BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS146C10

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    245   9e-72   Solanum lycopersicum
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    243   7e-71   Solanum pennellii
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    242   2e-70   Solanum peruvianum [Peruvian tomato]
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    241   4e-70   Sesamum indicum [beniseed]
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    241   4e-70   Solanum tuberosum [potatoes]
emb|CDP02660.1|  unnamed protein product                                238   5e-69   Coffea canephora [robusta coffee]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    236   1e-68   Nicotiana tomentosiformis
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    235   3e-68   Solanum tuberosum [potatoes]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    234   5e-68   Sesamum indicum [beniseed]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    234   1e-67   Solanum lycopersicum
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    234   1e-67   Nelumbo nucifera [Indian lotus]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    231   7e-67   Nicotiana sylvestris
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    230   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    229   3e-66   Nicotiana sylvestris
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    229   6e-66   Nicotiana tomentosiformis
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                227   2e-65   Erythranthe guttata [common monkey flower]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    226   4e-65   Dimocarpus longan [longan]
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    226   8e-65   Morus notabilis
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    225   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    223   6e-64   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    223   7e-64   
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             222   2e-63   Prunus persica
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    221   2e-63   
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    219   2e-62   
emb|CBI35733.3|  unnamed protein product                                218   2e-62   Vitis vinifera
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    218   5e-62   Vitis vinifera
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   214   9e-61   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             214   9e-61   Citrus clementina [clementine]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    214   1e-60   Citrus sinensis [apfelsine]
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           214   1e-60   
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             214   1e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    211   1e-59   Fragaria vesca subsp. vesca
gb|EPS74129.1|  hypothetical protein M569_00625                         210   2e-59   Genlisea aurea
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         210   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             209   7e-59   
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    209   1e-58   Eucalyptus grandis [rose gum]
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    208   2e-58   
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    207   2e-58   Arabis alpina [alpine rockcress]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           208   2e-58   Glycine max [soybeans]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             206   9e-58   Capsella rubella
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             205   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    204   3e-57   Cicer arietinum [garbanzo]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    204   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    204   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    204   5e-57   Camelina sativa [gold-of-pleasure]
gb|KJB18115.1|  hypothetical protein B456_003G034500                    204   6e-57   Gossypium raimondii
gb|KJB18113.1|  hypothetical protein B456_003G034400                    204   7e-57   Gossypium raimondii
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    204   9e-57   Populus euphratica
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    203   9e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    203   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    203   1e-56   Cucumis sativus [cucumbers]
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    202   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    202   2e-56   Gossypium arboreum [tree cotton]
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             202   2e-56   
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             202   3e-56   Capsella rubella
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    201   5e-56   Brassica rapa
gb|KJB48795.1|  hypothetical protein B456_008G087500                    201   5e-56   Gossypium raimondii
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         201   5e-56   Jatropha curcas
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    201   6e-56   Tarenaya hassleriana [spider flower]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    201   1e-55   Gossypium arboreum [tree cotton]
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             200   1e-55   
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    199   2e-55   
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    197   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    196   4e-54   Camelina sativa [gold-of-pleasure]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           196   6e-54   Glycine max [soybeans]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    195   7e-54   Arabis alpina [alpine rockcress]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             195   8e-54   Phaseolus vulgaris [French bean]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    195   1e-53   Ricinus communis
ref|NP_001237688.1|  receptor-like protein kinase precursor             192   1e-52   Glycine max [soybeans]
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    190   6e-52   
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    190   7e-52   Brassica rapa
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    189   1e-51   Elaeis guineensis
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    189   2e-51   Elaeis guineensis
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    189   2e-51   
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    188   3e-51   Cucumis melo [Oriental melon]
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    187   6e-51   Tarenaya hassleriana [spider flower]
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    187   8e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          187   1e-50   
gb|AES94465.2|  LRR receptor-like kinase family protein                 184   6e-50   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                       184   7e-50   
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    182   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             181   7e-49   Phaseolus vulgaris [French bean]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    181   9e-49   
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    181   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADB85326.1|  putative receptor protein kinase                        170   2e-48   Phyllostachys edulis [kikko-chiku]
emb|CDY08759.1|  BnaA06g24650D                                          179   4e-48   Brassica napus [oilseed rape]
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    176   4e-47   
ref|XP_003608587.1|  Receptor-like protein kinase                       176   4e-47   Medicago truncatula
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    176   8e-47   Phoenix dactylifera
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    171   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ84911.1|  predicted protein                                      168   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    164   1e-42   Phoenix dactylifera
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    162   4e-42   Oryza brachyantha
ref|NP_001058840.2|  Os07g0134200                                       162   4e-42   
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    162   4e-42   Zea mays [maize]
gb|EAZ02682.1|  hypothetical protein OsI_24796                          162   6e-42   Oryza sativa Indica Group [Indian rice]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          162   6e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          162   6e-42   Sorghum bicolor [broomcorn]
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    161   9e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12                159   1e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    160   2e-41   Cucumis melo [Oriental melon]
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    160   3e-41   
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    159   4e-41   Setaria italica
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    159   5e-41   
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    159   5e-41   Cucumis sativus [cucumbers]
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    159   7e-41   
emb|CDY02112.1|  BnaA03g40550D                                          157   2e-40   
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    156   8e-40   
emb|CDY23037.1|  BnaC07g31500D                                          155   9e-40   Brassica napus [oilseed rape]
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          155   2e-39   Sorghum bicolor [broomcorn]
emb|CDY45620.1|  BnaCnng13280D                                          152   1e-38   Brassica napus [oilseed rape]
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    151   3e-38   
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470          151   3e-38   Amborella trichopoda
dbj|BAJ89729.1|  predicted protein                                      151   3e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHJ14779.1|  CLAVATA1                                                150   7e-38   Rhododendron ovatum
gb|ABF99108.1|  Receptor protein kinase CLAVATA1 precursor, putat...    149   8e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783             150   1e-37   
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    150   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...    149   1e-37   Populus euphratica
gb|AAP68887.1|  putative receptor-like protein kinase 1                 149   1e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92008.1|  hypothetical protein OsI_13698                          149   1e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1        149   1e-37   
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    148   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002307734.1|  receptor protein kinase                            148   3e-37   Populus trichocarpa [western balsam poplar]
gb|EEE60014.1|  hypothetical protein OsJ_12761                          147   7e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    147   8e-37   
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    145   2e-36   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    145   3e-36   
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    145   4e-36   Fragaria vesca subsp. vesca
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    144   8e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             144   1e-35   Prunus persica
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...    144   1e-35   Phoenix dactylifera
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...    143   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    143   2e-35   Populus euphratica
ref|XP_011004295.1|  PREDICTED: leucine-rich repeat receptor-like...    142   3e-35   Populus euphratica
gb|AAF73373.1|AF193835_1  LRK1 protein                                  142   3e-35   Oryza sativa [red rice]
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...    142   3e-35   
gb|KEH33614.1|  LRR receptor-like kinase family protein                 142   4e-35   Medicago truncatula
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    142   5e-35   
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    142   7e-35   
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...    141   9e-35   Cicer arietinum [garbanzo]
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250          141   9e-35   
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1        141   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    141   1e-34   Prunus mume [ume]
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    140   1e-34   Brassica rapa
ref|XP_002300697.2|  receptor protein kinase                            140   1e-34   
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...    140   2e-34   Setaria italica
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    140   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1        140   2e-34   Malus domestica [apple tree]
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    140   3e-34   
gb|KDP36903.1|  hypothetical protein JCGZ_08194                         139   4e-34   Jatropha curcas
emb|CDP04113.1|  unnamed protein product                                139   4e-34   Coffea canephora [robusta coffee]
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738             139   4e-34   
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    139   4e-34   Vitis vinifera
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...    139   5e-34   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1        139   6e-34   Fragaria vesca subsp. vesca
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    138   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...    138   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    138   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...    138   1e-33   Elaeis guineensis
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg             138   2e-33   Citrus clementina [clementine]
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                   137   2e-33   Citrus sinensis [apfelsine]
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...    137   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg             137   2e-33   Capsella rubella
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    137   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    137   2e-33   Populus euphratica
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                    137   2e-33   Arabis alpina [alpine rockcress]
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             137   2e-33   Citrus clementina [clementine]
gb|KJB29653.1|  hypothetical protein B456_005G112100                    137   2e-33   Gossypium raimondii
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...    137   3e-33   Citrus sinensis [apfelsine]
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...    137   4e-33   
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             137   4e-33   Eutrema salsugineum [saltwater cress]
emb|CBI19895.3|  unnamed protein product                                136   4e-33   Vitis vinifera
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    136   4e-33   Brachypodium distachyon [annual false brome]
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...    136   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1        136   5e-33   Vitis vinifera
emb|CDX73202.1|  BnaC06g36500D                                          136   5e-33   
emb|CDX87661.1|  BnaA07g32120D                                          136   6e-33   
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    136   7e-33   Elaeis guineensis
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    136   7e-33   Ricinus communis
ref|XP_011035024.1|  PREDICTED: receptor protein kinase CLAVATA1-...    135   8e-33   Populus euphratica
ref|XP_009393965.1|  PREDICTED: leucine-rich repeat receptor-like...    134   8e-33   
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg             135   9e-33   Eutrema salsugineum [saltwater cress]
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    135   9e-33   Malus domestica [apple tree]
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...    135   9e-33   Populus euphratica
ref|XP_008647501.1|  PREDICTED: uncharacterized LOC100272700 isof...    135   1e-32   Zea mays [maize]
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...    135   1e-32   
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   Phoenix dactylifera
ref|XP_006468613.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   Citrus sinensis [apfelsine]
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   Citrus sinensis [apfelsine]
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...    135   1e-32   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1        135   1e-32   Brassica rapa
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             135   2e-32   Capsella rubella
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    134   2e-32   Vitis vinifera
emb|CAN71863.1|  hypothetical protein VITISV_023530                     134   3e-32   Vitis vinifera
emb|CBI29704.3|  unnamed protein product                                134   3e-32   Vitis vinifera
gb|AAP49010.1|  CLV1-like receptor kinase                               134   3e-32   Brassica napus [oilseed rape]
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870          134   3e-32   Sorghum bicolor [broomcorn]
gb|ADD64789.1|  CLAVATA1                                                134   3e-32   Brassica napus [oilseed rape]
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1        134   4e-32   Solanum lycopersicum
ref|XP_007131794.1|  hypothetical protein PHAVU_011G042100g             132   4e-32   Phaseolus vulgaris [French bean]
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    134   4e-32   
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    133   5e-32   
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1        133   7e-32   
gb|KJB59753.1|  hypothetical protein B456_009G269700                    131   7e-32   Gossypium raimondii
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                        133   7e-32   Gossypium arboreum [tree cotton]
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                   133   9e-32   
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    132   1e-31   Pyrus x bretschneideri [bai li]
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana          132   2e-31
ref|NP_177710.1|  receptor protein kinase CLAVATA1                      132   2e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDP07377.1|  unnamed protein product                                131   2e-31   Coffea canephora [robusta coffee]
gb|AAD02501.1|  receptor kinase                                         132   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAB58929.1|  CLV1 receptor kinase                                    132   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729             132   2e-31   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1        132   2e-31   Eucalyptus grandis [rose gum]
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    132   2e-31   Eucalyptus grandis [rose gum]
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                     132   2e-31   Eucalyptus grandis [rose gum]
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg             132   2e-31   
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    131   3e-31   Glycine max [soybeans]
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             131   3e-31   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             131   3e-31   
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    130   5e-31   Sesamum indicum [beniseed]
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    130   6e-31   Elaeis guineensis
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    130   6e-31   Camelina sativa [gold-of-pleasure]
gb|KJB32927.1|  hypothetical protein B456_005G268400                    130   6e-31   Gossypium raimondii
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...    130   8e-31   Ricinus communis
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    130   9e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g             130   1e-30   Phaseolus vulgaris [French bean]
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    129   1e-30   
gb|AIT55304.1|  nodulation autoregulation receptor kinase               129   1e-30   Phaseolus vulgaris [French bean]
gb|EEC79804.1|  hypothetical protein OsI_21242                          129   1e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001174552.1|  Os05g0595950                                       129   1e-30   
ref|XP_009345734.1|  PREDICTED: putative receptor-like protein ki...    129   2e-30   Pyrus x bretschneideri [bai li]
gb|KDP23869.1|  hypothetical protein JCGZ_27138                         129   2e-30   Jatropha curcas
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1        129   2e-30   Sesamum indicum [beniseed]
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    128   3e-30   Gossypium arboreum [tree cotton]
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    128   3e-30   Glycine max [soybeans]
ref|XP_010676066.1|  PREDICTED: LRR receptor-like serine/threonin...    128   3e-30   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                          128   4e-30   Silene latifolia
ref|XP_010668145.1|  PREDICTED: receptor protein kinase CLAVATA1-...    126   5e-30   
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...    127   5e-30   
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    127   6e-30   Populus euphratica
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    127   7e-30   Solanum lycopersicum
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    127   8e-30   
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    127   9e-30   
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    127   9e-30   Nicotiana tomentosiformis
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...    127   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...    127   1e-29   Oryza brachyantha
gb|ACH59593.1|  LRR receptor-like protein kinase                        117   1e-29   Pseudotsuga menziesii
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1        127   1e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             126   2e-29   
gb|ACH59600.1|  LRR receptor-like protein kinase                        117   2e-29   Pseudotsuga menziesii
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1        126   2e-29   Tarenaya hassleriana [spider flower]
gb|KJB16198.1|  hypothetical protein B456_002G217000                    125   2e-29   Gossypium raimondii
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        126   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    125   2e-29   Cucumis sativus [cucumbers]
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        125   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    125   3e-29   Gossypium arboreum [tree cotton]
emb|CAD42335.1|  hypernodulation aberrant root formation protein        125   3e-29   Lotus japonicus
ref|NP_001238576.1|  receptor protein kinase-like protein precursor     125   4e-29   Glycine max [soybeans]
ref|XP_010243899.1|  PREDICTED: leucine-rich repeat receptor-like...    125   4e-29   Nelumbo nucifera [Indian lotus]
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    125   4e-29   Glycine soja [wild soybean]
ref|XP_010277679.1|  PREDICTED: LRR receptor-like serine/threonin...    125   5e-29   Nelumbo nucifera [Indian lotus]
dbj|BAC41332.1|  LRR receptor-like kinase                               125   5e-29   Glycine max [soybeans]
gb|KJB16199.1|  hypothetical protein B456_002G217000                    125   5e-29   Gossypium raimondii
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             125   5e-29   Prunus persica
gb|EMT21473.1|  Putative LRR receptor-like serine/threonine-prote...    125   5e-29   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor     125   5e-29   Glycine max [soybeans]
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    124   6e-29   Nelumbo nucifera [Indian lotus]
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    124   6e-29   
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...    124   6e-29   Populus euphratica
gb|KJB58082.1|  hypothetical protein B456_009G193600                    124   7e-29   Gossypium raimondii
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    124   7e-29   Prunus mume [ume]
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             124   8e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    124   1e-28   Citrus sinensis [apfelsine]
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                        124   1e-28   Gossypium arboreum [tree cotton]
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             124   1e-28   Phaseolus vulgaris [French bean]
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                     124   1e-28   
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   124   1e-28   
ref|XP_010026766.1|  PREDICTED: putative receptor-like protein ki...    124   1e-28   
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    124   1e-28   
gb|KCW60108.1|  hypothetical protein EUGRSUZ_H02842                     124   1e-28   
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...    124   1e-28   
ref|XP_006663536.1|  PREDICTED: probable LRR receptor-like serine...    124   1e-28   
ref|XP_008351784.1|  PREDICTED: putative receptor-like protein ki...    124   1e-28   
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    124   1e-28   
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    123   2e-28   
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    123   2e-28   
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                123   2e-28   
ref|XP_006590881.1|  PREDICTED: receptor protein kinase CLAVATA1-...    121   3e-28   
emb|CDO97616.1|  unnamed protein product                                122   3e-28   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    122   4e-28   
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    122   4e-28   
ref|XP_002529272.1|  serine-threonine protein kinase, plant-type,...    122   4e-28   
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg             122   4e-28   
gb|KEH37840.1|  LRR receptor-like kinase family protein                 122   4e-28   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                        122   4e-28   
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg             122   4e-28   
gb|KDP42443.1|  hypothetical protein JCGZ_00240                         122   4e-28   
ref|XP_002526889.1|  serine-threonine protein kinase, plant-type,...    122   5e-28   
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...    122   6e-28   
gb|KJB73883.1|  hypothetical protein B456_011G2584002                   116   6e-28   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558              122   7e-28   
gb|KJB47871.1|  hypothetical protein B456_008G045400                    121   7e-28   
ref|XP_011035599.1|  PREDICTED: probable LRR receptor-like serine...    121   7e-28   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...    121   8e-28   
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    121   9e-28   
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g             121   9e-28   
emb|CAN71566.1|  hypothetical protein VITISV_016304                     117   1e-27   
ref|XP_010690942.1|  PREDICTED: probable LRR receptor-like serine...    121   1e-27   
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...    121   1e-27   
ref|XP_008791706.1|  PREDICTED: putative receptor-like protein ki...    121   1e-27   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051              121   1e-27   
gb|AAW71475.1|  CLV1-like receptor kinase                               120   1e-27   
emb|CAD42181.1|  serine-threonine protein kinase                        120   1e-27   
dbj|BAJ99137.1|  predicted protein                                      120   1e-27   
gb|EYU30632.1|  hypothetical protein MIMGU_mgv1a022995mg                116   2e-27   
ref|XP_003606987.1|  CLV1-like receptor kinase                          119   2e-27   
gb|AAX14781.1|  RLP1 leucine-rich repeat receptor-like protein          119   2e-27   
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    120   2e-27   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...    120   2e-27   
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...    120   2e-27   
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...    120   2e-27   
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...    120   2e-27   
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    120   2e-27   
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    120   2e-27   
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    120   2e-27   
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    120   3e-27   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg             119   3e-27   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...    119   3e-27   
ref|XP_008369397.1|  PREDICTED: putative receptor-like protein ki...    119   3e-27   
ref|XP_010667968.1|  PREDICTED: leucine-rich repeat receptor-like...    119   4e-27   
ref|XP_002308597.2|  hypothetical protein POPTR_0006s25380g             119   4e-27   
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...    119   5e-27   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...    119   5e-27   
ref|XP_008345324.1|  PREDICTED: putative receptor-like protein ki...    119   5e-27   
gb|EPS62062.1|  protein kinase                                          119   5e-27   
ref|XP_009369178.1|  PREDICTED: putative receptor-like protein ki...    119   5e-27   
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g             119   6e-27   
emb|CDP18494.1|  unnamed protein product                                119   7e-27   
emb|CDX92460.1|  BnaA10g14990D                                          118   7e-27   
ref|XP_008369385.1|  PREDICTED: putative receptor-like protein ki...    119   8e-27   
gb|EYU40960.1|  hypothetical protein MIMGU_mgv1a018813mg                118   8e-27   
ref|XP_010058160.1|  PREDICTED: putative receptor-like protein ki...    117   9e-27   
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...    118   1e-26   
ref|XP_008370076.1|  PREDICTED: probable LRR receptor-like serine...    118   1e-26   
ref|NP_001048946.2|  Os03g0145000                                       118   1e-26   
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...    118   1e-26   
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...    118   1e-26   
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    118   1e-26   
ref|XP_010269666.1|  PREDICTED: probable LRR receptor-like serine...    118   1e-26   
gb|KCW71731.1|  hypothetical protein EUGRSUZ_E00238                     118   1e-26   
ref|XP_004952135.1|  PREDICTED: leucine-rich repeat receptor-like...    118   1e-26   
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...    118   1e-26   
gb|EEC68365.1|  hypothetical protein OsI_36500                          115   1e-26   
ref|XP_006645505.1|  PREDICTED: putative receptor-like protein ki...    118   1e-26   
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...    118   1e-26   
ref|XP_010026767.1|  PREDICTED: probable LRR receptor-like serine...    117   1e-26   
ref|XP_009409686.1|  PREDICTED: putative receptor-like protein ki...    118   1e-26   
dbj|BAJ95144.1|  predicted protein                                      117   2e-26   
ref|XP_008377848.1|  PREDICTED: receptor protein kinase CLAVATA1-...    117   2e-26   
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   
gb|EAY88517.1|  hypothetical protein OsI_09989                          117   2e-26   
ref|XP_003625388.1|  Receptor-like protein kinase                       117   2e-26   
ref|XP_002527461.1|  serine-threonine protein kinase, plant-type,...    117   2e-26   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                   117   2e-26   
ref|XP_010256508.1|  PREDICTED: probable LRR receptor-like serine...    117   2e-26   
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   
ref|XP_008223875.1|  PREDICTED: probable LRR receptor-like serine...    117   2e-26   
gb|KEH29416.1|  LRR receptor-like kinase family protein                 117   2e-26   
ref|XP_010675938.1|  PREDICTED: LRR receptor-like serine/threonin...    117   2e-26   
ref|XP_010064788.1|  PREDICTED: putative receptor-like protein ki...    117   2e-26   
gb|KCW69037.1|  hypothetical protein EUGRSUZ_F02592                     117   2e-26   
ref|XP_008803980.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   
ref|XP_008224399.1|  PREDICTED: probable LRR receptor-like serine...    117   2e-26   
gb|KJB73884.1|  hypothetical protein B456_011G258500                    117   2e-26   
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...    117   3e-26   
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...    117   3e-26   
emb|CDY26403.1|  BnaA02g23670D                                          116   3e-26   
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...    117   3e-26   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...    117   3e-26   
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...    117   3e-26   
ref|XP_006423117.1|  hypothetical protein CICLE_v10027688mg             117   3e-26   
ref|XP_010911433.1|  PREDICTED: putative receptor-like protein ki...    114   3e-26   
gb|KJB73885.1|  hypothetical protein B456_011G258600                    117   3e-26   
gb|KJB73887.1|  hypothetical protein B456_011G258900                    113   4e-26   
gb|KJB53046.1|  hypothetical protein B456_008G290200                    116   4e-26   
ref|XP_009351379.1|  PREDICTED: probable LRR receptor-like serine...    113   4e-26   
ref|XP_008369236.1|  PREDICTED: probable LRR receptor-like serine...    116   5e-26   
ref|XP_006830605.1|  hypothetical protein AMTR_s00120p00057210          114   5e-26   
ref|XP_010257102.1|  PREDICTED: putative receptor-like protein ki...    116   5e-26   
emb|CAN65889.1|  hypothetical protein VITISV_030571                     114   5e-26   
ref|NP_001068120.1|  Os11g0570000                                       114   5e-26   
ref|XP_003614937.1|  Somatic embryogenesis receptor kinase              113   5e-26   
ref|XP_006279948.1|  hypothetical protein CARUB_v10025818mg             116   5e-26   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...    116   5e-26   
ref|XP_003539668.1|  PREDICTED: leucine-rich repeat receptor-like...    116   5e-26   
ref|XP_008355553.1|  PREDICTED: probable LRR receptor-like serine...    116   5e-26   
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg             116   6e-26   
ref|XP_006382044.1|  hypothetical protein POPTR_0006s25380g             116   6e-26   
emb|CDY36706.1|  BnaC02g31270D                                          116   6e-26   
gb|EYU21706.1|  hypothetical protein MIMGU_mgv1a023669mg                116   6e-26   
ref|XP_008369395.1|  PREDICTED: probable LRR receptor-like serine...    116   6e-26   
ref|XP_010907375.1|  PREDICTED: probable LRR receptor-like serine...    116   6e-26   
ref|XP_006493473.1|  PREDICTED: putative leucine-rich repeat rece...    116   6e-26   
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    116   7e-26   
ref|XP_002303493.2|  hypothetical protein POPTR_0003s10680g             116   7e-26   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1        115   7e-26   
ref|XP_004979517.1|  PREDICTED: putative receptor-like protein ki...    115   7e-26   
ref|XP_009341868.1|  PREDICTED: probable LRR receptor-like serine...    115   7e-26   
emb|CDP21987.1|  unnamed protein product                                114   7e-26   
ref|XP_004983327.1|  PREDICTED: leucine-rich repeat receptor-like...    113   7e-26   
gb|AAB82755.1|  receptor kinase-like protein                            115   8e-26   
gb|EEC68386.1|  hypothetical protein OsI_36534                          115   8e-26   
ref|XP_010520745.1|  PREDICTED: putative receptor-like protein ki...    115   8e-26   
ref|XP_008223897.1|  PREDICTED: probable LRR receptor-like serine...    115   8e-26   
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...    115   9e-26   
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...    115   9e-26   
ref|XP_004955796.1|  PREDICTED: probable LRR receptor-like serine...    115   9e-26   
gb|KJB73886.1|  hypothetical protein B456_011G258700                    115   9e-26   
gb|EEC70577.1|  hypothetical protein OsI_01776                          115   1e-25   
gb|EYU21721.1|  hypothetical protein MIMGU_mgv1a019783mg                115   1e-25   
gb|KJB73894.1|  hypothetical protein B456_011G259500                    115   1e-25   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   
gb|KJB32855.1|  hypothetical protein B456_005G265400                    115   1e-25   
ref|XP_009377741.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-25   
ref|XP_009340992.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-25   
ref|XP_007021924.1|  Serine-threonine protein kinase                    112   1e-25   
ref|XP_010693707.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   
gb|AAB82756.1|  receptor kinase-like protein                            115   1e-25   
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   
ref|XP_008385922.1|  PREDICTED: LRR receptor-like serine/threonin...    115   1e-25   
gb|KJB51410.1|  hypothetical protein B456_008G215400                    115   1e-25   
gb|KJB51409.1|  hypothetical protein B456_008G215400                    115   1e-25   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...    115   1e-25   
ref|XP_010269665.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-25   
gb|EYU26654.1|  hypothetical protein MIMGU_mgv1a001213mg                114   1e-25   
ref|XP_006427668.1|  hypothetical protein CICLE_v10027227mg             115   2e-25   
gb|KJB45801.1|  hypothetical protein B456_007G329200                    110   2e-25   
gb|EPS70741.1|  hypothetical protein M569_04011                         114   2e-25   
ref|XP_008812886.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-25   
gb|EEC66712.1|  hypothetical protein OsI_33040                          114   2e-25   
ref|XP_010939071.1|  PREDICTED: probable LRR receptor-like serine...    114   2e-25   
ref|XP_010064760.1|  PREDICTED: probable leucine-rich repeat rece...    110   2e-25   
ref|XP_010262819.1|  PREDICTED: putative receptor-like protein ki...    114   2e-25   
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...    114   2e-25   
ref|XP_010064793.1|  PREDICTED: putative receptor-like protein ki...    114   2e-25   
gb|AAC78595.1|  Hcr2-5B                                                 114   2e-25   
ref|XP_007131359.1|  hypothetical protein PHAVU_011G007200g             114   2e-25   
gb|AAX19029.1|  Hcr2-p6                                                 111   2e-25   
ref|XP_004143021.1|  PREDICTED: probable LRR receptor-like serine...    114   2e-25   
gb|KGN62467.1|  hypothetical protein Csa_2G354930                       114   3e-25   
ref|XP_004966471.1|  PREDICTED: leucine-rich repeat receptor-like...    114   3e-25   
ref|XP_010655183.1|  PREDICTED: putative receptor-like protein ki...    114   3e-25   
ref|XP_011470626.1|  PREDICTED: LRR receptor-like serine/threonin...    110   3e-25   
emb|CDP10862.1|  unnamed protein product                                113   3e-25   
ref|XP_010664968.1|  PREDICTED: probable LRR receptor-like serine...    114   3e-25   
gb|AAC78593.1|  Hcr2-0B                                                 114   3e-25   
gb|KCW69044.1|  hypothetical protein EUGRSUZ_F02602                     113   3e-25   
gb|KCW80480.1|  hypothetical protein EUGRSUZ_C018221                    109   3e-25   
ref|XP_010321824.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    114   3e-25   
gb|AAC78596.1|  Hcr2-5D                                                 114   3e-25   
gb|KJB73880.1|  hypothetical protein B456_011G258200                    114   3e-25   
gb|AAC78591.1|  disease resistance protein                              114   3e-25   
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg                114   3e-25   
ref|XP_011006423.1|  PREDICTED: probably inactive leucine-rich re...    114   4e-25   
gb|EEC69970.1|  hypothetical protein OsI_00442                          114   4e-25   
gb|KJB62770.1|  hypothetical protein B456_009G435400                    114   4e-25   
emb|CDP19927.1|  unnamed protein product                                113   4e-25   
gb|EEC81438.1|  hypothetical protein OsI_24717                          113   4e-25   
gb|EAZ38534.1|  hypothetical protein OsJ_22922                          113   4e-25   
gb|KJB11032.1|  hypothetical protein B456_001G237400                    113   4e-25   
ref|XP_008392992.1|  PREDICTED: putative receptor-like protein ki...    113   4e-25   
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg                113   4e-25   
dbj|BAC10827.1|  putative protein kinase Xa21, receptor type prec...    113   5e-25   
ref|XP_011024490.1|  PREDICTED: leucine-rich repeat receptor-like...    113   5e-25   
ref|XP_010910648.1|  PREDICTED: putative receptor-like protein ki...    110   5e-25   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1        113   5e-25   
ref|XP_010441796.1|  PREDICTED: putative receptor-like protein ki...    113   6e-25   
gb|KCW80214.1|  hypothetical protein EUGRSUZ_C01568                     113   6e-25   
ref|XP_010050671.1|  PREDICTED: putative receptor-like protein ki...    113   6e-25   
ref|XP_004309032.2|  PREDICTED: probable LRR receptor-like serine...    113   6e-25   
ref|XP_011027952.1|  PREDICTED: leucine-rich repeat receptor-like...    113   6e-25   
ref|NP_001058786.2|  Os07g0121200                                       113   6e-25   
ref|XP_006368235.1|  hypothetical protein POPTR_0001s00820g             113   7e-25   
ref|XP_008794419.1|  PREDICTED: putative leucine-rich repeat rece...    113   7e-25   
ref|NP_001176608.1|  Os11g0559200                                       113   7e-25   
ref|XP_010533087.1|  PREDICTED: leucine-rich repeat receptor-like...    112   7e-25   
emb|CBI25249.3|  unnamed protein product                                113   7e-25   
gb|KJB73890.1|  hypothetical protein B456_011G259200                    113   7e-25   
ref|XP_004985730.1|  PREDICTED: leucine-rich repeat receptor-like...    113   7e-25   
ref|XP_009343568.1|  PREDICTED: LRR receptor-like serine/threonin...    111   7e-25   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                        112   7e-25   
dbj|BAJ98758.1|  predicted protein                                      113   7e-25   
ref|XP_010934709.1|  PREDICTED: leucine-rich repeat receptor-like...    113   8e-25   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    112   8e-25   
ref|XP_009337767.1|  PREDICTED: probable LRR receptor-like serine...    112   8e-25   
ref|XP_008385914.1|  PREDICTED: probable LRR receptor-like serine...    112   8e-25   



