNNDVSASIGVVGVKMSTVDGQRQVGVGYVD  167



>ref|XP_006216498.1| PREDICTED: DNA mismatch repair protein Msh2 isoform X1 [Vicugna 
pacos]
Length=934

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 92/165 (56%), Gaps = 12/165 (7%)
 Frame = +1

Query  154  LPE--LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTA  324
            LP+  L+LD     GF+ FF+ +P   T  VR FDR D+Y+AH  +A   A+  + T   
Sbjct  4    LPKETLQLDGAAELGFVRFFQAMPEKPTTTVRLFDRGDFYSAHSEDALLAAREVFKTQGV  63

Query  325  LRQLG-SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKT  480
            ++ +G +G  A+ SV +S+  FE+  +DLLL R  + +E+Y+    N       W L   
Sbjct  64   VKYMGPAGTKALESVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKTSKENDWYLAFK  122

Query  481  GTPGNLGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
             +PGNL  FEDILF NN++  S  +V +  +  +    VG+GYVD
Sbjct  123  ASPGNLSQFEDILFGNNDVSASIGVVGVKMSTVDGQRQVGVGYVD  167



>gb|KEQ79885.1| DNA mismatch repair protein-like protein msh-2 [Aureobasidium 
pullulans EXF-150]
Length=918

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLP-SDTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ FF+ LP ++   +R FDR DYYTAHG++A FIA   Y TT+ ++Q
Sbjct  5    PELKVDDEY--GFIKFFRNLPGTNDDTIRLFDRNDYYTAHGDDAKFIALNQYKTTSVIKQ  62

Query  334  LGSGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-WRLVKTGTPGNLGSFE  510
            LG  PG + SV++S+ +F    R+ L  R    +E++E +G N + L K  +PGNL   E
Sbjct  63   LGRDPG-LESVTLSQTVFRNFLREALF-RLGKRVEIWESTGKNKFTLAKQASPGNLQDVE  120

Query  511  DILFANNEMQDSPVIVAL  564
            D +   + M+ +P+I+A+
Sbjct  121  DEV--GSSMEAAPIILAV  136



>gb|ELV13655.1| DNA mismatch repair protein Msh2 [Tupaia chinensis]
Length=488

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 89/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YT HG +A   A+  + T   ++ +G
Sbjct  9    LQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTVHGEDAVLAAREVFKTQGVIKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+Y+    N       W L    +PGN
Sbjct  69   PAGAKDLQSVVLSKMNFESFVKDLLLVR-QYRVEVYKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN++  S  +V +  +  +    VG+GYVD
Sbjct  128  LSQFEDILFGNNDLSASIGVVGVKMSTVDGQRQVGVGYVD  167



>ref|XP_001382178.3| PREDICTED: DNA mismatch repair protein Msh2 [Monodelphis domestica]
Length=969

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 87/160 (54%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSDTrvvrffdrr-dyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L +D++    F+ FF+ LP+          R DYYTAHG +A   A+  + T   ++ +G
Sbjct  44   LAMDSQAECSFVRFFQALPAKPLTTVRLFDRGDYYTAHGEDALLAAREVFKTQAVIKYIG  103

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+ ++DLLL R  + +E+Y+    N       W +    +PGN
Sbjct  104  LTGSKKLESVVLSKMNFESFSKDLLLVR-QYRVEVYKNKAGNKATKENDWHVAFKASPGN  162

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FE+ILF NN+M  S   V +  +I +   +VG+GYVD
Sbjct  163  LSQFEEILFGNNDMSCSIGGVGVKLSIVDGQRLVGVGYVD  202



>ref|XP_004436729.1| PREDICTED: DNA mismatch repair protein Msh2 isoform 1 [Ceratotherium 
simum simum]
Length=934

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 90/160 (56%), Gaps = 10/160 (6%)
 Frame = +1

Query  163  LKLDAKQAQGFLSFFKTLPSD-TrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQLG  339
            L+L++    GF+ FF+ +P   T  VR FDR D+YTAHG +A   A+  + T   ++ +G
Sbjct  9    LQLESFAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVVKYMG  68

Query  340  -SGPGAISSVSMSRNMFETIARDLLLERTDHTLELYEGSGSN-------WRLVKTGTPGN  495
             +G   + SV +S+  FE+  +DLLL R  + +E+++    N       W L    +PGN
Sbjct  69   PTGAKTLESVVLSKMNFESFVKDLLLVR-QYRVEVFKNRAGNKASKENDWYLAFKASPGN  127

Query  496  LGSFEDILFANNEMQDSPVIVALVPNIRENGCVVGLGYVD  615
            L  FEDILF NN+M  S  +V +  +  +    VG+GYVD
Sbjct  128  LAQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVD  167



>gb|ENH88976.1| DNA mismatch repair protein [Colletotrichum orbiculare MAFF 240422]
Length=922

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 88/140 (63%), Gaps = 9/140 (6%)
 Frame = +1

Query  157  PELKLDAKQAQGFLSFFKTLPS-DTrvvrffdrrdyyTAHGNNATFIAKTYYHTTTALRQ  333
            PELK+D +   GF+ FFK+LP+     VR FDR D+YTAHG +A FIA+T Y TT+ +R 
Sbjct  5    PELKVDDEH--GFIRFFKSLPTVHEDTVRIFDRGDWYTAHGEDANFIARTVYKTTSVVRT  62

Query  334  LGSGPG-AISSVSMSRNMFETIARDLLLERTDHTLELYEGSGS--NWRLVKTGTPGNLGS  504
            LG      +SSV+M+  +F    R+ L  +    +E++E +G   NW++VK  +PGNL  
Sbjct  63   LGRDEKTGLSSVTMTVTVFRQFLREALF-KLGKRIEIWESTGGRMNWKIVKQASPGNLQD  121

Query  505  FEDILFANNEMQDSPVIVAL  564
             E+ L    +++ +P+I+A+
Sbjct  122  VEEDL--GGQIESAPMILAV  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950