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = +1

Query  37   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  216
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  217  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  396
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  131

Query  397  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  576
             QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+FSGRIPPEYGRFP+LEYL
Sbjct  132  SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFSGRIPPEYGRFPSLEYL  191

Query  577  AVSGNGLSGVIP  612
            AVSGN L G IP
Sbjct  192  AVSGNALVGEIP  203


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNK  366

Query  595  LSGVIP  612
            L+G +P
Sbjct  367  LTGNLP  372


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  592  GLSGVIP  612
             L G IP
Sbjct  390  FLFGPIP  396


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 71/151 (47%), Gaps = 25/151 (17%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  363
             SG + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174  FSGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGN  233

Query  364  LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  519
            LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234  LSQLLRFDAANCGLSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             FSG IPP +    N+  + +  N L G IP
Sbjct  294  MFSGEIPPTFAELKNITLVNLFRNKLYGSIP  324


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  450

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L  +  S N 
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  510

Query  595  LSGVI  609
            LSG I
Sbjct  511  LSGPI  515


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = +1

Query  292  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  471
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  517

Query  472  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            E+ +   L ++ L  N  SG IP E      L YL +S N L G IP
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIP  564


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  592  GLSGVIP  612
              SG IP
Sbjct  486  KFSGRIP  492



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  234
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SLD+SG N
Sbjct  18   AGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSLDISGFN  77

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP QL +L
Sbjct  78   LTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFPSQLTRL  137

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+F GRIPPEYGRFP+LEYLAVSGN 
Sbjct  138  RNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFGGRIPPEYGRFPSLEYLAVSGNA  197

Query  595  LSGVIP  612
            L G IP
Sbjct  198  LVGEIP  203


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNK  366

Query  595  LSGVIP  612
            L+G +P
Sbjct  367  LTGNLP  372


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  592  GLSGVIP  612
             L G IP
Sbjct  390  FLFGPIP  396


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 70/149 (47%), Gaps = 25/149 (17%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------NLS  369
            G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 NLS
Sbjct  176  GRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLS  235

Query  370  --------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF  525
                    N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N F
Sbjct  236  QLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMF  295

Query  526  SGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            SG IPP +    N+  + +  N L G IP
Sbjct  296  SGEIPPTFAELKNITLVNLFRNKLYGSIP  324


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  450

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L  +  S N 
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  510

Query  595  LSGVI  609
            LSG I
Sbjct  511  LSGPI  515


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = +1

Query  292  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  471
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  517

Query  472  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            E+ +   L ++ L  N  SG IP E      L YL +S N L G IP
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIP  564


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  592  GLSGVIP  612
              SG IP
Sbjct  486  KFSGRIP  492



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = +1

Query  37   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  216
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  11   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  70

Query  217  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  396
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  71   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  130

Query  397  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  576
             QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+FSGRIPPEYGRF +LEYL
Sbjct  131  SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFSGRIPPEYGRFSSLEYL  190

Query  577  AVSGNGLSGVIP  612
            AVSGN L G IP
Sbjct  191  AVSGNALVGEIP  202


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  246  LSGKIPREIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  305

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  306  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNK  365

Query  595  LSGVIP  612
            L+G +P
Sbjct  366  LTGNLP  371


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  269  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  328

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  329  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  388

Query  592  GLSGVIP  612
             L G IP
Sbjct  389  FLFGPIP  395


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L G + P++G +  L  L +   N  +G +PP I  +S L   + +N       P ++ +
Sbjct  197  LVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGKIPREIGK  256

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  L L  N+L+G L  E+  + SL+ L L  N FSG IPP +    N+  + +  N
Sbjct  257  LQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRN  316

Query  592  GLSGVIP  612
             L G IP
Sbjct  317  KLYGSIP  323


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  485  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  544

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  545  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVPGT-GQFSYFNYTSFLGN  603


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  390  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  449

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L  +  S N 
Sbjct  450  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  509

Query  595  LSGVI  609
            LSG I
Sbjct  510  LSGPI  514


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = +1

Query  292  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  471
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  457  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  516

Query  472  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            E+ +   L ++ L  N  SG IP E      L YL +S N L G IP
Sbjct  517  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIP  563


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  424

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  425  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  484

Query  592  GLSGVIP  612
              SG IP
Sbjct  485  KFSGRIP  491



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvv  210
            R+S GA  G+   + E  ALLSIKAA T D QS+L SWN STSHCTW  VTCD    HV 
Sbjct  16   RYSTGARPGR---MPEYRALLSIKAAITEDPQSTLASWNASTSHCTWEGVTCDVSGRHVT  72

Query  211  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  390
            +LD+S L+L+G LSPDVG L FLVNLS+AAN LSGPVPP+IS I  LR+LNLSNN+F  +
Sbjct  73   ALDISNLSLTGTLSPDVGHLRFLVNLSVAANSLSGPVPPQISDIPNLRYLNLSNNVFNLS  132

Query  391  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  570
            FP QL +L NLQVLDLYNNN+TGD P + Y +TSLRHLHLGGN+FSG IP E+G FPNLE
Sbjct  133  FPPQLYRLKNLQVLDLYNNNMTGDFPSQAYLLTSLRHLHLGGNFFSGEIPAEFGSFPNLE  192

Query  571  YLAVSGNGLSGVIP  612
            YLAVSGN L+G IP
Sbjct  193  YLAVSGNELTGAIP  206


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G L  L  L +  N L+G + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAEL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N LTG +P  + ++  L+ L L  N F+G IP   G   NL  + VS N 
Sbjct  310  KNMTLLNLFRNKLTGSIPDFIGELPELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGNLP  375


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L+P++G L  L ++ ++ N LSG +PP  + +  +  LNL  N    + P  + +L
Sbjct  274  LTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  +    +L  + +  N  +G +PP       L  L   GN 
Sbjct  334  PELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNKLTGNLPPNLCNGKQLHTLITLGNF  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGPIP  399


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L F++LS N    + P ++  
Sbjct  489  KFSGRIPAEIGKLQQLSKMDFSHNNLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITG  548

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  549  MRILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYNNFSGLVPGT-GQFSYFNYTSFLGN  607


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 62/127 (49%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +  ++G L  L  L I   N  SG +P EI  +S L   + +N       P ++  
Sbjct  201  LTGAIPREIGNLTQLKELYIGYYNTFSGGIPKEIGNLSNLVRFDAANCGLSGEIPAEIGN  260

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  L L  N LTG L  E+  + SL+ + L  N  SG +PP +    N+  L +  N
Sbjct  261  LQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRN  320

Query  592  GLSGVIP  612
             L+G IP
Sbjct  321  KLTGSIP  327


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+    FP      
Sbjct  394  LFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGAFPETDRPS  453

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  + L NN+L+G LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  454  TTLGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNN  513

Query  595  LSGVI  609
            LSG I
Sbjct  514  LSGPI  518


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N LSGP+PP I     ++ L L  N F    P ++ +L  L  +D  +NNL+
Sbjct  456  LGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNNLS  515

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  SG +P E      L YL +S N L G IP
Sbjct  516  GPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGMRILNYLNLSRNHLVGSIP  567


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG +  ++G L  LV    A   LSG +P EI  +  L  L L  N        +L  L
Sbjct  226  FSGGIPKEIGNLSNLVRFDAANCGLSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNL  285

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+ +DL NN L+G+LP    ++ ++  L+L  N  +G IP   G  P L+ L +  N 
Sbjct  286  KSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGELPELQVLQLWENN  345

Query  595  LSGVIP  612
             +G IP
Sbjct  346  FTGSIP  351


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGNLPPNLCNGKQLHTLITLGNFLFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLS  428

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G  P      T+L  + L  N+ SG +PP  G F  ++ L + GN
Sbjct  429  LPKLTQVELQDNLLSGAFPETDRPSTTLGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGN  488

Query  592  GLSGVIP  612
              SG IP
Sbjct  489  KFSGRIP  495


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG  P      +TL  ++LSNN      P  +   
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLSGAFPETDRPSTTLGQISLSNNHLSGPLPPSIGNF  477

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N  +G +P E+ K+  L  +    N  SG I PE  R   L ++ +S N 
Sbjct  478  VGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNNLSGPIAPEISRCKLLTFVDLSRNQ  537

Query  595  LSGVIP  612
            LSG +P
Sbjct  538  LSGSVP  543



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = +1

Query  37   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  216
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  217  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  396
            D+SG NL+G L P+VG L FL NLS+A NQ +GP+P EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPIPVEISFIPNLGYLNLSNNIFGMEFP  131

Query  397  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  576
             QL +L NLQVLDLYNNN+TG+LP+EVY+MT+LRHLHLGGN+F GRIPPEYGRFP+LEYL
Sbjct  132  PQLTRLRNLQVLDLYNNNMTGELPLEVYQMTNLRHLHLGGNFFGGRIPPEYGRFPSLEYL  191

Query  577  AVSGNGLSGVIP  612
            AVSGN L G IP
Sbjct  192  AVSGNALVGEIP  203


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ + +S N 
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIPQGLGTKSKLKNVDLSSNK  366

Query  595  LSGVIP  612
            L+G +P
Sbjct  367  LTGNLP  372


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (54%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VL L+ NN TG +P  +   + L+++ L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKNVDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  592  GLSGVIP  612
             L G IP
Sbjct  390  FLFGPIP  396


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 70/149 (47%), Gaps = 25/149 (17%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------NLS  369
            G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 NLS
Sbjct  176  GRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNITTLQQLYVGYYNTFTGGIPPAIGNLS  235

Query  370  --------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF  525
                    N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N F
Sbjct  236  QLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMF  295

Query  526  SGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            SG IPP +    N+  + +  N L G IP
Sbjct  296  SGEIPPTFAELKNITLVNLFRNKLYGSIP  324


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 61/123 (50%), Gaps = 0/123 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPRLSQVELQNNILTGTFPDISSKS  450

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L  +  S N 
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  510

Query  595  LSG  603
             SG
Sbjct  511  FSG  513


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITG  545

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPSPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 55/107 (51%), Gaps = 0/107 (0%)
 Frame = +1

Query  292  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  471
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NN +G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNFSGPMAP  517

Query  472  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            E+ +   L ++ L  N  SG IP E      L YL +S N L G IP
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPSEITGMRILNYLNLSRNHLVGSIP  564


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPRLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485

Query  592  GLSGVIP  612
              SG IP
Sbjct  486  KFSGRIP  492



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 142/179 (79%), Gaps = 1/179 (1%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSP  255
            E  ALLSIK+A TAD QSSL SWN ST+HC+W  VTCDS    V+      LNL+G LSP
Sbjct  26   EYKALLSIKSAITADPQSSLASWNDSTTHCSWSGVTCDSYGRHVTALDISGLNLTGSLSP  85

Query  256  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  435
            DV  L  L+NLS+AANQ  GPVPPEIS+ISTLR+LNLSNNIF  TFP QL +L NL+VLD
Sbjct  86   DVSHLRLLLNLSVAANQFCGPVPPEISSISTLRYLNLSNNIFNLTFPRQLIRLKNLEVLD  145

Query  436  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             YNNN++G LPV+VY++T+LRHLHLGGNYFSG IP EYG FPNLEYLAVSGN L+G IP
Sbjct  146  FYNNNMSGPLPVDVYQLTNLRHLHLGGNYFSGGIPAEYGSFPNLEYLAVSGNELAGRIP  204


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N LSGP+  E+  + +L+ ++LSNN+F    P   AQL
Sbjct  248  LSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNNFTGSIPQGLGTNGKLQNLDLSSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGNLP  373


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +    +  N+ +GP+P EI  +  L  ++ S+N F      ++++ 
Sbjct  464  LSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISEC  523

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  524  KLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIASMQSLTSVDFSYNN  583

Query  595  LSGVIP  612
            LSG++P
Sbjct  584  LSGMVP  589


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG + P +G L  L+    A   LSG VPPE+  +  L  L L  N        +L  L
Sbjct  224  FSGGIPPQIGNLSQLLRFDAANCGLSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYL  283

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  284  KSLKSMDLSNNMFTGEIPSSFAQLKNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNN  343

Query  595  LSGVIP  612
             +G IP
Sbjct  344  FTGSIP  349


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     QL  L  L++  NQL G +P  I  +  L  L L +N F  + P  L   
Sbjct  296  FTGEIPSSFAQLKNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNNFTGSIPQGLGTN  355

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ LDL +N LTG+LP  +     L+ L   GN+  G IP   G+  +L  L +  N 
Sbjct  356  GKLQNLDLSSNKLTGNLPPNICTGNKLQTLITLGNFLFGTIPESLGQCESLSRLRMGENY  415

Query  595  LSGVIP  612
            L+G IP
Sbjct  416  LNGSIP  421


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  L +  N L+G +P  + ++  L  + L +N+   +FP      
Sbjct  392  LFGTIPESLGQCESLSRLRMGENYLNGSIPKGLLSLPQLTQVELQDNLLTGSFPETDKTS  451

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  + L NN L+G LP  +     ++   L GN F+G IP E G+   L  +  S N 
Sbjct  452  TALGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNS  511

Query  595  LSGVI  609
             SG I
Sbjct  512  FSGPI  516


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSGP+PP I     ++   L  N F    P ++ +L  L  +D  +N+ +
Sbjct  454  LGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFS  513

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  +G IP E      L YL +S N L G IP
Sbjct  514  GPIAPEISECKLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIP  565


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P      + L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPQLTQVELQDNLLTGSFPETDKTSTALGQISLSNNRLSGPLPPSIGNF  475

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q   L  N  TG +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  476  VGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISECKLLTFVDLSRNQ  535

Query  595  LSGVIP  612
            L+G IP
Sbjct  536  LAGEIP  541


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  L +  N    + P  L  
Sbjct  367  KLTGNLPPNICTGNKLQTLITLGNFLFGTIPESLGQCESLSRLRMGENYLNGSIPKGLLS  426

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG  P      T+L  + L  N  SG +PP  G F  ++   + GN
Sbjct  427  LPQLTQVELQDNLLTGSFPETDKTSTALGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGN  486

Query  592  GLSGVIP  612
              +G IP
Sbjct  487  KFTGPIP  493


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SG ++P++ +   L  + ++ NQL+G +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  SFSGPIAPEISECKLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIAS  570

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGMVP  589



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +1

Query  49   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  228
            + A KP  + E  ALLS+K A T D QS+L SWNISTSHCTW+ VTCD   HV SL++S 
Sbjct  19   SAAAKPHFLPEYRALLSLKTAITDDPQSALISWNISTSHCTWKGVTCDKYRHVTSLNISN  78

Query  229  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
            LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP QL 
Sbjct  79   LNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSLISNLRYLNLSNNIFNLSFPQQLT  138

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            QL NL+VLD+YNNNLTG+L V V+ +T+L HLHLGGN+F+GRIPPE+G+FP L+YLAVSG
Sbjct  139  QLINLEVLDIYNNNLTGELAVGVHNLTNLYHLHLGGNFFTGRIPPEFGKFPFLKYLAVSG  198

Query  589  NGLSGVIP  612
            N L+G IP
Sbjct  199  NELAGDIP  206


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  177  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  236

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  237  LSELVRFDAANCGLSGNIPSEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNN  296

Query  592  GLSGVIP  612
             LSG IP
Sbjct  297  LLSGEIP  303


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +L
Sbjct  274  LSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQEL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP   R  NLE L   GN 
Sbjct  334  PKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGNF  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGPIP  399


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  250  LSGNIPSEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  310  KNLTLLNLFRNKLYGSIPEFIQELPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGNLP  375


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  394  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  453

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP E G+   L  +  SGNG
Sbjct  454  ASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNG  513

Query  595  LSGVIP  612
             SG IP
Sbjct  514  FSGPIP  519


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N+ SG +P EI  +  L  ++ S N F    P +++  
Sbjct  466  LTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNC  525

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L++  N+  G IP       +L  +  S N 
Sbjct  526  KALTFIDLSRNKLSGEIPTEITGMRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNN  585

Query  595  LSGVIP  612
            LSG++P
Sbjct  586  LSGLVP  591


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPSSIGSF  477

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE      L ++ +S N 
Sbjct  478  SGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNCKALTFIDLSRNK  537

Query  595  LSGVIP  612
            LSG IP
Sbjct  538  LSGEIP  543


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 68/127 (54%), Gaps = 2/127 (2%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N++ GS  P ++  
Sbjct  226  FSGGIPPEIGNLSELVRFDAANCGLSGNIPSEIGKLKKLDTLFLQVNSLSGSLIP-EIGY  284

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ LDL NN L+G++P+ + ++ +L  L+L  N   G IP      P LE L +  N
Sbjct  285  LKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQELPKLEVLQLWEN  344

Query  592  GLSGVIP  612
              +G IP
Sbjct  345  NFTGSIP  351


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  428

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG  PV      SL  + L  N  +GR+P   G F  ++ L + GN
Sbjct  429  LPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGN  488

Query  592  GLSGVIP  612
              SG IP
Sbjct  489  KFSGRIP  495



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = +1

Query  61   KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  240
            KP  V E  ALLS+K + T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTSITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  L +LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPIELSFIPNLSYLNLSNNIFNLSFPPQLTHLRY  143

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L+VLD+YNNN+TGDLPV VY +T+LRHLHLGGN+FSG IPPEYGRFP LEYLAVSGN L 
Sbjct  144  LKVLDIYNNNMTGDLPVGVYNLTNLRHLHLGGNFFSGSIPPEYGRFPFLEYLAVSGNALV  203

Query  601  GVIP  612
            G+IP
Sbjct  204  GMIP  207


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTEL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L  + +S N 
Sbjct  311  KNLTLLNLFRNKLYGSIPEFIEDLPKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGNLP  376


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  L
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDL  334

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + K + L ++ +  N  +G +PP       L+ L   GN 
Sbjct  335  PKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNF  394

Query  595  LSGVIP  612
            L G IP
Sbjct  395  LFGPIP  400


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S  S+L  + LSNN F    P  +   
Sbjct  419  LNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSIGNF  478

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE  R   L Y+ +S N 
Sbjct  479  TGVQKLLLDGNKFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNK  538

Query  595  LSGVIP  612
            LSG +P
Sbjct  539  LSGEVP  544


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVS  454

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L  + L NN  TG LP  +   T ++ L L GN FSG+IP E G+   L  +  SGN 
Sbjct  455  SSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGNKFSGQIPAELGKLQQLSKMDFSGNS  514

Query  595  LSGVIP  612
             SG+IP
Sbjct  515  FSGLIP  520


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG L  ++G L  L+ L  A   LSG +PPEI  +  L  L L  N    +   +L  L
Sbjct  227  FSGGLPAEIGNLSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNL  286

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+ LDL NN L+G++P    ++ +L  L+L  N   G IP      P LE L +  N 
Sbjct  287  KSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDLPKLEVLQLWENN  346

Query  595  LSGVIP  612
             +G IP
Sbjct  347  FTGSIP  352


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L++  N L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFIGN  608


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFS  429

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG  PV     +SL  + L  N F+G +P   G F  ++ L + GN
Sbjct  430  LPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGN  489

Query  592  GLSGVIP  612
              SG IP
Sbjct  490  KFSGQIP  496



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +1

Query  49   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldls  225
            + A +P  ++E  ALLSIKAA T D QS+L SWN++T+HCTW+ +TCD S  HV SLD+S
Sbjct  16   SAAARPPRMSEYRALLSIKAAITDDPQSALASWNLTTNHCTWKGITCDPSRRHVTSLDIS  75

Query  226  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  405
             L+L+G LSPDVGQL FLVNLS+AAN +SGPVPP+IS I  LR+LNLSNN+F  +FP +L
Sbjct  76   NLSLTGTLSPDVGQLRFLVNLSVAANFISGPVPPQISDIPNLRYLNLSNNVFNLSFPPEL  135

Query  406  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  585
             +L NLQVLDLYNNN+TGD P + Y + +LRHLHLGGN+FSG IPPE+G FP LEYLAVS
Sbjct  136  YRLRNLQVLDLYNNNMTGDFPSKAYLLANLRHLHLGGNFFSGEIPPEFGSFPYLEYLAVS  195

Query  586  GNGLSGVIP  612
            GN L+G IP
Sbjct  196  GNELTGAIP  204


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+F    P   A+L
Sbjct  248  LTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAEL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N LTG +P  + ++  L  L L  N F+G IP   G   NL+ + VS N 
Sbjct  308  KNMTLLNLFRNKLTGSIPDFIGELPELEVLQLWENNFTGIIPQSLGTNGNLQEVDVSSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGNLP  373


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 72/151 (48%), Gaps = 25/151 (17%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ G  P+L  L+++ N+L+G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  175  FSGEIPPEFGSFPYLEYLAVSGNELTGAIPPEIGNLTQLKELYIGYYNAFTGGMPKEIGN  234

Query  412  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  519
            L+ L  LD  N  LTG++P E+  +                         SL+ + L  N
Sbjct  235  LSQLVRLDAANCGLTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNN  294

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             FSG IPP +    N+  L +  N L+G IP
Sbjct  295  MFSGEIPPSFAELKNMTLLNLFRNKLTGSIP  325


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N  SG +PP  + +  +  LNL  N    + P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  +    +L+ + +  N  +G +PP       L  L   GN 
Sbjct  332  PELEVLQLWENNFTGIIPQSLGTNGNLQEVDVSSNKLTGNLPPNLCNGNQLRTLITLGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGPIP  397


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L+G L P +G    +  L +  N+ SG +P EI  +  L  ++ S+N        +++Q
Sbjct  463  HLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNELTGLIAPEISQ  522

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  523  CKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYN  582

Query  592  GLSGVIP  612
             LSG++P
Sbjct  583  NLSGLVP  589


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP      
Sbjct  392  LFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGTFPETDGLS  451

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L +N+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  452  TSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNE  511

Query  595  LSGVI  609
            L+G+I
Sbjct  512  LTGLI  516


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG      G    L  +S++ N L+GP+PP I     ++ L L  N F    P ++ +L
Sbjct  440  LSGTFPETDGLSTSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKL  499

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N LTG +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  500  QQLSKMDFSHNELTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNH  559

Query  595  LSGVIP  612
            L G IP
Sbjct  560  LVGSIP  565


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGNLPPNLCNGNQLRTLITLGNFLFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLS  426

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G  P      TSL  + L  N+ +G +PP  G F  ++ L + GN
Sbjct  427  LPKLTQVELQDNLLSGTFPETDGLSTSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGN  486

Query  592  GLSGVIP  612
              SG IP
Sbjct  487  KFSGRIP  493



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  61   KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  240
            KP  V E  ALLS+K A T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTAITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  LR+LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPVELSFIPNLRYLNLSNNIFNLSFPPQLTHLRY  143

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L VLD+YNNN+TG+LPV  Y +T+LRHLHLGGN+FSG IPPEYGRFP LEYLAVSGN L 
Sbjct  144  LNVLDIYNNNMTGELPVGFYNLTNLRHLHLGGNFFSGSIPPEYGRFPFLEYLAVSGNALV  203

Query  601  GVIP  612
            G IP
Sbjct  204  GRIP  207


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGRIPPEIGNITTLRELYIGYYNTFSGGLPAEIGY  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  238  LSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNN  297

Query  592  GLSGVIP  612
             LSG IP
Sbjct  298  MLSGEIP  304


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTEL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G+   L  + +S N 
Sbjct  311  KNLTLLNLFRNKLYGSMPEFIEDMPKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGNLP  376


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  +
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTELKNLTLLNLFRNKLYGSMPEFIEDM  334

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + K + L ++ +  N  +G +PP       L+ L   GN 
Sbjct  335  PKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNF  394

Query  595  LSGVIP  612
            L G IP
Sbjct  395  LFGPIP  400


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVS  454

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A+L  + L NN  TG LP  +   T+++ L L GN FSG+IP E G+   L  +  SGN 
Sbjct  455  ASLGQICLSNNRFTGPLPSSIGNFTAVQKLLLDGNKFSGQIPGELGKLQQLSKMDFSGNS  514

Query  595  LSGVIP  612
             SG+IP
Sbjct  515  FSGLIP  520


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S  ++L  + LSNN F    P  +   
Sbjct  419  LNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSNNRFTGPLPSSIGNF  478

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE  R   L Y+ +S N 
Sbjct  479  TAVQKLLLDGNKFSGQIPGELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNK  538

Query  595  LSGVIP  612
            LSG +P
Sbjct  539  LSGEVP  544


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPGELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L++  N L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFIGN  608


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLS  429

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG  PV      SL  + L  N F+G +P   G F  ++ L + GN
Sbjct  430  LPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSNNRFTGPLPSSIGNFTAVQKLLLDGN  489

Query  592  GLSGVIP  612
              SG IP
Sbjct  490  KFSGQIP  496



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  234
            AGKP+ ++E  ALLS+K A + D Q  L +WN STSHCTW  V+CDSL  VVSLDLS +N
Sbjct  23   AGKPVRISENRALLSLKTAISDDPQGFLQNWNFSTSHCTWTGVSCDSLNRVVSLDLSNMN  82

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG+LSPDVGQL  LVNL++AAN + GP+PP IS IS LR LNLSNN+F  TFP QL++L
Sbjct  83   ISGILSPDVGQLRNLVNLTVAANLIYGPIPPGISYISGLRLLNLSNNVFNGTFPSQLSRL  142

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VLDLYNNN+TGDLPVEV  M +LRHLH GGN+FSGRIPPEYGR+  LEY+A+SGN 
Sbjct  143  KYLEVLDLYNNNMTGDLPVEVSDMPNLRHLHFGGNFFSGRIPPEYGRWEFLEYMALSGNE  202

Query  595  LSGVIP  612
            L+G IP
Sbjct  203  LTGPIP  208


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+    FP   ++L
Sbjct  252  LSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L++L +S N 
Sbjct  312  KNLTLLNLFRNKLHGAIPDFIGDLPELEVLQLWENNFTGSIPQGLGKNGRLQFLDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGNLP  377


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++GQL  L ++ ++ N LSG  P   S +  L  LNL  N      P  +  L
Sbjct  276  LSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDL  335

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  336  PELEVLQLWENNFTGSIPQGLGKNGRLQFLDLSSNKLTGNLPPDLCFGNRLQTLIALGNF  395

Query  595  LSGVIP  612
            L G IP
Sbjct  396  LFGPIP  401


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 70/151 (46%), Gaps = 25/151 (17%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  354
             SG + P+ G+  FL  ++++ N+L+GP+PP I  ++ L+                    
Sbjct  179  FSGRIPPEYGRWEFLEYMALSGNELTGPIPPTIGNLTKLQQLYLGYYNTYESGIPAEMGN  238

Query  355  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  519
                  L+++N       PH+L +L  L  L L  N L+G+L  E+ ++ SL+ + L  N
Sbjct  239  LTELVRLDMANCGLSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNN  298

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              SG  P  +    NL  L +  N L G IP
Sbjct  299  MLSGEFPETFSELKNLTLLNLFRNKLHGAIP  329


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP LV + +  N L G  P   S    L  ++LSNN    + P  +   
Sbjct  420  LNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVAENLGQISLSNNQLMGSLPRSIGNF  479

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P E+ ++  L  +    N FSG I PE  +   L ++ +S N 
Sbjct  480  SGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNRFSGSIAPEISQCKLLTFVDLSRNE  539

Query  595  LSGVIP  612
            LSG IP
Sbjct  540  LSGEIP  545


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ NQL G +P  I   S ++ L L  N F  + P ++ +L  L  +D  NN  +
Sbjct  458  LGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNRFS  517

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  SG IPPE      L YL +S N L G IP
Sbjct  518  GSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHLVGSIP  569


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  396  LFGPIPESLGRCESLSRIRMGENFLNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVA  455

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L G LP  +   + ++ L L GN+FSG IP E GR   L  +  S N 
Sbjct  456  ENLGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNR  515

Query  595  LSGVI  609
             SG I
Sbjct  516  FSGSI  520


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG ++P++ Q   L  + ++ N+LSG +PPEI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHLVGSIPASISTM  575

Query  415  ANLQVLDLYNNNLTGDLP  468
             +L  +D   NNL+G +P
Sbjct  576  QSLTSVDFSYNNLSGLVP  593



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  234
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW+ VTCD   HV SLD+SG N
Sbjct  20   AGKQPRIPEYQALLALKTAITDDPQLALASWNISTSHCTWKGVTCDRYRHVTSLDISGFN  79

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G L P+VG L FL NLS+  NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  80   VTGTLPPEVGNLRFLQNLSVDLNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  139

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VLDLYNNN+TGDLPV+VY+MT+LRHLHLGGN+F GRIPPEYGRF  LEYLAVSGN 
Sbjct  140  RNLKVLDLYNNNMTGDLPVDVYQMTNLRHLHLGGNFFGGRIPPEYGRFQFLEYLAVSGNE  199

Query  595  LSGVIP  612
            L G IP
Sbjct  200  LVGEIP  205


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  272  SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  331

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP      NL+ +   GN
Sbjct  332  LPELEVLQLWENNFTGSIPQGLGTNSKLKNLDLSSNKLTGNLPPNMCAGKNLQTIITLGN  391

Query  592  GLSGVIP  612
             L G IP
Sbjct  392  FLFGPIP  398


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 70/125 (56%), Gaps = 1/125 (1%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLA  417
            G + P+ G+  FL  L+++ N+L G +PPEI  I+TL  L +   N F    P ++  L+
Sbjct  178  GRIPPEYGRFQFLEYLAVSGNELVGEIPPEIGNITTLHELYVGYYNTFSGGIPPEIGNLS  237

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L   D  N  L+G++P E+ K+ +L  L L  N  SG + PE G   +L+ L +S N L
Sbjct  238  QLVRFDAANCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNML  297

Query  598  SGVIP  612
            SG +P
Sbjct  298  SGEVP  302


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  249  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENNFTGSIPQGLGTNSKLKNLDLSSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGNLP  374


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  393  LFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLSLPQLSQVELQNNLLTGTFPETKSIS  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  453  TSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHND  512

Query  595  LSGVI  609
             SG I
Sbjct  513  FSGPI  517


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG + P++G L  LV    A   LSG +P E+  +  L  L L  N    +   ++  L
Sbjct  225  FSGGIPPEIGNLSQLVRFDAANCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTL  284

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+ LDL NN L+G++P     + +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  285  KSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENN  344

Query  595  LSGVIP  612
             +G IP
Sbjct  345  FTGSIP  350


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  488  KFSGRIPAEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  547

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  548  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVPGT-GQFSYFNYTSFLGN  606


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN    + P  +   
Sbjct  417  LNGSIPKRLLSLPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGSLPTSIGNF  476

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A +Q L L  N  +G +P E+ K+  L  +    N FSG I PE  +   L Y+ +S N 
Sbjct  477  AGVQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQ  536

Query  595  LSGVIP  612
            LSG IP
Sbjct  537  LSGEIP  542


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P +L  
Sbjct  368  KLTGNLPPNMCAGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLS  427

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L NN LTG  P      TSL  + L  N+ +G +P   G F  ++ L + GN
Sbjct  428  LPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGN  487

Query  592  GLSGVIP  612
              SG IP
Sbjct  488  KFSGRIP  494



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  234
            AG+PL + E  ALLSIK A + D Q+SL +WN+STSHCTW  V+CDS   VVSLDLS +N
Sbjct  20   AGRPLRIPEYRALLSIKTAISDDPQASLPNWNLSTSHCTWTGVSCDSFNRVVSLDLSNMN  79

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG+LSPDVGQL  L+NL+ AAN  SGP+P EIS IS LR LNLSNN+F  +FP + ++L
Sbjct  80   LSGILSPDVGQLRNLINLTAAANFFSGPIPSEISHISGLRLLNLSNNVFNGSFPSEFSRL  139

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VLDLYNNN+TGDLPV+V +M +LRHLHLGGN+FSGRIP EYGR+  LEYLA+SGN 
Sbjct  140  KLLEVLDLYNNNMTGDLPVDVSEMPNLRHLHLGGNFFSGRIPSEYGRWEFLEYLALSGNE  199

Query  595  LSGVIP  612
            L G IP
Sbjct  200  LGGTIP  205


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L  DV ++P L +L +  N  SG +P E      L +L LS N  G T P ++  
Sbjct  151  NMTGDLPVDVSEMPNLRHLHLGGNFFSGRIPSEYGRWEFLEYLALSGNELGGTIPPEIGN  210

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  LQ L L Y N+  G +P E+  +T L  L +     SG IPPE+ +   L+ L +  
Sbjct  211  LTKLQQLYLGYYNSYEGGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQV  270

Query  589  NGLSG  603
            NGLSG
Sbjct  271  NGLSG  275


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P+  +L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   ++L
Sbjct  249  LSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSEL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPDFIGDLPALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGNLP  374


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++GQL  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  273  LSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDL  332

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L  L   GN 
Sbjct  333  PALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNKLTGNLPPDLCFGNRLHTLIALGNF  392

Query  595  LSGVIP  612
            L G IP
Sbjct  393  LFGPIP  398


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P++G L  LV L +A   LSG +PPE S +  L  L L  N        +L QL 
Sbjct  226  EGGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLK  285

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  286  SLKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDLPALEVLQLWENNF  345

Query  598  SGVIP  612
            +G IP
Sbjct  346  TGSIP  350


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 63/122 (52%), Gaps = 6/122 (5%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            ++ D+GQ+      S++ NQL+G +P  I   S ++ L L  N F  + P ++ +L  L 
Sbjct  451  IAEDLGQI------SLSNNQLTGSLPRSIGNFSGVQKLLLDGNFFFGSIPAEIGRLQQLS  504

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +D  NN  +G +  E+ +   L  + L  N  SG IPPE      L YL +S N L+G 
Sbjct  505  KMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGS  564

Query  607  IP  612
            IP
Sbjct  565  IP  566


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGRCKSLSRIRMGENFLNGTIPKGLFSLPNLAQVELQDNYLVGGFPQTDSIA  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN LTG LP  +   + ++ L L GN+F G IP E GR   L  +  S N 
Sbjct  453  EDLGQISLSNNQLTGSLPRSIGNFSGVQKLLLDGNFFFGSIPAEIGRLQQLSKMDFSNNR  512

Query  595  LSGVI  609
             SG I
Sbjct  513  FSGPI  517


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G +  ++G+L  L  +  + N+ SGP+  EIS    L F++LS N      P ++  +  
Sbjct  491  GSIPAEIGRLQQLSKMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRI  550

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
            L  L+L  N+LTG +P  +  M SL  +    N  SG +P
Sbjct  551  LNYLNLSRNHLTGSIPASIATMQSLTSVDFSYNNLSGLVP  590


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L G  P   S    L  ++LSNN    + P  +   
Sbjct  417  LNGTIPKGLFSLPNLAQVELQDNYLVGGFPQTDSIAEDLGQISLSNNQLTGSLPRSIGNF  476

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N   G +P E+ ++  L  +    N FSG I  E  +   L ++ +S N 
Sbjct  477  SGVQKLLLDGNFFFGSIPAEIGRLQQLSKMDFSNNRFSGPIASEISQCKLLTFVDLSRNE  536

Query  595  LSGVIP  612
            LSGVIP
Sbjct  537  LSGVIP  542


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG ++ ++ Q   L  + ++ N+LSG +PPE++ +  L +LNLS N    + P  +A +
Sbjct  513  FSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGSIPASIATM  572

Query  415  ANLQVLDLYNNNLTGDLP  468
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  49   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl  222
            + A KP  + E  ALLS+K A + D QS+L SWN ST  SHCTW+ VTCD   HV SL++
Sbjct  15   SAAAKPHFLPEYRALLSLKTAISDDPQSALISWNSSTTTSHCTWKGVTCDKYRHVTSLNI  74

Query  223  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  402
            S LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP Q
Sbjct  75   SNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSVISNLRYLNLSNNIFNLSFPQQ  134

Query  403  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  582
            L QL NL+VLD+YNNNLTG LPV V+ +T+L HLHLGGN+F+GRIPPE+G+FP L+YLAV
Sbjct  135  LTQLINLEVLDIYNNNLTGQLPVGVHNLTNLYHLHLGGNFFTGRIPPEFGKFPFLKYLAV  194

Query  583  SGNGLSGVIP  612
            SGN L+G IP
Sbjct  195  SGNELAGDIP  204


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  175  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  234

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  235  LSELVRFDAANCGLSGEIPAEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNN  294

Query  592  GLSGVIP  612
             LSG IP
Sbjct  295  LLSGEIP  301


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +L
Sbjct  272  LSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEEL  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP   R  NLE L   GN 
Sbjct  332  PKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGPIP  397


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  248  LSGEIPAEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLYGSIPEFIEELPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGNLP  373


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  451

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP E G+   L  +  SGNG
Sbjct  452  ASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNG  511

Query  595  LSGVIP  612
             SG IP
Sbjct  512  FSGPIP  517


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 68/127 (54%), Gaps = 2/127 (2%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N++ GS  P ++  
Sbjct  224  FSGGIPPEIGNLSELVRFDAANCGLSGEIPAEIGKLKKLDTLFLQVNSLSGSLIP-EIGY  282

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ LDL NN L+G++P+ + ++ +L  L+L  N   G IP      P LE L +  N
Sbjct  283  LKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEELPKLEVLQLWEN  342

Query  592  GLSGVIP  612
              +G IP
Sbjct  343  NFTGSIP  349


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  
Sbjct  487  KFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISHCKALTFVDLSRNKLSGEIPTEITG  546

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  547  MRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPPSIGNF  475

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE      L ++ +S N 
Sbjct  476  SGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISHCKALTFVDLSRNK  535

Query  595  LSGVIP  612
            LSG IP
Sbjct  536  LSGEIP  541


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  426

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG  PV      SL  + L  N  +GR+PP  G F  ++ L + GN
Sbjct  427  LPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGN  486

Query  592  GLSGVIP  612
              SG IP
Sbjct  487  KFSGRIP  493



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 142/186 (76%), Gaps = 0/186 (0%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  234
            AGK   + E  ALL++K A   D Q +L SWN STSHCTW+ VTCD   HV SLD+SG N
Sbjct  19   AGKHPRIPEYQALLALKTAIIDDPQLALASWNNSTSHCTWKGVTCDRYRHVTSLDISGFN  78

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G L P+VG   FL NLS+A NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  79   VTGTLPPEVGNFRFLQNLSVALNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  138

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VLDLYNNN+TGDLPV+VY+MT+LRHLHLGGN+F GRIPPEYGRF  LEYLAVSGN 
Sbjct  139  RNLKVLDLYNNNMTGDLPVDVYQMTNLRHLHLGGNFFGGRIPPEYGRFQFLEYLAVSGNE  198

Query  595  LSGVIP  612
            L GVIP
Sbjct  199  LVGVIP  204


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  271  SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  330

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP      NL+ +   GN
Sbjct  331  LPELEVLQLWENNFTGSIPHGLGTNSKLKNLDLSSNKLTGSLPPNMCAGKNLQTIITLGN  390

Query  592  GLSGVIP  612
             L G IP
Sbjct  391  FLFGPIP  397


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 70/125 (56%), Gaps = 1/125 (1%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLA  417
            G + P+ G+  FL  L+++ N+L G +PPEI  I+TL  L +   N F    P ++  L+
Sbjct  177  GRIPPEYGRFQFLEYLAVSGNELVGVIPPEIGNITTLHELYVGYYNTFSGGIPPEIGNLS  236

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L   D  N  L+G++P E+ K+ +L  L L  N  SG + PE G   +L+ L +S N L
Sbjct  237  QLVRFDAANCGLSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNML  296

Query  598  SGVIP  612
            SG +P
Sbjct  297  SGEVP  301


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++ +L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  248  LSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENNFTGSIPHGLGTNSKLKNLDLSSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGSLP  373


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSIS  451

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  452  TSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGNKFSGRIPVEIGKLQQLSKIDFSHND  511

Query  595  LSGVI  609
             SG I
Sbjct  512  FSGPI  516


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N    +   ++  L
Sbjct  224  FSGGIPPEIGNLSQLVRFDAANCGLSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTL  283

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+ LDL NN L+G++P     + +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  284  KSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENN  343

Query  595  LSGVIP  612
             +G IP
Sbjct  344  FTGSIP  349


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  487  KFSGRIPVEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  546

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  547  MRILNYLNLSRNHLVGSIPTPISSMQSLTSVDFSYNNFSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGPLPTSIGNF  475

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A +Q L L  N  +G +PVE+ K+  L  +    N FSG I PE  +   L Y+ +S N 
Sbjct  476  AGVQKLLLDGNKFSGRIPVEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQ  535

Query  595  LSGVIP  612
            LSG IP
Sbjct  536  LSGEIP  541


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGSLPPNMCAGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  426

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L NN LTG  P      TSL  + L  N+ +G +P   G F  ++ L + GN
Sbjct  427  LPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGN  486

Query  592  GLSGVIP  612
              SG IP
Sbjct  487  KFSGRIP  493



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 146/191 (76%), Gaps = 1/191 (1%)
 Frame = +1

Query  43   AGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsld  219
             G+ A  P  + E  ALLSIKAA T D QS+L SWN +T HCTWR VTCD+    V SLD
Sbjct  16   GGSAAATPPHMPEYRALLSIKAAITDDPQSALASWNATTHHCTWRGVTCDASGRRVASLD  75

Query  220  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  399
            +S L+L+GVLSPDVG+L FLVN S AAN LSGP+PP+IS I  LR LNLSNN+F  +FP 
Sbjct  76   ISNLSLAGVLSPDVGRLRFLVNFSAAANFLSGPIPPQISDIPNLRHLNLSNNVFNLSFPA  135

Query  400  QLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  579
            +L  L NL+VLD+YNNN+TGD P + Y +T+LRHLHLGGN+F+G  PPE+G FP+LEYLA
Sbjct  136  ELYHLKNLEVLDVYNNNMTGDFPSQAYLLTNLRHLHLGGNFFTGVFPPEFGSFPHLEYLA  195

Query  580  VSGNGLSGVIP  612
            VSGN L+G IP
Sbjct  196  VSGNELTGAIP  206


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G L  L  L +  N +SG +PPE+  + +L+ ++LSNNI     P   +QL
Sbjct  250  LSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N  TG +P  +  +  L+ L L  N F+G IP   G   NLE + +S N 
Sbjct  310  QNITLLNLFRNKFTGSIPDFIGDLPELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGNLP  375


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +GV  P+ G  P L  L+++ N+L+G +PP+I  ++ L+ L +   N F    P ++  
Sbjct  177  FTGVFPPEFGSFPHLEYLAVSGNELTGAIPPQIGNLTHLKELYIGYFNTFTGGIPKEIGN  236

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+NL   D  N  L+G +P E+  + +L  L L  N  SG +PPE G   +L+ + +S N
Sbjct  237  LSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNN  296

Query  592  GLSGVIP  612
             LSG IP
Sbjct  297  ILSGEIP  303


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG L P++G L  L ++ ++ N LSG +PP  S +  +  LNL  N F  + P  +  L
Sbjct  274  ISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  +    +L  + L  N  +G +PP       L  L   GN 
Sbjct  334  PELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNKLTGNLPPNLCNGNQLNTLITLGNF  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGPIP  399


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +  ++G L  L+    A   LSG +P EI  +  L  L L  N      P +L  L
Sbjct  226  FTGGIPKEIGNLSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNL  285

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+ +DL NN L+G++P    ++ ++  L+L  N F+G IP   G  P L+ L +  N 
Sbjct  286  KSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDLPELQVLQLWENN  345

Query  595  LSGVIP  612
             +G+IP
Sbjct  346  FTGIIP  351


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   +  LP L  + +  N LSG  P     +ST L  ++LSNN      P  +  
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLSGEFPNTDGILSTTLGQISLSNNHLAGRLPPSIGN  477

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             A +Q L L  N  +G++P E+ K+  L  +    N FSG+I PE  R   L ++ +S N
Sbjct  478  FAAVQKLLLDGNKFSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHN  537

Query  592  GLSGVIP  612
             LSG IP
Sbjct  538  RLSGPIP  544


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG +  ++G+L  L  +  + N  SG + PEIS    L F++LS+N      P ++  +
Sbjct  491  FSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSM  550

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L  L+L  NNL G++P  +  M SL  +    N FSG +P   G+F      +  GN
Sbjct  551  KILNYLNLSRNNLMGNIPSSISGMQSLTSVDFSYNNFSGLVPAT-GQFSYFNRTSFLGN  608


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SG +SP++ +   L  + ++ N+LSGP+P EI+++  L +LNLS N      P  ++ 
Sbjct  514  DFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSMKILNYLNLSRNNLMGNIPSSISG  573

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L  +D   NN +G +P
Sbjct  574  MQSLTSVDFSYNNFSGLVP  592



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            V+E  ALLSIK+A +ADSQ++L+SWN +TSHCTW  VTCDS  HV SLDL  LNLSG LS
Sbjct  21   VSEYRALLSIKSALSADSQAALSSWNATTSHCTWTGVTCDSRHHVTSLDLRDLNLSGTLS  80

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             DV  L FL NL++AANQ SGP+PPEIS +S LRFLNLSNN+F  +FP QLA+LANL+V+
Sbjct  81   SDVAHLQFLRNLTVAANQFSGPIPPEISQLSALRFLNLSNNVFNGSFPSQLARLANLEVM  140

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+T +LPV V ++ +L HLHLGGN+FSG IP EYG +  LEYLAVSGN L G IP
Sbjct  141  DLYNNNMTDELPVGVTQLRNLHHLHLGGNFFSGEIPAEYGGWEFLEYLAVSGNELVGKIP  200


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+F    P   A+L
Sbjct  244  LSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAEL  303

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  304  KNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNK  363

Query  595  LSGVIP  612
            L+G +P
Sbjct  364  LTGTLP  369


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G L P++G L  LV L  A   LSG +P EI  +  L  L L  N    T   +L  L 
Sbjct  221  TGGLPPEIGNLSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLK  280

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN  TG++P    ++ ++  L+L  N   G IP   G  P LE L +  N  
Sbjct  281  SLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNF  340

Query  598  SGVIP  612
            +G IP
Sbjct  341  TGSIP  345


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  +  LNL  N      P  + +L
Sbjct  268  LSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGEL  327

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  328  PKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNKLTGTLPPDMCSGNRLETLITLGNF  387

Query  595  LSGVIP  612
            L G IP
Sbjct  388  LFGPIP  393


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG +  + G   FL  L+++ N+L G +PPEI  ++TLR L +   N +    P ++  
Sbjct  171  FSGEIPAEYGGWEFLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNTYTGGLPPEIGN  230

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L++L  LD  N  L+G++P E+ K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  231  LSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNN  290

Query  592  GLSGVIP  612
              +G IP
Sbjct  291  MFTGEIP  297


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    +  L +  N+ SG +PPE+ ++  L  +  S+N F      ++++ 
Sbjct  460  LSGSLPASIGNFSGVQKLLLDGNKFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISKC  519

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  520  KLLTFVDLSRNELSGVVPNEITGMKILNYLNLSRNHLVGSIPAAIASMQSLTSVDFSYNN  579

Query  595  LSGVIP  612
            LSG++P
Sbjct  580  LSGLVP  585


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  363  KLTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  422

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+ PV      SL  + L  N  SG +P   G F  ++ L + GN
Sbjct  423  LPKLTQVELQDNYLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGN  482

Query  592  GLSGVIP  612
              SG IP
Sbjct  483  KFSGQIP  489


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S   +L  + LSNN    + P  +   
Sbjct  412  LNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNF  471

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P EV  +  L  +    N FSG+I PE  +   L ++ +S N 
Sbjct  472  SGVQKLLLDGNKFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISKCKLLTFVDLSRNE  531

Query  595  LSGVIP  612
            LSGV+P
Sbjct  532  LSGVVP  537


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  388  LFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSIS  447

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN L+G LP  +   + ++ L L GN FSG+IPPE G    L  +  S N 
Sbjct  448  VSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGNKFSGQIPPEVGSLKQLSKMGFSDNR  507

Query  595  LSGVI  609
             SG I
Sbjct  508  FSGQI  512


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  +  L++  N+L G +P  I  +  L  L L  N F  + P +L   
Sbjct  292  FTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSN  351

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  352  GMLQLLDLSSNKLTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENF  411

Query  595  LSGVIP  612
            L+G IP
Sbjct  412  LNGSIP  417



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   226 bits (575),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            V E  ALLS KAA T D QSSL +WN ST HCTW  +TCDS  HV SLDLSGLNLSG LS
Sbjct  26   VPEYKALLSFKAALTDDPQSSLATWNASTLHCTWFGITCDSRRHVTSLDLSGLNLSGSLS  85

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
            P++  L FL N+S+A NQ SGP+P EISAIS LR LNLSNN+F  TFP +L+QL NLQ+L
Sbjct  86   PELAYLRFLSNVSLADNQFSGPIPAEISAISGLRLLNLSNNVFNGTFPPELSQLKNLQIL  145

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TGDLP++V  + +LRHLHLGGNYFSG IP EYGR+  LEYLAVSGN LSG IP
Sbjct  146  DLYNNNMTGDLPLDVVDLPNLRHLHLGGNYFSGAIPKEYGRWEFLEYLAVSGNELSGKIP  205


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PE+ ++++L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAEL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGTLP  374


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N LSG +PP  + +  L  LNL  N      P  + +L
Sbjct  273  LSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGEL  332

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + +   L+ L L  N  +G +PP+      L  L   GN 
Sbjct  333  PELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNKLTGTLPPDMCSGHRLHTLITLGNF  392

Query  595  LSGVIP  612
            L G IP
Sbjct  393  LFGPIP  398


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG +  + G+  FL  L+++ N+LSG +PPEI +++ LR L +   N +    P ++  
Sbjct  176  FSGAIPKEYGRWEFLEYLAVSGNELSGKIPPEIGSLTNLRELYIGYYNTYEGGLPAEIGN  235

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  236  LSELVRFDGANCALSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNN  295

Query  592  GLSGVIP  612
             LSG IP
Sbjct  296  MLSGEIP  302


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++ S+N F      +++Q 
Sbjct  466  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQC  525

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  526  KVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGNIPSSIASMQSLTSVDFSYNN  585

Query  595  LSGVIP  612
            LSG++P
Sbjct  586  LSGLVP  591


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P   +L  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  297  LSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRN  356

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  357  GKLQLLDLSSNKLTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQSLSRIRMGENF  416

Query  595  LSGVIP  612
            L+G IP
Sbjct  417  LNGSIP  422


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 25/151 (17%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  427

Query  412  LANLQVLDLYNNNLTGD-------------------------LPVEVYKMTSLRHLHLGG  516
            L  L  ++L +N L+GD                         LP  +   + ++ L L G
Sbjct  428  LPKLTQVELQDNLLSGDFPESDGTFAANLGQISLSNNQLSGSLPPSIGNFSGVQKLLLDG  487

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            N FSGRIPPE GR   +  +  S N  SG+I
Sbjct  488  NKFSGRIPPEIGRLQQVSKIDFSHNKFSGLI  518


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 61/125 (49%), Gaps = 6/125 (5%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G  + ++GQ+      S++ NQLSG +PP I   S ++ L L  N F    P ++ +L 
Sbjct  449  DGTFAANLGQI------SLSNNQLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQ  502

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             +  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  503  QVSKIDFSHNKFSGLITPEISQCKVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHL  562

Query  598  SGVIP  612
             G IP
Sbjct  563  VGNIP  567



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 140/183 (77%), Gaps = 1/183 (1%)
 Frame = +1

Query  67   LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  243
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  244  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
             LSPDV  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP QL+ L  L
Sbjct  80   TLSPDVAHLRFLANLTLAENQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPQLSNLTRL  139

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGG  199

Query  604  VIP  612
             IP
Sbjct  200  PIP  202


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+NL   D  N NLTG++P EV ++ ++  L L  N  SG +  E G   +L+ + +S N
Sbjct  233  LSNLVRFDAANCNLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNN  292

Query  592  GLSGVIP  612
              +G IP
Sbjct  293  VFTGEIP  299


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G + P+VG+L  +  L +  N LSG +  E+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  592  GLSGVIP  612
             L+G +P
Sbjct  365  KLTGTLP  371


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++  +N F      +++  
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNKFMGPITPEISHC  521

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  595  LSGVIP  612
            LSG++P
Sbjct  582  LSGLVP  587


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   +  +    N 
Sbjct  450  GNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNK  509

Query  595  LSGVI  609
              G I
Sbjct  510  FMGPI  514


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L+ L L  N F  + P  L + 
Sbjct  294  FTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKN  353

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP ++    +L+ L    N+  G IP   GR  +L  + +  N 
Sbjct  354  GKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNY  413

Query  595  LSGVIP  612
            L+G IP
Sbjct  414  LNGSIP  419


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP      P L  + +  N 
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNL  437

Query  595  LSGVIP  612
            L G  P
Sbjct  438  LDGSFP  443


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGN  484

Query  592  GLSGVIP  612
              SG IP
Sbjct  485  KFSGRIP  491


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  +  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNKFM  511

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+     L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  512  GPITPEISHCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGSIP  563



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 140/181 (77%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPPQLSNLTRLTV  140

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G I
Sbjct  141  LDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGGSI  200

Query  610  P  612
            P
Sbjct  201  P  201


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSE  303

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  304  LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  363

Query  592  GLSGVIP  612
             L+G +P
Sbjct  364  KLTGTLP  370


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGMPPEIGN  231

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  232  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNN  291

Query  592  GLSGVIP  612
              +G IP
Sbjct  292  MFTGEIP  298


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISQC  520

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLFGSIPSSISTMQSLTSVDFSYNN  580

Query  595  LSGVIP  612
            LSG++P
Sbjct  581  LSGLVP  586


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+     +L+ L    N 
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNSLQTLITLSNF  388

Query  595  LSGVIP  612
            L G IP
Sbjct  389  LFGPIP  394


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFSLPKLTQVELQDNLLDGSFPETDTIS  448

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +    N 
Sbjct  449  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNK  508

Query  595  LSGVI  609
              G I
Sbjct  509  FMGSI  513


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFS  423

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  592  GLSGVIP  612
              SG IP
Sbjct  484  KFSGRIP  490


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFM  510

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  511  GSITPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLFGSIP  562



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 140/183 (77%), Gaps = 1/183 (1%)
 Frame = +1

Query  67   LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  243
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  244  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPXKLSNLTRL  139

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGG  199

Query  604  VIP  612
             IP
Sbjct  200  PIP  202


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  233  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNN  292

Query  592  GLSGVIP  612
              +G IP
Sbjct  293  VFTGEIP  299


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  592  GLSGVIP  612
             L+G +P
Sbjct  365  KLTGTLP  371


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+     NL+ L    N 
Sbjct  330  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNF  389

Query  595  LSGVIP  612
            L G IP
Sbjct  390  LFGPIP  395


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E   M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  595  LSGVIP  612
            LSG++P
Sbjct  582  LSGLVP  587


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +    N 
Sbjct  450  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNK  509

Query  595  LSGVI  609
              G I
Sbjct  510  FMGSI  514


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP      P L  + +  N 
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNL  437

Query  595  LSGVIP  612
            L G  P
Sbjct  438  LDGSFP  443


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  484

Query  592  GLSGVIP  612
              SG IP
Sbjct  485  KFSGRIP  491


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFM  511

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+     L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  512  GSITPEISHCKLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIP  563



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            +++  ALLS K++ ++D  S L+SW  +TSHCTW  VTCDS  HV SLDLS  +L G LS
Sbjct  22   MSDYRALLSFKSSISSDPNSVLSSWTPTTSHCTWTGVTCDSRRHVTSLDLSSSDLVGTLS  81

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             D+  L FL NL++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ L  L VL
Sbjct  82   SDIAHLRFLSNLTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSNLTRLAVL  141

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPPE+GRFP LEYLA+SGN L G IP
Sbjct  142  DLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGRIPPEFGRFPLLEYLAISGNELGGSIP  201


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ G+ P L  L+I+ N+L G +PPEI  +++L+ L +   NI+    P ++  
Sbjct  172  FSGRIPPEFGRFPLLEYLAISGNELGGSIPPEIGNLTSLKELYIGYYNIYEGGIPPEIGN  231

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD  N NLTG++P E+ ++ ++  L L  N  SG +  E G   +L+ + +S N
Sbjct  232  LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNN  291

Query  592  GLSGVIP  612
              SG IP
Sbjct  292  MFSGEIP  298


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  303

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L  L +S N
Sbjct  304  LKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSN  363

Query  592  GLSGVIP  612
             L+G +P
Sbjct  364  KLTGTLP  370


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  328

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  + K   L  L L  N  +G +PP+     NL+ L   GN 
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNF  388

Query  595  LSGVIP  612
            L G IP
Sbjct  389  LFGPIP  394


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  520

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  580

Query  595  LSGVIP  612
            LSG++P
Sbjct  581  LSGLVP  586


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLAGSFPETDTIS  448

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +  S N 
Sbjct  449  VNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNK  508

Query  595  LSGVI  609
              G I
Sbjct  509  FLGPI  513


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFG  423

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLSQVELQDNLLAGSFPETDTISVNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  592  GLSGVIP  612
              SG IP
Sbjct  484  KFSGRIP  490


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFL  510

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  +G IP E      L YL +S N L G IP
Sbjct  511  GPIAPEISQCKLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIP  562


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   +G LP L  L +  N  +G +P  +     L  L+LS+N    T P  +  
Sbjct  316  KLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCF  375

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              NLQ L    N L G +P  + +  SL  + +G N+ +G IP      P L  + +  N
Sbjct  376  GNNLQTLITLGNFLFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDN  435

Query  592  GLSGVIP  612
             L+G  P
Sbjct  436  LLAGSFP  442



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPRQLSNLTRLTV  140

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNNLTG LPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G I
Sbjct  141  LDLYNNNLTGKLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGGSI  200

Query  610  P  612
            P
Sbjct  201  P  201


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN++    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSE  303

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  304  LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  363

Query  592  GLSGVIP  612
             L+G +P
Sbjct  364  KLTGTLP  370


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  231

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  232  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNN  291

Query  592  GLSGVIP  612
              +G IP
Sbjct  292  MYTGEIP  298


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISLC  520

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLXGSIPSSISTMQSLTSVDFSYNN  580

Query  595  LSGVIP  612
            LSG++P
Sbjct  581  LSGLVP  586


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+     +L+ L    N 
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNSLQTLITLSNF  388

Query  595  LSGVIP  612
            L G IP
Sbjct  389  LFGPIP  394


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFXLPKLTQVELQDNLLDGSFPETDTIS  448

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +    N 
Sbjct  449  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNK  508

Query  595  LSGVI  609
              G I
Sbjct  509  FMGSI  513


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFX  423

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483

Query  592  GLSGVIP  612
              SG IP
Sbjct  484  KFSGRIP  490


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFM  510

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+     L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  511  GSITPEISLCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLXGSIP  562



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 139/183 (76%), Gaps = 1/183 (1%)
 Frame = +1

Query  67   LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  243
            + ++   ALLS+K++ T+   S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSXPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  244  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPKLSNLTRL  139

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L G
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNELGG  199

Query  604  VIP  612
             IP
Sbjct  200  PIP  202


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  233  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNN  292

Query  592  GLSGVIP  612
              +G IP
Sbjct  293  VFTGEIP  299


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  592  GLSGVIP  612
             L+G +P
Sbjct  365  KLTGTLP  371


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+     NL+ L    N 
Sbjct  330  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNF  389

Query  595  LSGVIP  612
            L G IP
Sbjct  390  LFGPIP  395


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E   M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  595  LSGVIP  612
            LSG++P
Sbjct  582  LSGLVP  587


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +    N 
Sbjct  450  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNK  509

Query  595  LSGVI  609
              G I
Sbjct  510  FMGSI  514


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP      P L  + +  N 
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNL  437

Query  595  LSGVIP  612
            L G  P
Sbjct  438  LDGSFP  443


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  484

Query  592  GLSGVIP  612
              SG IP
Sbjct  485  KFSGRIP  491


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFM  511

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+     L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  512  GSITPEISHCKLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIP  563



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  234
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  39   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  98

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  99   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  158

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VLDLYNNN+TGDLP+ V +M +LRHLHLGGN+F+G IPP YG++  LEYLAVSGN 
Sbjct  159  KRLEVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNE  218

Query  595  LSGVIP  612
            L G IP
Sbjct  219  LHGPIP  224


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  268  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  327

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L+ L VS N 
Sbjct  328  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPQGLGKNGKLQLLDVSSNK  387

Query  595  LSGVIP  612
            L+G +P
Sbjct  388  LTGNLP  393


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q 
Sbjct  484  LTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQC  543

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  544  KVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNN  603

Query  595  LSGVIP  612
            LSG++P
Sbjct  604  LSGLVP  609


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V ++P L +L +  N  +G +PP       L +L +S N      P ++  
Sbjct  170  NMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGN  229

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L +LQ L + Y N   G +P E+  +TSL  L +     SG IPPE G+  NL+ L +  
Sbjct  230  LTSLQQLYVGYYNTYDGGIPPEIGNLTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQV  289

Query  589  NGLSG  603
            N LSG
Sbjct  290  NTLSG  294


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  412  LFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTP  471

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN LTG LP  V   + L+ L L GN FSGRIPPE G    L  +  S N 
Sbjct  472  DSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNK  531

Query  595  LSGVI  609
             SG I
Sbjct  532  FSGEI  536


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  387  KLTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFD  446

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+ P       SL  + L  N  +G +PP  G F  L+ L + GN
Sbjct  447  LPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGN  506

Query  592  GLSGVIP  612
              SG IP
Sbjct  507  KFSGRIP  513


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = +1

Query  253  PDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            P++   P  L  +S++ NQL+G +PP +   S L+ L L  N F    P ++  L  L  
Sbjct  465  PEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSK  524

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            +D  NN  +G++  E+ +   L  + L  N   G IP E      L YL +S N L G I
Sbjct  525  MDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSI  584

Query  610  P  612
            P
Sbjct  585  P  585



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   218 bits (555),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  234
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  20   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  79

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  80   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  139

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VLDLYNNN+TGDLP+ V +M +LRHLHLGGN+F+G IPP YG++  LEYLAVSGN 
Sbjct  140  KRLEVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNE  199

Query  595  LSGVIP  612
            L G IP
Sbjct  200  LHGPIP  205


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L+ L VS N 
Sbjct  309  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPQGLGKNGKLQLLDVSSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGNLP  374


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q 
Sbjct  465  LTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQC  524

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNN  584

Query  595  LSGVIP  612
            LSG++P
Sbjct  585  LSGLVP  590


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V ++P L +L +  N  +G +PP       L +L +S N      P ++  
Sbjct  151  NMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGN  210

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L +LQ L + Y N   G +P E+  +TSL  L +     SG IPPE G+  NL+ L +  
Sbjct  211  LTSLQQLYVGYYNTYDGGIPPEIGNLTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQV  270

Query  589  NGLSG  603
            N LSG
Sbjct  271  NTLSG  275


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTP  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN LTG LP  V   + L+ L L GN FSGRIPPE G    L  +  S N 
Sbjct  453  DSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNK  512

Query  595  LSGVI  609
             SG I
Sbjct  513  FSGEI  517


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFD  427

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+ P       SL  + L  N  +G +PP  G F  L+ L + GN
Sbjct  428  LPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGN  487

Query  592  GLSGVIP  612
              SG IP
Sbjct  488  KFSGRIP  494


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = +1

Query  253  PDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            P++   P  L  +S++ NQL+G +PP +   S L+ L L  N F    P ++  L  L  
Sbjct  446  PEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSK  505

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            +D  NN  +G++  E+ +   L  + L  N   G IP E      L YL +S N L G I
Sbjct  506  MDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSI  565

Query  610  P  612
            P
Sbjct  566  P  566



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   214 bits (546),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L G IP
Sbjct  140  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIP  199


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  362

Query  595  LSGVIP  612
            L+G +P
Sbjct  363  LTGTLP  368


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V QL  L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  145  NMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGN  204

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  LQ L + Y N+ TG LP E+  ++SL          SG IP + GR  NL+ L +  
Sbjct  205  LTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQV  264

Query  589  NGLSG  603
            N LSG
Sbjct  265  NALSG  269


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  339

Query  598  SGVIP  612
            +G IP
Sbjct  340  TGSIP  344


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  600


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  421

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  422  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  592  GLSGVIP  612
              SG IP
Sbjct  482  KFSGQIP  488


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  411  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  470

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N 
Sbjct  471  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNE  530

Query  595  LSGVIP  612
            LSG IP
Sbjct  531  LSGEIP  536


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  387  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  446

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP E G+   L  +  S N 
Sbjct  447  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNK  506

Query  595  LSGVI  609
             SG I
Sbjct  507  FSGRI  511


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 67/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  338  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  396

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  397  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  456

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  457  NQLSGSLP  464



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   214 bits (546),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  22   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  81

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  82   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  141

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L G IP
Sbjct  142  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIP  201


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  245  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  304

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  305  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  364

Query  595  LSGVIP  612
            L+G +P
Sbjct  365  LTGTLP  370


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V QL  L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  147  NMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGN  206

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  LQ L + Y N+ TG LP E+  ++SL          SG IP + GR  NL+ L +  
Sbjct  207  LTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQV  266

Query  589  NGLSG  603
            N LSG
Sbjct  267  NALSG  271


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  222  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  281

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  282  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  341

Query  598  SGVIP  612
            +G IP
Sbjct  342  TGSIP  346


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  484  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  543

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  544  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  602


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  364  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  423

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  424  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  483

Query  592  GLSGVIP  612
              SG IP
Sbjct  484  KFSGQIP  490


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  413  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  472

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N 
Sbjct  473  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNE  532

Query  595  LSGVIP  612
            LSG IP
Sbjct  533  LSGEIP  538


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  389  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  448

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP E G+   L  +  S N 
Sbjct  449  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNK  508

Query  595  LSGVI  609
             SG I
Sbjct  509  FSGRI  513


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 67/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  340  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  398

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  399  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  458

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  459  NQLSGSLP  466



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L G IP
Sbjct  140  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIP  199


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  362

Query  595  LSGVIP  612
            L+G +P
Sbjct  363  LTGTLP  368


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V QL  L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  145  NMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNELGGKIPGEIGN  204

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  LQ L + Y N+ TG LP E+  ++SL          SG IP + GR  NL+ L +  
Sbjct  205  LTKLQQLYIGYYNSYTGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQV  264

Query  589  NGLSG  603
            N LSG
Sbjct  265  NALSG  269


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNF  339

Query  598  SGVIP  612
            +G IP
Sbjct  340  TGSIP  344


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  600


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  421

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  422  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481

Query  592  GLSGVIP  612
              SG IP
Sbjct  482  KFSGQIP  488


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  411  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  470

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N 
Sbjct  471  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNE  530

Query  595  LSGVIP  612
            LSG IP
Sbjct  531  LSGEIP  536


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  387  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  446

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP E G+   L  +  S N 
Sbjct  447  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNK  506

Query  595  LSGVI  609
             SG I
Sbjct  507  FSGRI  511


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 67/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G    L  L +++N+L+G +PP++ A + L+  + L N +FG   P  L 
Sbjct  338  NFTGSIPQRLGSNGKLRILDLSSNKLTGTLPPDMCAGNCLQTLITLGNFLFG-PIPESLG  396

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ + SL  + L  NY +G+ P       NL  + +S 
Sbjct  397  KCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSN  456

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  457  NQLSGSLP  464



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            ++E  ALLS+++A T  +   LTSWN ST +C+W  VTCD+  HV SLDL+GL+LSG LS
Sbjct  25   ISEYRALLSLRSAITDATPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGPLS  84

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             DV  LPFL NLS+A+N+ SGP+PP +SA+S LRFLNLSNN+F  TFP +L++L NL+VL
Sbjct  85   ADVAHLPFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSELSRLQNLEVL  144

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TG LP+ V +M +LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN L G IP
Sbjct  145  DLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELEGTIP  204


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSGVL P +G    +  L +  N  +G +PP+I  +  L  ++ S N F      +++Q 
Sbjct  464  LSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQC  523

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  524  KLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISSMQSLTSVDFSYNN  583

Query  595  LSGVIP  612
            LSG++P
Sbjct  584  LSGLVP  589


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P +  +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGEL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N L G +P  + ++ +L  + L  N F+G IP   G+   L  + +S N 
Sbjct  308  KNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGTLP  373


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   +S++ L L GN F+GRIPP+ GR   L  +  SGN 
Sbjct  452  VNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNK  511

Query  595  LSGVI  609
             SG I
Sbjct  512  FSGPI  516


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+V+ L+ NN TG +P  + K   L  + L  N  +G +P        L+ L   GN 
Sbjct  332  PALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGPIP  397


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G + P++G L  LV L  A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P LE + +  N  
Sbjct  285  SLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNF  344

Query  598  SGVIP  612
            +G IP
Sbjct  345  TGSIP  349


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = +1

Query  253  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            P+VG +   L  ++++ NQLSG +PP I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  445  PEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSK  504

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L YL +S N L G I
Sbjct  505  IDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGI  564

Query  610  P  612
            P
Sbjct  565  P  565


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++GVL   V Q+  L +L +  N  SG +PPE      L++L +S N    T P ++  
Sbjct  150  NMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELEGTIPPEIGN  209

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L++L+ L + Y N  TG +P E+  ++ L  L       SG IP   G+   L+ L +  
Sbjct  210  LSSLRELYIGYYNTYTGGIPPEIGNLSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQV  269

Query  589  NGLSG  603
            N LSG
Sbjct  270  NALSG  274


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 56/115 (49%), Gaps = 0/115 (0%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            LP L  + +  N LSG  P   S    L  + LSNN      P  +   +++Q L L  N
Sbjct  427  LPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGN  486

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              TG +P ++ ++  L  +   GN FSG I PE  +   L +L +S N LSG IP
Sbjct  487  MFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIP  541


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +    G+L  +  L++  N+L G +P  I  +  L  + L  N F  + P  L + 
Sbjct  296  LSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKN  355

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +    +L+ L   GN+  G IP   G   +L  + +  N 
Sbjct  356  GRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNFLFGPIPESLGSCESLTRIRMGENF  415

Query  595  LSGVIP  612
            L+G IP
Sbjct  416  LNGSIP  421


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  L    N L GP+P  + +  +L  + +  N    + P  L  L  L  ++L +N L+
Sbjct  382  LQTLITLGNFLFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLS  441

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G+ P       +L  + L  N  SG +PP  G F +++ L + GN  +G IP
Sbjct  442  GEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIP  493


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 24/151 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   +G+LP L  + +  N  +G +P  +     L  ++LS+N    T P  L  
Sbjct  319  KLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCS  378

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP------PEY--------  549
               LQ L    N L G +P  +    SL  + +G N+ +G IP      P+         
Sbjct  379  GNTLQTLITLGNFLFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDN  438

Query  550  ---GRFP-------NLEYLAVSGNGLSGVIP  612
               G FP       NL  + +S N LSGV+P
Sbjct  439  YLSGEFPEVGSVAVNLGQITLSNNQLSGVLP  469



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            +TE  ALLS+K++FT D  S LTSWN+ST+ C+W  VTCD  L  V+      LNLSG L
Sbjct  25   ITELNALLSLKSSFTIDEHSPLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL  84

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  426
            S DV  LP L NLS+AANQ+SGP+PPEIS +  LR LNLSNN+F  ++P +L+  L NL+
Sbjct  85   SSDVSHLPLLQNLSLAANQISGPIPPEISNLYELRHLNLSNNVFNGSYPDELSSGLVNLR  144

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTGDLPV +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L G 
Sbjct  145  VLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELIGK  204

Query  607  IP  612
            IP
Sbjct  205  IP  206


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SG +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  250  LTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNNMFTGEIPASFSQL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIPHKLGENGRLVILDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGTLP  375


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  467  LSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  526

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  527  KLLTFVDLSRNELSGDIPKEITGMRILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNN  586

Query  595  LSGVIP  612
            LSG++P
Sbjct  587  LSGLVP  592


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  230  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLK  289

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  290  SMDLSNNMFTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGG  349

Query  607  IP  612
            IP
Sbjct  350  IP  351


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  237  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNN  296

Query  592  GLSGVIP  612
              +G IP
Sbjct  297  MFTGEIP  303


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     QL  L  L++  N+L G +P  I  +  L  L L  N F    PH+L + 
Sbjct  298  FTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIPHKLGEN  357

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +LDL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  358  GRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENF  417

Query  595  LSGVIP  612
            L+G IP
Sbjct  418  LNGSIP  423


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 62/127 (49%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIS-TLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   +  LP L  + +  N L+G +P     +S  L  ++LSNN      P  +  
Sbjct  418  LNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGPLPAAIGN  477

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + +Q L L  N   G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N
Sbjct  478  FSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRN  537

Query  592  GLSGVIP  612
             LSG IP
Sbjct  538  ELSGDIP  544


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 62/151 (41%), Gaps = 25/151 (17%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  428

Query  412  LANLQVLDLYNNNLTGDLPVE-------------------------VYKMTSLRHLHLGG  516
            L  L  ++L +N LTG+LP+                          +   + ++ L L G
Sbjct  429  LPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDG  488

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            N F+G IPPE GR   L  L  S N  SG I
Sbjct  489  NKFAGPIPPEIGRLQQLSKLDFSHNLFSGRI  519



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = +1

Query  88   ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  267
            ALLS+K++   D  S L+SW  +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPD+  
Sbjct  38   ALLSLKSSLD-DPDSRLSSWTPNTSHCTWAGVTCDSHNHVTSLDLSGLNLSGYLSPDIAF  96

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            L +L NL++A N LSGP+PPEISA+  LR LNLSNN+F  TFP +L+ L NL+VLDLYNN
Sbjct  97   LVYLSNLTLAENNLSGPIPPEISALPALRLLNLSNNVFNRTFPPELSNLTNLRVLDLYNN  156

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            NLTG LPV V  MT+LRHLHLGGN+F G IPPEYG+FP LEYLAVSGN ++G IP
Sbjct  157  NLTGVLPVSVTHMTNLRHLHLGGNFFEGSIPPEYGQFPFLEYLAVSGNSITGKIP  211


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NLSG + P++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+
Sbjct  254  NLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLKSLKSMDLSNNLFSGEIPTSFAE  313

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   GR   L+ + +S N
Sbjct  314  LKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNFTGSIPQSLGRNGKLQLVDLSSN  373

Query  592  GLSGVIP  612
             L+G +P
Sbjct  374  KLTGALP  380


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N+F      ++++ 
Sbjct  471  LSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRC  530

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  531  KVLAYVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGNIPAPISAMQSLTSVDFSYNN  590

Query  595  LSGVIP  612
            LSG++P
Sbjct  591  LSGLVP  596


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  399  LFGPIPESLGECKSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNFLNGPFPVSDSVS  458

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A L  + L NN L+G LP  +   T ++ L L GN FSGRIPPE G    L  +  S N 
Sbjct  459  AGLGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNL  518

Query  595  LSGVI  609
             SG I
Sbjct  519  FSGPI  523


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG +     +L  L  L++  NQL G +P  I  +  L+ L L  N F  + P  L + 
Sbjct  303  FSGEIPTSFAELKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNFTGSIPQSLGRN  362

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ++DL +N LTG LP ++    +L+ L   GN+  G IP   G   +L  + +  N 
Sbjct  363  GKLQLVDLSSNKLTGALPPDMCSGNNLQTLITLGNFLFGPIPESLGECKSLSRIRMGENF  422

Query  595  LSGVIP  612
            L+G IP
Sbjct  423  LNGSIP  428


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+GP P   S  + L  ++LSNN      P  +   
Sbjct  423  LNGSIPKGLFGLPKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSNNRLSGPLPPAIGNF  482

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N  +G +P E+  +  L  +    N FSG I PE  R   L Y+ +S N 
Sbjct  483  TGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRCKVLAYVDLSRNE  542

Query  595  LSGVIP  612
            LSG IP
Sbjct  543  LSGEIP  548


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSGP+PP I   + ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  461  LGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFS  520

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L ++ L  N  SG IP E      L YL +S N L G IP
Sbjct  521  GPIAPEISRCKVLAYVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGNIP  572


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  374  KLTGALPPDMCSGNNLQTLITLGNFLFGPIPESLGECKSLSRIRMGENFLNGSIPKGLFG  433

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L G  PV       L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  434  LPKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGN  493

Query  592  GLSGVIP  612
              SG IP
Sbjct  494  KFSGRIP  500



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 147/193 (76%), Gaps = 1/193 (1%)
 Frame = +1

Query  37   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvs-  213
            H     A +P  ++E  AL+SIKAA + +++ +L SWN   SHC+WR VTCDSL   V+ 
Sbjct  15   HLQRCAAVRPPRMSEYHALVSIKAAISEEARPALASWNSGASHCSWRGVTCDSLGRHVTG  74

Query  214  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  393
            LD+S L+LSG LSPDVGQL FLVNLS AAN LSGPVP EI+ I  LR+LNLSNN+F  +F
Sbjct  75   LDISNLSLSGSLSPDVGQLLFLVNLSAAANLLSGPVPAEIADIPNLRYLNLSNNVFNLSF  134

Query  394  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  573
            P +L +L NLQVLDLYNNN+TGD P   Y + +LRHLHLGGN+F+G +PPE+G FP+LEY
Sbjct  135  PTELYRLKNLQVLDLYNNNMTGDFPSRAYLLANLRHLHLGGNFFTGTMPPEFGSFPHLEY  194

Query  574  LAVSGNGLSGVIP  612
            LAVSGN LSG IP
Sbjct  195  LAVSGNELSGTIP  207


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P+ G  P L  L+++ N+LSG +PPE+  ++ L+ L +   N F    P ++  
Sbjct  178  FTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGLPKEIGN  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+NL  LD  +  L+GD+P E+  + +L  L L  N FSG + PE G   NL+ + +S N
Sbjct  238  LSNLLRLDAASCGLSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNN  297

Query  592  GLSGVIP  612
             LSG IP
Sbjct  298  ALSGEIP  304


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 0/123 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G L  L  L +  N  SG + PE+  +  L+ ++LSNN      P   A+L
Sbjct  251  LSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAEL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L+ L L  N F+G IP   G   NL+ + +S N 
Sbjct  311  KNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLGSNGNLQEVDLSSNK  370

Query  595  LSG  603
            L+G
Sbjct  371  LTG  373


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG L+P++G L  L ++ ++ N LSG +P   + +  L  LNL  N    + P+ + +L
Sbjct  275  FSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGEL  334

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  +    +L+ + L  N  +G + P+      L  L   GN 
Sbjct  335  PQLQVLQLWENNFTGSIPENLGSNGNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNF  394

Query  595  LSGVIP  612
            L+G IP
Sbjct  395  LTGPIP  400


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 64/125 (51%), Gaps = 6/125 (5%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            + VLS ++GQ+      S++ N LSGP+PP I     ++   L  N F  + P ++ +L 
Sbjct  450  TDVLSQNLGQI------SLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIPAEIGKLQ  503

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L  +D  +N  +G +P E+ +   L  + L  N  +GR+P E      L YL +S N L
Sbjct  504  QLSKMDFSSNKFSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISAMKILNYLNLSRNQL  563

Query  598  SGVIP  612
             G IP
Sbjct  564  DGNIP  568


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  L +  N +SGP P        L  ++LSNN      P  +   
Sbjct  419  LNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNF  478

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q   L  N+ +G +P E+ K+  L  +    N FSG+IPPE  +   L ++ +S N 
Sbjct  479  VAVQKFLLDGNSFSGSIPAEIGKLQQLSKMDFSSNKFSGQIPPELSQCKQLAFVDLSRNQ  538

Query  595  LSGVIP  612
            L+G +P
Sbjct  539  LNGRVP  544


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +G    L  + +  N L+G +P  + ++  L  L L +N+    FP      
Sbjct  395  LTGPIPDSMGHCESLSRVRMGENYLNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLS  454

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN+L+G LP  +    +++   L GN FSG IP E G+   L  +  S N 
Sbjct  455  QNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIPAEIGKLQQLSKMDFSSNK  514

Query  595  LSGVIP  612
             SG IP
Sbjct  515  FSGQIP  520


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +     +L  L  L++  N+L+G +P  I  +  L+ L L  N F  + P  L   
Sbjct  299  LSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLGSN  358

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NLQ +DL +N LTG L  ++     L  L   GN+ +G IP   G   +L  + +  N 
Sbjct  359  GNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSMGHCESLSRVRMGENY  418

Query  595  LSGVIP  612
            L+G IP
Sbjct  419  LNGHIP  424


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G LSP +     L  L    N L+GP+P  +    +L  + +  N      P  L  L
Sbjct  371  LTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSMGHCESLSRVRMGENYLNGHIPKGLLSL  430

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  L+L +N ++G  P       +L  + L  N+ SG +PP  G F  ++   + GN 
Sbjct  431  PMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGNS  490

Query  595  LSGVIP  612
             SG IP
Sbjct  491  FSGSIP  496


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG + P++ Q   L  + ++ NQL+G VP EISA+  L +LNLS N      P  ++ +
Sbjct  515  FSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISAMKILNYLNLSRNQLDGNIPSSISSM  574

Query  415  ANLQVLDLYNNNLTGDLP  468
             +L  +D   NN TG +P
Sbjct  575  QSLTSVDFSYNNFTGLVP  592



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 137/183 (75%), Gaps = 3/183 (2%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  246
            +TE  ALLS+K++FT D  S L TSWN+ST+ C+W  VTCD  L  V+      LNLSG 
Sbjct  25   ITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGT  84

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  423
            LS DV  LP L NLS+AANQ+SGP+PP+IS +  LR LNLSNN+F  +FP +L+  L NL
Sbjct  85   LSSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNL  144

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
            +VLDLYNNNLTGDLPV +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L+G
Sbjct  145  RVLDLYNNNLTGDLPVSLTNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELTG  204

Query  604  VIP  612
             IP
Sbjct  205  KIP  207


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSFSQL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  311  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGENGRLVILDLSSNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLK  290

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  291  SMDLSNNMFTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGS  350

Query  607  IP  612
            IP
Sbjct  351  IP  352


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  178  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG++P E+ K+  L  L L  N F+G I  E G   +L+ + +S N
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNN  297

Query  592  GLSGVIP  612
              +G IP
Sbjct  298  MFTGEIP  304


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G L  +  L +  N+ SG +PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  468  LSGSLPAAIGNLSGVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNELSGDIPNELTGMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIS-TLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +  ++  LP L  + +  N L+G +P     +S  L  ++LSNN    + P  +  
Sbjct  419  LNGSIPKELFGLPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGSLPAAIGN  478

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ +Q L L  N  +G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N
Sbjct  479  LSGVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRN  538

Query  592  GLSGVIP  612
             LSG IP
Sbjct  539  ELSGDIP  545


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     QL  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGEN  358

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +LDL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  359  GRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENF  418

Query  595  LSGVIP  612
            L+G IP
Sbjct  419  LNGSIP  424


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 64/151 (42%), Gaps = 25/151 (17%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P +L  
Sbjct  370  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKELFG  429

Query  412  LANLQVLDLYNNNLTGDLPVE-------------------------VYKMTSLRHLHLGG  516
            L  L  ++L +N LTG+LP+                          +  ++ ++ L L G
Sbjct  430  LPKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGSLPAAIGNLSGVQKLLLDG  489

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            N FSG IPPE GR   L  L  S N  SG I
Sbjct  490  NKFSGSIPPEIGRLQQLSKLDFSHNLFSGRI  520



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   209 bits (532),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 136/191 (71%), Gaps = 7/191 (4%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  225
            AG+P  ++E  ALLS+K++ T    D  S LTSW +STS C W  VTCD     V+    
Sbjct  31   AGRP--ISEYHALLSLKSSLTGGENDQHSPLTSWKLSTSFCLWTGVTCDVSRRHVTSLDL  88

Query  226  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  402
              LNLSG LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNNIF  ++P +
Sbjct  89   SGLNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEISNLSELRHLNLSNNIFNGSYPDE  148

Query  403  L-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  579
            L A L NLQVLDLYNNNLTGDLPV +  +T LRHLHLGGNYF+G IP  YG +P LEYLA
Sbjct  149  LSAGLVNLQVLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFAGNIPAVYGTWPVLEYLA  208

Query  580  VSGNGLSGVIP  612
            VSGN L G IP
Sbjct  209  VSGNELVGKIP  219


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++ +L  L  L +  N  SGP+ PE+  IS+L+ ++LSNN+F    P    QL
Sbjct  263  LTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPASFEQL  322

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L  L +S N 
Sbjct  323  KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLVILDLSSNK  382

Query  595  LSGVIP  612
            L+G +P
Sbjct  383  LTGTLP  388


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 1/118 (1%)
 Frame = +1

Query  262  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  438
            G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  L+ L   D 
Sbjct  199  GTWPVLEYLAVSGNELVGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGNLSELVRFDA  258

Query  439  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             N  LTG++P E++K+  L  L L  N FSG + PE G   +L+ + +S N  +G IP
Sbjct  259  ANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIP  316


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  243  LPPEIGNLSELVRFDAANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLK  302

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  303  SMDLSNNMFTGEIPASFEQLKNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGS  362

Query  607  IP  612
            IP
Sbjct  363  IP  364


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 64/126 (51%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG +S ++GQ+      S++ NQLSGP+PP I   S ++ L L  N F    P ++ +L
Sbjct  461  VSGGVSVNLGQI------SLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGQIPSEIGRL  514

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LD  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N 
Sbjct  515  QQLSKLDFSHNLFSGRITPEISHCKLLTFVDLSRNELSGEIPNEITSMRILNYLNISRNH  574

Query  595  LSGVIP  612
            L G IP
Sbjct  575  LVGSIP  580


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  382  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLLG  441

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  442  LPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGN  501

Query  592  GLSGVIP  612
              SG IP
Sbjct  502  KFSGQIP  508


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 55/115 (48%), Gaps = 0/115 (0%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            LP L  + +  N L+G +P        L  ++LSNN      P  +   + +Q L L  N
Sbjct  442  LPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGN  501

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              +G +P E+ ++  L  L    N FSGRI PE      L ++ +S N LSG IP
Sbjct  502  KFSGQIPSEIGRLQQLSKLDFSHNLFSGRITPEISHCKLLTFVDLSRNELSGEIP  556


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  407  LFGSIPDSLGECESLTRIRMGENFLNGSIPKGLLGLPKLSQVELQDNYLTGELPVSGGVS  466

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN FSG+IP E GR   L  L  S N 
Sbjct  467  VNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGQIPSEIGRLQQLSKLDFSHNL  526

Query  595  LSGVI  609
             SG I
Sbjct  527  FSGRI  531


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG ++P++     L  + ++ N+LSG +P EI+++  L +LN+S N    + P  +A +
Sbjct  527  FSGRITPEISHCKLLTFVDLSRNELSGEIPNEITSMRILNYLNISRNHLVGSIPVTIASM  586

Query  415  ANLQVLDLYNNNLTGDLP  468
             +L  +D   NNL+G +P
Sbjct  587  QSLTSVDFSYNNLSGLVP  604



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 150/201 (75%), Gaps = 9/201 (4%)
 Frame = +1

Query  34   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTS-------HCTWRRVTCd  192
            R  A A A  P  +TE  ALLSI+AA T D QS+L+SW  + +       HC+W+ VTCD
Sbjct  17   RRGAAASAA-PTRLTEPLALLSIRAAVTGDPQSALSSWTSAAAAAANGSSHCSWQGVTCD  75

Query  193  -sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS  369
                HV +LDLS L L+G LSPDV  L FL++LS+AANQLSGP+PP+ISA++ LR+LNLS
Sbjct  76   PRRRHVTALDLSSLELAGALSPDVAHLRFLISLSVAANQLSGPIPPQISALAALRYLNLS  135

Query  370  NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY  549
            NN+F  TFP +L  L NL+VLDLYNNN+TGDLPV V +M  LRHLHLGGNYF GRIPPEY
Sbjct  136  NNVFNGTFPPRLGLLRNLRVLDLYNNNMTGDLPVAVAEMPQLRHLHLGGNYFGGRIPPEY  195

Query  550  GRFPNLEYLAVSGNGLSGVIP  612
            GR+  +EYLAVSG+ L+G IP
Sbjct  196  GRWEFIEYLAVSGDELTGAIP  216


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++ +L  L  L +  N  +G +P EI  +++L+ L+LSNN+F    P   +QL
Sbjct  260  LSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQL  319

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L L+ N L G++P  +  +  L+ L L  N F+G IP   G+  +L+ + +S N 
Sbjct  320  KNLTLLHLFRNKLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNK  379

Query  595  LSGVIP  612
            L+G +P
Sbjct  380  LTGTLP  385


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G L P +G    +  L +  N  SG +PPEI  +  L  ++ S+N +    P Q++Q
Sbjct  476  KLGGSLPPTIGNFSGVQKLLLDGNNFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQ  535

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  +DL  N L+G++P E+  M  L +L+L  N  SG IPP      +L  +  S N
Sbjct  536  CKLLTFVDLSGNELSGEIPNEITGMRILNYLNLSSNNLSGSIPPSISTMQSLTSVDFSYN  595

Query  592  GLSGVIP  612
             LSG++P
Sbjct  596  NLSGLVP  602


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             L+G + P++G L  L  L +   N   G +PPEI  +S L  L+ ++       P ++A
Sbjct  210  ELTGAIPPEIGNLTTLRELYLGYYNSYDGSLPPEIGNLSQLVRLDAASCGLSGEIPPEIA  269

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +L NL  L L  N   G LP E+  + SL+ L L  N F+G IP  + +  NL  L +  
Sbjct  270  KLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQLKNLTLLHLFR  329

Query  589  NGLSGVIP  612
            N L+G IP
Sbjct  330  NKLNGEIP  337


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N SG + P++G+L  L  +  ++N+ SGP+P +IS    L F++LS N      P+++  
Sbjct  500  NFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNELSGEIPNEITG  559

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L +NNL+G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  560  MRILNYLNLSSNNLSGSIPPSISTMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  618


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     QL  L  L +  N+L+G +P  I+ +  L+ L L  N F  + P  L + 
Sbjct  308  FAGEIPESFSQLKNLTLLHLFRNKLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKN  367

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +LQ++DL +N LTG LP ++     L+ L    NY  G IP   G+  +LE + + GN 
Sbjct  368  GHLQIVDLSSNKLTGTLPPDLCYGNQLQILIALSNYLLGPIPESLGKCRSLERIRMGGNY  427

Query  595  LSGVIP  612
            L+G IP
Sbjct  428  LNGSIP  433


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  ++++ N+L G +PP I   S ++ L L  N F    P ++ +L  L  +D  +N  +
Sbjct  467  LGQITLSNNKLGGSLPPTIGNFSGVQKLLLDGNNFSGQIPPEIGRLQQLAKIDFSSNRYS  526

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +P ++ +   L  + L GN  SG IP E      L YL +S N LSG IP
Sbjct  527  GPIPAQISQCKLLTFVDLSGNELSGEIPNEITGMRILNYLNLSSNNLSGSIP  578


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 65/155 (42%), Gaps = 31/155 (20%)
 Frame = +1

Query  232  NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  402
             L+G L PD+    QL  L+ LS   N L GP+P  +    +L  + +  N    + P  
Sbjct  379  KLTGTLPPDLCYGNQLQILIALS---NYLLGPIPESLGKCRSLERIRMGGNYLNGSIPRG  435

Query  403  LAQLANLQVLD-------------------------LYNNNLTGDLPVEVYKMTSLRHLH  507
            L  L  L  ++                         L NN L G LP  +   + ++ L 
Sbjct  436  LFGLPELNQVEFQDNLLVGEFPVSDDSIALKLGQITLSNNKLGGSLPPTIGNFSGVQKLL  495

Query  508  LGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            L GN FSG+IPPE GR   L  +  S N  SG IP
Sbjct  496  LDGNNFSGQIPPEIGRLQQLAKIDFSSNRYSGPIP  530


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G +   +  LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  331  KLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNKLTGTLPPDLCY  390

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               LQ+L   +N L G +P  + K  SL  + +GGNY +G IP      P L  +    N
Sbjct  391  GNQLQILIALSNYLLGPIPESLGKCRSLERIRMGGNYLNGSIPRGLFGLPELNQVEFQDN  450

Query  592  GLSGVIP  612
             L G  P
Sbjct  451  LLVGEFP  457



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            ++E  ALLS++ A T  +   L+SWN ST+HC W  VTCD+  HV +L+L+GLNLSG L+
Sbjct  23   ISEYRALLSLREAITDTNPPILSSWNPSTTHCIWLGVTCDTRRHVTALNLTGLNLSGTLA  82

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             D+  LPFL NLS+A N+ SG +PP +SA+S LR LNLSNN+F  TFP +L+QL +L+VL
Sbjct  83   ADIAHLPFLSNLSLADNKFSGEIPPSLSAVSGLRLLNLSNNVFNGTFPSELSQLKSLEVL  142

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TG LP+ V ++ +LRHLHLGGNYF+G+IPPEYG + +LEYLAVSGN L G IP
Sbjct  143  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYFTGQIPPEYGLWQHLEYLAVSGNELDGTIP  202


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   +QL
Sbjct  246  LSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQL  305

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNFTGNIPMGLGSNGKLTLLDLSSNK  365

Query  595  LSGVIP  612
            L+G +P
Sbjct  366  LTGTLP  371


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  223  AGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLK  282

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N  
Sbjct  283  SLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNF  342

Query  598  SGVIP  612
            +G IP
Sbjct  343  TGNIP  347


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  270  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDM  329

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+V+ L+ NN TG++P+ +     L  L L  N  +G +PP       L+ L   GN 
Sbjct  330  PALEVVQLWENNFTGNIPMGLGSNGKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNF  389

Query  595  LSGVIP  612
            L G IP
Sbjct  390  LFGPIP  395


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +   +G+L  L N+  + N+ SGP+  EIS    L F++LS N      P+++  +
Sbjct  486  FTGKIPSQIGRLQQLSNIDFSHNKFSGPIASEISQCKLLTFVDLSRNELSGVIPNEITGM  545

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L  L+L  N+L G +P+ +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  546  RILNYLNLSRNHLVGSIPISISSMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  603


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 61/125 (49%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V +LP L +L +  N  +G +PPE      L +L +S N    T P  +  
Sbjct  148  NMTGTLPLAVTELPNLRHLHLGGNYFTGQIPPEYGLWQHLEYLAVSGNELDGTIPPGIGN  207

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L +L+ L + Y N   G +P E+  +T L  L       SG IP E G+   L+ L +  
Sbjct  208  LTSLRELYIGYYNTYAGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDTLFLQV  267

Query  589  NGLSG  603
            N LSG
Sbjct  268  NALSG  272


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  ++++ NQLSG +PP I   ++++   L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  452  LGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNMFTGKIPSQIGRLQQLSNIDFSHNKFS  511

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  512  GPIASEISQCKLLTFVDLSRNELSGVIPNEITGMRILNYLNLSRNHLVGSIP  563


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  390  LFGPIPESLGSCESLNRIRMGDNFLNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSVS  449

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   TS++   L GN F+G+IP + GR   L  +  S N 
Sbjct  450  VNLGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNMFTGKIPSQIGRLQQLSNIDFSHNK  509

Query  595  LSGVI  609
             SG I
Sbjct  510  FSGPI  514


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG  P   S    L  + LSNN      P  +   
Sbjct  414  LNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGVLPPSIGNF  473

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             ++Q   L  N  TG +P ++ ++  L ++    N FSG I  E  +   L ++ +S N 
Sbjct  474  TSMQKFLLDGNMFTGKIPSQIGRLQQLSNIDFSHNKFSGPIASEISQCKLLTFVDLSRNE  533

Query  595  LSGVIP  612
            LSGVIP
Sbjct  534  LSGVIP  539


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P +     L  L    N L GP+P  + +  +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPYLCSGNRLQTLITLGNFLFGPIPESLGSCESLNRIRMGDNFLNGSIPKGLFG  424

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F +++   + GN
Sbjct  425  LPKLTQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGN  484

Query  592  GLSGVIP  612
              +G IP
Sbjct  485  MFTGKIP  491


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     QL  L  L++  N+L G +P  I  +  L  + L  N F    P  L   
Sbjct  294  LTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNFTGNIPMGLGSN  353

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +LDL +N LTG LP  +     L+ L   GN+  G IP   G   +L  + +  N 
Sbjct  354  GKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNFLFGPIPESLGSCESLNRIRMGDNF  413

Query  595  LSGVIP  612
            L+G IP
Sbjct  414  LNGSIP  419


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 66/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G    L  L +++N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  341  NFTGNIPMGLGSNGKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNFLFGP-IPESLG  399

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
               +L  + + +N L G +P  ++ +  L  + L  NY SG  P  +    NL  + +S 
Sbjct  400  SCESLNRIRMGDNFLNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSVSVNLGQITLSN  459

Query  589  NGLSGVIP  612
            N LSGV+P
Sbjct  460  NQLSGVLP  467



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 144/189 (76%), Gaps = 5/189 (3%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllh-vvsldlsg  228
            A +P   TE  ALLS+K + T+  QSS LTSWN+S S C W  VTCD  L  V SLDLS 
Sbjct  17   AARP--TTELHALLSLKTSLTSGEQSSSLTSWNLSKSFCLWAGVTCDVSLRHVTSLDLSS  74

Query  229  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-  405
            LNLSG LS DV  LP L NLS+AANQ+SGP+PPEI+ +S LR LNLSNN+F  ++P+QL 
Sbjct  75   LNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEIANLSELRHLNLSNNVFNGSYPNQLS  134

Query  406  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  585
            A+LANLQVLDLYNNNLTGDLPV +  +T LRHLHLGGNYF+GRIP  YG +P LEYLAVS
Sbjct  135  ARLANLQVLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFTGRIPAVYGSWPVLEYLAVS  194

Query  586  GNGLSGVIP  612
            GN L G IP
Sbjct  195  GNELVGKIP  203


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P    QL
Sbjct  247  LTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPASFEQL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L  L +S N 
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGRLVILDLSSNK  366

Query  595  LSGVIP  612
            L+G +P
Sbjct  367  LTGTLP  372


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG L P +G    +  L +  N+  GP+PPEI  +  L  L+ S+N+F      +++Q
Sbjct  463  HLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQLSKLDFSHNLFPGRIAPEISQ  522

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  523  CKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPVTMASMQSLTSVDFSYN  582

Query  592  GLSGVIP  612
             LSG++P
Sbjct  583  NLSGLVP  589


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 63/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G+L  LV    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  227  LPPEIGKLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLK  286

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  287  SMDLSNNMFTGEIPASFEQLKNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGS  346

Query  607  IP  612
            IP
Sbjct  347  IP  348


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 66/118 (56%), Gaps = 1/118 (1%)
 Frame = +1

Query  262  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  438
            G  P L  L+++ N+L G +PPEI  ++TL+ L +   N F +  P ++ +L+ L   D 
Sbjct  183  GSWPVLEYLAVSGNELVGKIPPEIGNLTTLKELYIGYYNAFENGLPPEIGKLSELVRFDA  242

Query  439  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N  +G IP
Sbjct  243  ANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIP  300


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 63/124 (51%), Gaps = 6/124 (5%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            GV+S ++GQ+      S++ N LSGP+PP I   S ++ L L  N FG   P ++ +L  
Sbjct  448  GVVSVNLGQI------SLSNNHLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQ  501

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L  LD  +N   G +  E+ +   L  + L  N  SG IP E      L YL +S N L 
Sbjct  502  LSKLDFSHNLFPGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLL  561

Query  601  GVIP  612
            G IP
Sbjct  562  GSIP  565


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L  ++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGTLPVNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  425

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L  ++L +N LTG+LP+    ++ +L  + L  N+ SG +PP  G F  ++ L + G
Sbjct  426  LPKLSQVELQDNYLTGELPIGGGVVSVNLGQISLSNNHLSGPLPPAIGNFSGVQKLLLDG  485

Query  589  NGLSGVIP  612
            N   G IP
Sbjct  486  NKFGGPIP  493



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            ++E  ALLS+++  T  +   L+SWN S  +C+W  VTCD+  HV +L+L+GL+LSG LS
Sbjct  25   ISEYRALLSLRSVITDATPPVLSSWNASIPYCSWLGVTCDNRRHVTALNLTGLDLSGTLS  84

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             DV  LPFL NLS+AAN+ SGP+PP +SA+S LR+LNLSNN+F  TFP +L +L +L+VL
Sbjct  85   ADVAHLPFLSNLSLAANKFSGPIPPSLSALSGLRYLNLSNNVFNETFPSELWRLQSLEVL  144

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TG LP+ V +M +LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN L G IP
Sbjct  145  DLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELDGTIP  204


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG LSP +G    +  L +  N  +G +P +I  +  L  ++ S N F      +++Q 
Sbjct  464  LSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQC  523

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  524  KLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHLVGSIPSSISSMQSLTSVDFSYNN  583

Query  595  LSGVIP  612
            LSG++P
Sbjct  584  LSGLVP  589


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGEL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N L G +P  + ++ +L  + L  N  +G IP   G+   L  + +S N 
Sbjct  308  KNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNLTGSIPEGLGKNGRLNLVDLSSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGTLP  373


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+V+ L+ NNLTG +P  + K   L  + L  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVVQLWENNLTGSIPEGLGKNGRLNLVDLSSNKLTGTLPPYLCSGNTLQTLITLGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGPIP  397


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 65/125 (52%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G + P++G L  LV L +A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDVAYCALSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P LE + +  N L
Sbjct  285  SLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNL  344

Query  598  SGVIP  612
            +G IP
Sbjct  345  TGSIP  349


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++GVL   V Q+  L +L +  N  SG +PPE      L++L +S N    T P ++  
Sbjct  150  NMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELDGTIPPEIGN  209

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L +L+ L + Y N  TG +P E+  ++ L  L +     SG IP   G+   L+ L +  
Sbjct  210  LTSLRELYIGYYNTYTGGIPPEIGNLSELVRLDVAYCALSGEIPAALGKLQKLDTLFLQV  269

Query  589  NGLSG  603
            N LSG
Sbjct  270  NALSG  274


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 1/121 (1%)
 Frame = +1

Query  253  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            P+VG +   L  ++++ NQLSG + P I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  445  PEVGSVAVNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSK  504

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L YL +S N L G I
Sbjct  505  IDFSGNKFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHLVGSI  564

Query  610  P  612
            P
Sbjct  565  P  565


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGTCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G L   +   +S++ L L GN F+GRIP + GR   L  +  SGN 
Sbjct  452  VNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNK  511

Query  595  LSGVI  609
             SG I
Sbjct  512  FSGPI  516


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG  P   S    L  + LSNN         +   
Sbjct  416  LNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGALSPSIGNF  475

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            +++Q L L  N  TG +P ++ ++  L  +   GN FSG I PE  +   L +L +S N 
Sbjct  476  SSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQCKLLTFLDLSRNE  535

Query  595  LSGVIP  612
            LSG IP
Sbjct  536  LSGDIP  541



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   206 bits (524),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 133/182 (73%), Gaps = 2/182 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            +TE  ALLS+K++ T D  S L SWN+ST+ C+W  VTCD     V+      L+LSG L
Sbjct  22   ITELQALLSLKSSLTGDEHSPLNSWNLSTTFCSWTGVTCDVSRRHVTSLDLSGLDLSGTL  81

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  426
            S DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L NL+
Sbjct  82   SSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRHLNLSNNVFNGSYPDELSSGLVNLR  141

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTG LP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L G 
Sbjct  142  VLDLYNNNLTGVLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELIGK  201

Query  607  IP  612
            IP
Sbjct  202  IP  203


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++ SNN+F    P   A+L
Sbjct  247  LTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNNMFTGEIPASFAEL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGENGRLVILDLSSNK  366

Query  595  LSGVIP  612
            L+G +P
Sbjct  367  LTGTLP  372


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  463  LSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  522

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  523  KLLTFVDLSRNELSGDIPNEITGMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNN  582

Query  595  LSGVIP  612
            LSG++P
Sbjct  583  LSGLVP  588


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  227  LPPEIGNLSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLK  286

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +D  NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  287  SMDFSNNMFTGEIPASFAELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGG  346

Query  607  IP  612
            IP
Sbjct  347  IP  348


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +    G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  
Sbjct  174  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGN  233

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG +P E+ K+ +L  L L  N F+G +  E G   +L+ +  S N
Sbjct  234  LSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNN  293

Query  592  GLSGVIP  612
              +G IP
Sbjct  294  MFTGEIP  300


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P        L  ++LSNN      P  +   
Sbjct  415  LNGSIPKGLFGLPKLSQVELQDNYLTGGLPISGGVSGDLGQISLSNNQLSGPLPAAIGNF  474

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N   G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N 
Sbjct  475  SGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  534

Query  595  LSGVIP  612
            LSG IP
Sbjct  535  LSGDIP  540


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  391  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLTGGLPISGGVS  450

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN L+G LP  +   + ++ L L GN F+G IPPE GR   L  L  S N 
Sbjct  451  GDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNL  510

Query  595  LSGVI  609
             SG I
Sbjct  511  FSGRI  515


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F    P +L + 
Sbjct  295  FTGEIPASFAELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGEN  354

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +LDL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  355  GRLVILDLSSNKLTGTLPPNMCSGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGENF  414

Query  595  LSGVIP  612
            L+G IP
Sbjct  415  LNGSIP  420


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     LV L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGTLPPNMCSGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  425

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG LP+       L  + L  N  SG +P   G F  ++ L + GN
Sbjct  426  LPKLSQVELQDNYLTGGLPISGGVSGDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDGN  485

Query  592  GLSGVIP  612
              +G IP
Sbjct  486  KFAGPIP  492


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 69/128 (54%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   LV L +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  342  NFTGGIPQKLGENGRLVILDLSSNKLTGTLPPNMCSGNRLVTLITLGNFLFGS-IPDSLG  400

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  401  KCESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLTGGLPISGGVSGDLGQISLSN  460

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  461  NQLSGPLP  468



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            V+E  ALLSIK++ T D QS L++WN +T  C+W  +TCD     V+      LNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTTPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            S DV  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDVAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG LP+ V +M +LRHLHLGGNY+SG+IP EYG++  LEYLA+SGN L G I
Sbjct  148  LDLYNNNMTGGLPLTVVEMPNLRHLHLGGNYYSGKIPSEYGKWGFLEYLAISGNELEGSI  207

Query  610  P  612
            P
Sbjct  208  P  208


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP   G+   LE L +S N 
Sbjct  312  KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQNGKLEILDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN T  +P  + +   L  L L  N  +G +PP      NL+ L    N 
Sbjct  336  PELQVLQLWENNFTSTIPQALGQNGKLEILDLSSNKLTGTLPPNMCLGNNLQTLITLSNF  395

Query  595  LSGVIP  612
            L G IP
Sbjct  396  LFGPIP  401


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLVGSIPAPIATMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609

Query  592  -GLSG  603
             GL G
Sbjct  610  PGLCG  614


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  396  LFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLA  455

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  L L NN LTG LP  V   + ++   L GN FSG IPPE GR   L  +  S N 
Sbjct  456  VNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDGNKFSGSIPPEIGRLQQLTKMDFSHNK  515

Query  595  LSGVI  609
             SG I
Sbjct  516  FSGPI  520


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L++LDL +N LTG LP  +    +L+ L    N+  G IP   G+  +L  + +  N 
Sbjct  360  GKLEILDLSSNKLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENF  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFD  430

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  ++L +N L G+ PV      +L  L L  N  +G +PP  G F  ++   + GN
Sbjct  431  LPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDGN  490

Query  592  GLSGVIP  612
              SG IP
Sbjct  491  KFSGSIP  497


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   +    L  L+LSNN    + P  +   
Sbjct  420  LNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNF  479

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q   L  N  +G +P E+ ++  L  +    N FSG I PE  +   L ++ +S N 
Sbjct  480  SGVQKFLLDGNKFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNE  539

Query  595  LSGVIP  612
            LSG IP
Sbjct  540  LSGEIP  545



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCds-llhvvsldlsglNLSGV  246
            ++E   LLS K++  T D   SL SWN ST+HC+W  +TC     HV S+DLS L L+  
Sbjct  22   ISEHKTLLSFKSSSITDDPTHSLISWNSSTTHCSWHGITCTGPHRHVTSIDLSSLTLTAT  81

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            LS  +  LPFL NLS+A N+ SGP+PP  S++ +LRFLNLSNN+F  TFP QL++L+NL 
Sbjct  82   LSDHLSNLPFLSNLSLADNKFSGPIPPSFSSLYSLRFLNLSNNVFNGTFPSQLSRLSNLH  141

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNN+TG LP+ V +M +LRHLHLGGN+F+G+IPPEYG +P+LEYLAVSGN LSG 
Sbjct  142  VLDLYNNNMTGTLPLSVTRMQNLRHLHLGGNFFTGKIPPEYGTWPHLEYLAVSGNELSGP  201

Query  607  IP  612
            IP
Sbjct  202  IP  203


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN F    P   A+L
Sbjct  247  LTGEIPPELGKLQNLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAEL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + +M +L  L +  N F+G IP   G+   L  + VS N 
Sbjct  307  KNLTLLNLFRNKLHGAIPEFIGEMPALEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNK  366

Query  595  LSGVIP  612
            L+G +P
Sbjct  367  LTGSLP  372


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 2/127 (2%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N   G VP   + +  L  LNL  N      P  + ++
Sbjct  271  LSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAELKNLTLLNLFRNKLHGAIPEFIGEM  330

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSGN  591
              L+VL ++ NN TG +P  + K   L  + +  N  +G +PP Y  F N L+ L   GN
Sbjct  331  PALEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPP-YMCFGNKLQTLITLGN  389

Query  592  GLSGVIP  612
             L G IP
Sbjct  390  FLFGPIP  396


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  391  LFGPIPDSLGKCESLSRIRMGENFLNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMS  450

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   TS++ L L GN F+G+IP E G+   L  +  S N 
Sbjct  451  PNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIPSEIGKLQQLSKIDFSHNK  510

Query  595  LSGVI  609
             SG I
Sbjct  511  FSGPI  515


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG  P  +S    L  + LSNN      P  +   
Sbjct  415  LNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNF  474

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             ++Q L L  N  TG +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  475  TSVQKLLLDGNQFTGKIPSEIGKLQQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNE  534

Query  595  LSGVIP  612
            LSG IP
Sbjct  535  LSGEIP  540


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG     V   P L  ++++ N+LSGP+P  I   ++++ L L  N F    P ++ +L
Sbjct  439  LSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIPSEIGKL  498

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N 
Sbjct  499  QQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  558

Query  595  LSGVIP  612
            L G IP
Sbjct  559  LVGTIP  564


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +  ++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  487  FTGKIPSEIGKLQQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGM  546

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L  L+L  N+L G +P  +  M SL  +    N  +G +P   G+F    Y +  GN
Sbjct  547  RILNYLNLSRNHLVGTIPGSIASMQSLTSVDFSYNNLTGLVPGT-GQFSYFNYTSFLGN  604



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 136/184 (74%), Gaps = 4/184 (2%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  243
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  23   ITEFNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  82

Query  244  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  420
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L+VLDLYNNNLTGDLP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L+
Sbjct  143  LRVLDLYNNNLTGDLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELT  202

Query  601  GVIP  612
            G IP
Sbjct  203  GKIP  206


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGTLP  375


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             LSG L   +G    +  L +  N+ +GP+PP+I  +  L  L+ S+N+F      ++++
Sbjct  465  KLSGSLPAAIGNFSGVQKLLLDGNKFTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISR  524

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  525  CKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYN  584

Query  592  GLSGVIP  612
             LSG++P
Sbjct  585  NLSGLVP  591


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L   D  N  LTG +P E+ K+ +L  L L  N FSG +  E G   +L+ + +S N
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNN  296

Query  592  GLSGVIP  612
              +G IP
Sbjct  297  MFTGEIP  303


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  230  LPPEIGNLTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLK  289

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  290  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGG  349

Query  607  IP  612
            IP
Sbjct  350  IP  351


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P      S L  ++LSNN    + P  +   
Sbjct  418  LNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNKLSGSLPAAIGNF  477

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  TG +P ++ ++  L  L    N FSGRI PE  R   L ++ +S N 
Sbjct  478  SGVQKLLLDGNKFTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  537

Query  595  LSGVIP  612
            LSG IP
Sbjct  538  LSGDIP  543


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  394  LFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVS  453

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L  + L NN L+G LP  +   + ++ L L GN F+G IPP+ GR   L  L  S N 
Sbjct  454  SDLGQVSLSNNKLSGSLPAAIGNFSGVQKLLLDGNKFTGPIPPDIGRLQQLSKLDFSHNL  513

Query  595  LSGVI  609
             SG I
Sbjct  514  FSGRI  518


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFG  428

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+LP+     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  429  LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNKLSGSLPAAIGNFSGVQKLLLDGN  488

Query  592  GLSGVIP  612
              +G IP
Sbjct  489  KFTGPIP  495


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 67/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  408
            N +G +   +G    LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  345  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  403

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  404  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSN  463

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  464  NKLSGSLP  471



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 134/186 (72%), Gaps = 6/186 (3%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  237
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  414
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  595  LSGVIP  612
            L G IP
Sbjct  203  LVGKIP  208


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  351

Query  607  IP  612
            IP
Sbjct  352  IP  353


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  592  GLSGVIP  612
              +G IP
Sbjct  299  MFTGEIP  305


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 54/115 (47%), Gaps = 0/115 (0%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            LP L  + +  N LSG +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
               G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N LSG IP
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIP  545


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  595  LSGVIP  612
            L G IP
Sbjct  564  LLGSIP  569


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N   ++ P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNASIPKGLFG  430

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  592  GLSGVIP  612
               G IP
Sbjct  491  KFEGQIP  497


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGQNF  419

Query  595  LSGVIP  612
            L+  IP
Sbjct  420  LNASIP  425


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+  +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRMGQNFLNASIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  455

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   T ++ L L GN F G+IP E G+   L  +  S N 
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNL  515

Query  595  LSGVI  609
             SG I
Sbjct  516  FSGRI  520


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 67/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L   +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGQNFLNASIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  466  NQLSGPLP  473



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 134/186 (72%), Gaps = 6/186 (3%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  237
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  414
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  595  LSGVIP  612
            L G IP
Sbjct  203  LVGKIP  208


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  351

Query  607  IP  612
            IP
Sbjct  352  IP  353


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  592  GLSGVIP  612
              +G IP
Sbjct  299  MFTGEIP  305


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  480  TGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  539

Query  595  LSGVIP  612
            LSG IP
Sbjct  540  LSGEIP  545


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  595  LSGVIP  612
            L G IP
Sbjct  564  LLGSIP  569


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRIGQNF  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + I  N L+G +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRIGQNFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  455

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   T ++ L L GN F G+IP E G+   L  +  S N 
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNL  515

Query  595  LSGVI  609
             SG I
Sbjct  516  FSGRI  520


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRIGQNFLNGSIPKGLFG  430

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  592  GLSGVIP  612
               G IP
Sbjct  491  KFEGQIP  497


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 68/128 (53%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRIGQNFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  466  NQLSGPLP  473



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 140/181 (77%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  249
            VTE  AL+++K++ T D QS L++WN ST  C++  VTCD    HV S+DL+ + L+G L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNASTPLCSFAGVTCDLTGRHVTSIDLTNVTLAGTL  86

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SP +  L FL NLS+A N LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAGNDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG I
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKI  206

Query  610  P  612
            P
Sbjct  207  P  207


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGRIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  226  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  285

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ +DL NN  TG++P    ++ +L  L+L  N   GRIP   G  P LE L +  N
Sbjct  286  LNSLKSMDLSNNMFTGEIPASFAQLKNLTLLNLFRNKLHGRIPDFIGELPELEVLQLWEN  345

Query  592  GLSGVIP  612
              +G IP
Sbjct  346  NFTGSIP  352


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N      P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ NQLSG +P  +   S ++ L L  N F    P ++ +L  L  +D  +N L+
Sbjct  458  LGQISLSNNQLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLS  517

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +P E+ K   L  + L GN  SGRIP E      L YL +S N L G IP
Sbjct  518  GLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIP  569


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  444
            LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +   + +Q L L  
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  445  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N  +G +P E+ K+  L  +    N  SG IPPE  +   L ++ +SGN LSG IP
Sbjct  490  NKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKCKLLTFVDLSGNELSGRIP  545


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLG  429

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L  ++L +N LTG+ PV    +++ L  + L  N  SG +P   G F  ++ L + G
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  589  NGLSGVIP  612
            N  SG IP
Sbjct  490  NKFSGPIP  497



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 140/181 (77%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  249
            VTE +AL+++K++ T D QS L++WN +T  C++  V CD    HV S+DL+   LSG L
Sbjct  27   VTELSALIAVKSSITDDPQSYLSNWNANTPLCSFAGVACDLTGRHVTSIDLTNFTLSGTL  86

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SP +  L FL NLS+AAN LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAANDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG I
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKI  206

Query  610  P  612
            P
Sbjct  207  P  207


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P+VG+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  444
            LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +   + +Q L L  
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  445  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N  +G +P E+ K+  L  +    N FSG IPPE  +   L ++ +S N LSG IP
Sbjct  490  NKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKCKLLTFVDLSRNELSGQIP  545


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLG  429

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L  ++L +N LTG+ PV    ++ +L  + L  N  SG +P   G F  ++ L + G
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  589  NGLSGVIP  612
            N  SG IP
Sbjct  490  NKFSGPIP  497



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   204 bits (518),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 133/181 (73%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            V+E  ALLSIK++ T D QS L++WN +   C+W  +TCD     V+      LNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTAPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            S D+  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDIAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG LP+ V +M +LRHLHLGGNY+SG+IP EYG++  LEYLA+SGN L G I
Sbjct  148  LDLYNNNMTGGLPLTVVEMPNLRHLHLGGNYYSGKIPSEYGKWEFLEYLAISGNELEGSI  207

Query  610  P  612
            P
Sbjct  208  P  208


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP   G+   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQNGKLQILDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLVGSIPSPIATMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609

Query  592  -GLSG  603
             GL G
Sbjct  610  PGLCG  614


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +GQ   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  396  LFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLA  455

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  L L NN LTG LP  V   + ++ L L GN FSG IPPE GR   L  +  S N 
Sbjct  456  VNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLTKMDFSHNK  515

Query  595  LSGVI  609
             SG I
Sbjct  516  FSGPI  520


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN T  +P  + +   L+ L L  N  +G +PP      NL+ L    N 
Sbjct  336  PELQVLQLWENNFTSTIPQALGQNGKLQILDLSSNKLTGTLPPNMCLGNNLQTLITLSNF  395

Query  595  LSGVIP  612
            L G IP
Sbjct  396  LFGPIP  401


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP  +    +L+ L    N+  G IP   G+  +L  + +  N 
Sbjct  360  GKLQILDLSSNKLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENF  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFD  430

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  ++L +N L G+ PV      +L  L L  N  +G +PP  G F  ++ L + GN
Sbjct  431  LPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDGN  490

Query  592  GLSGVIP  612
              SG IP
Sbjct  491  KFSGSIP  497


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   +    L  L+LSNN    + P  +   
Sbjct  420  LNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNF  479

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P E+ ++  L  +    N FSG I PE  +   L ++ +S N 
Sbjct  480  SGVQKLLLDGNKFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNE  539

Query  595  LSGVIP  612
            LSG IP
Sbjct  540  LSGEIP  545



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 134/184 (73%), Gaps = 4/184 (2%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSL-TSWNIS-TSHCTWRRVTCdsllhvvsldlsg-lNLSG  243
            +TE  ALLS+K++ T D  S L TSWN+S T+ C+W  V CD     V+      LNLSG
Sbjct  23   ITELNALLSLKSSLTGDDHSPLLTSWNLSSTTFCSWTGVKCDVSRRHVTSLDLSGLNLSG  82

Query  244  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  420
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISKLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L+VLDLYNNNLTGDLP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L 
Sbjct  143  LRVLDLYNNNLTGDLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELI  202

Query  601  GVIP  612
            G IP
Sbjct  203  GKIP  206


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  +GP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGTLP  375


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  466  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  525

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  526  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNN  585

Query  595  LSGVIP  612
            LSG++P
Sbjct  586  LSGLVP  591


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  230  LPPEIGNLTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLK  289

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  290  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGG  349

Query  607  IP  612
            IP
Sbjct  350  IP  351


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L   D  N  LTG +P E+ K+ +L  L L  N F+G +  E G   +L+ + +S N
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNN  296

Query  592  GLSGVIP  612
              +G IP
Sbjct  297  MFTGEIP  303


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P      S L  ++LSNN    + P  +   
Sbjct  418  LNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNQLSGSLPAAIGNF  477

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N   G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N 
Sbjct  478  SGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  537

Query  595  LSGVIP  612
            LSG IP
Sbjct  538  LSGDIP  543


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  394  LFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVS  453

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L  + L NN L+G LP  +   + ++ L L GN F+G IPPE GR   L  L  S N 
Sbjct  454  SDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNL  513

Query  595  LSGVI  609
             SG I
Sbjct  514  FSGRI  518


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFG  428

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+LP+     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  429  LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  488

Query  592  GLSGVIP  612
              +G IP
Sbjct  489  KFAGPIP  495


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 67/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  408
            N +G +   +G    LV L +++N+L+G +PP + S    +  + L N +FGS  P  L 
Sbjct  345  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGS-IPDSLG  403

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  404  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSN  463

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  464  NQLSGSLP  471



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 134/186 (72%), Gaps = 6/186 (3%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  237
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  414
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPLYGSWPVIEYLAVSGNE  202

Query  595  LSGVIP  612
            L G IP
Sbjct  203  LVGKIP  208


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPEKLGENGKLNLVDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  351

Query  607  IP  612
            IP
Sbjct  352  IP  353


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPLYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNN  298

Query  592  GLSGVIP  612
              +G IP
Sbjct  299  MFTGEIP  305


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  +    N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  480  TGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  539

Query  595  LSGVIP  612
            LSG IP
Sbjct  540  LSGEIP  545


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  595  LSGVIP  612
            L G IP
Sbjct  564  LLGSIP  569


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPEKLGEN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFVFGSIPESLGKCESLTRIRMGQNF  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N + G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFVFGSIPESLGKCESLTRIRMGQNFLNGSIPKGLFG  430

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++  +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  592  GLSGVIP  612
               G IP
Sbjct  491  KFEGQIP  497


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 67/128 (52%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPEKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFVFGS-IPESLG  405

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  +    NY SG +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGQNFLNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSN  465

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  466  NQLSGPLP  473


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 55/123 (45%), Gaps = 0/123 (0%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G +   +G+   L  + +  N L+G +P  +  +  L  +   +N      P       N
Sbjct  398  GSIPESLGKCESLTRIRMGQNFLNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVN  457

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L  + L NN L+G LP  +   T ++ L L GN F G+IP E G+   L  +  S N  S
Sbjct  458  LGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNLFS  517

Query  601  GVI  609
            G I
Sbjct  518  GRI  520



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            V+E  ALLS+K + T D +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LS
Sbjct  26   VSEYRALLSLKTSITGDPKSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLS  85

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
            PDV  L FL NLS+AAN+ SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VL
Sbjct  86   PDVAFLRFLTNLSLAANEFSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVL  145

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TGD P+ V +M+ LRHLHLGGN+F+GRIPPE GR  +LEYLAVSGN LSG IP
Sbjct  146  DLYNNNMTGDFPIVVTQMSGLRHLHLGGNFFAGRIPPEVGRMQSLEYLAVSGNELSGSIP  205


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  249  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+  IP   G+   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGTLP  374


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  488  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  547

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  MRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  606


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL 
Sbjct  226  DGGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLN  285

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ LDL NN L G++PV   ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  286  SLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNF  345

Query  598  SGVIP  612
            +  IP
Sbjct  346  TEAIP  350


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  273  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  332

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN T  +P  + K   L+ L L  N  +G +PP+      L+ L    N 
Sbjct  333  PKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNKLTGTLPPDMCFGNRLQILIALSNF  392

Query  595  LSGVIP  612
            L G IP
Sbjct  393  LFGPIP  398


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGKCVSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPPE GR   L  +  S N 
Sbjct  453  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPPEIGRLQQLSKIDFSSNM  512

Query  595  LSGVI  609
            LSG I
Sbjct  513  LSGPI  517


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 63/130 (48%), Gaps = 6/130 (5%)
 Frame = +1

Query  232  NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  402
             L+G L PD+    +L  L+ LS   N L GP+P  +    +L  + +  N    + P  
Sbjct  368  KLTGTLPPDMCFGNRLQILIALS---NFLFGPIPESLGKCVSLNRIRMGENFLNGSIPKG  424

Query  403  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  582
            L  L  L  ++L +N L+G+ P+      +L  + L  N  +G IPP  G F  ++ L +
Sbjct  425  LLSLPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLL  484

Query  583  SGNGLSGVIP  612
             GN  SG IP
Sbjct  485  DGNKFSGQIP  494



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 133/185 (72%), Gaps = 5/185 (3%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLS  240
            ++E  ALLS+K + T    D  S L+SW +STS CTW  VTCD     V+      LNLS
Sbjct  23   ISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWIGVTCDVSRRHVTSLDLSGLNLS  82

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  417
            G LSPDV  L  L NLS+A N +SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLAENLISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN L
Sbjct  143  NLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNEL  202

Query  598  SGVIP  612
             G IP
Sbjct  203  VGKIP  207


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  290

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  350

Query  607  IP  612
            IP
Sbjct  351  IP  352


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 68/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  238  LSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  297

Query  592  GLSGVIP  612
              +G IP
Sbjct  298  MFTGEIP  304


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  526

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  527  KLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNN  586

Query  595  LSGVIP  612
            LSG++P
Sbjct  587  LSGLVP  592


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  449  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKL  502

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  503  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNH  562

Query  595  LSGVIP  612
            L G IP
Sbjct  563  LVGSIP  568


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  419  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  478

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  479  TGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  538

Query  595  LSGVIP  612
            LSG IP
Sbjct  539  LSGEIP  544


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  358

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  359  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENF  418

Query  595  LSGVIP  612
            L+G IP
Sbjct  419  LNGSIP  424


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  429

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  592  GLSGVIP  612
               G IP
Sbjct  490  KFQGPIP  496


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 68/128 (53%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  404

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  405  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  464

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  465  NQLSGPLP  472


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  395  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  454

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N 
Sbjct  455  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNL  514

Query  595  LSGVI  609
             SG I
Sbjct  515  FSGRI  519



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  249
            VTE  AL+++K++ T D QS L++WN +T  C++  VTCD    HV S+DL+   LSG L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNATTPLCSFAGVTCDLTGRHVTSIDLTNFTLSGTL  86

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SP +  L FL NLS+A N L+GP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  87   SPSLAHLRFLQNLSVADNNLTGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQV  146

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN LSG I
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNELSGKI  206

Query  610  P  612
            P
Sbjct  207  P  207


 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G +P E+  M  L  L+L  N+  G IP       +L  +  S N 
Sbjct  528  ELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTMQSLTSVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L NN     FP   + +
Sbjct  395  LFGSIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQNNYLTGEFPVTDSSI  454

Query  415  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            + NL  + L NN L+G LP  +   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  455  SVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHN  514

Query  592  GLSGVIP  612
              SG+IP
Sbjct  515  KFSGLIP  521


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 58/116 (50%), Gaps = 1/116 (1%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  444
            LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +   + +Q L L  
Sbjct  430  LPQLTQVELQNNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDG  489

Query  445  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N  +G +P E+  +  L  +    N FSG IPPE  +   L ++ +S N LSG IP
Sbjct  490  NKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPPEICKCELLTFVDLSRNELSGRIP  545



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 134/185 (72%), Gaps = 5/185 (3%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLS  240
            ++E  ALLS+K++ T    D  S L+SW +STS CTW  VTCD     V+      LNLS
Sbjct  23   ISEFRALLSLKSSLTGAGDDINSPLSSWKVSTSFCTWTGVTCDVSRRHVTSLDLSGLNLS  82

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  417
            G LSPDV  L  L NLS+A NQ+SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLADNQISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+ +IPP YG +P +EYLAVSGN L
Sbjct  143  NLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAEKIPPSYGSWPVIEYLAVSGNEL  202

Query  598  SGVIP  612
             G IP
Sbjct  203  VGKIP  207


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SG +  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGTIPQKLGENGKLNLVDLSSNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F  +   +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLK  290

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGT  350

Query  607  IP  612
            IP
Sbjct  351  IP  352


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = +1

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQV  429
            P  G  P +  L+++ N+L G +PPEI  + TLR L +   N F    P ++  L+ L  
Sbjct  184  PSYGSWPVIEYLAVSGNELVGKIPPEIGNLKTLRELYIGYYNAFEDGLPPEIGNLSELVR  243

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
             D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N  +G I
Sbjct  244  FDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEI  303

Query  610  P  612
            P
Sbjct  304  P  304


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  526

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N   G IP       +L  L  S N 
Sbjct  527  KLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNNLVGSIPGSISSMQSLTSLDFSYNN  586

Query  595  LSGVIP  612
            LSG++P
Sbjct  587  LSGLVP  592


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  449  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  502

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  503  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNN  562

Query  595  LSGVIP  612
            L G IP
Sbjct  563  LVGSIP  568


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  419  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  478

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  479  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  538

Query  595  LSGVIP  612
            LSG IP
Sbjct  539  LSGEIP  544


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  T P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGTIPQKLGEN  358

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  359  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENF  418

Query  595  LSGVIP  612
            L+G IP
Sbjct  419  LNGSIP  424


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  429

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  592  GLSGVIP  612
               G IP
Sbjct  490  KFEGPIP  496


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 68/128 (53%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGTIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  404

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG +P   G   NL  +++S 
Sbjct  405  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSN  464

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  465  NQLSGPLP  472


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  395  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  454

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N 
Sbjct  455  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNL  514

Query  595  LSGVI  609
             SG I
Sbjct  515  FSGRI  519



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 133/186 (72%), Gaps = 6/186 (3%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  237
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  414
            SG LSPDV  L  L NLS+A NQ+SGP+P EIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPTEISNLSGLRHLNLSNNVFNGSFPDELSYGL  142

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143  VNLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  595  LSGVIP  612
            L G IP
Sbjct  203  LVGKIP  208


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGS  351

Query  607  IP  612
            IP
Sbjct  352  IP  353


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298

Query  592  GLSGVIP  612
              +G IP
Sbjct  299  MFTGEIP  305


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  468  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  528  KLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 7/124 (6%)
 Frame = +1

Query  262  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            GQLP        L  +S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L  
Sbjct  446  GQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQ  505

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L 
Sbjct  506  LSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHLV  565

Query  601  GVIP  612
            G IP
Sbjct  566  GSIP  569


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  480  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  539

Query  595  LSGVIP  612
            LSG IP
Sbjct  540  LSGEIP  545


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGSIPQKLGEN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENF  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  430

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  592  GLSGVIP  612
               G IP
Sbjct  491  KFEGPIP  497


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 69/128 (54%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGS-IPDSLG  405

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG++P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSN  465

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  466  NQLSGPLP  473


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGQLPVAGGVS  455

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N 
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNL  515

Query  595  LSGVI  609
             SG I
Sbjct  516  FSGRI  520



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 140/183 (77%), Gaps = 3/183 (2%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGV  246
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTCD     V SLDLS LNLSG 
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTCDVSRRHVTSLDLSSLNLSGT  82

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANL  423
            LSPDV  LP L NLS+A NQ+SGP+PPEIS +S LR LNLSNNIF  +FP ++ A LANL
Sbjct  83   LSPDVSHLPLLQNLSLADNQISGPIPPEISNLSGLRHLNLSNNIFNGSFPGEISAGLANL  142

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
            +VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L+G
Sbjct  143  RVLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNELTG  202

Query  604  VIP  612
             IP
Sbjct  203  KIP  205


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  249  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  309  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGTLP  374


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  229  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  288

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N  +G 
Sbjct  289  SMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGS  348

Query  607  IP  612
            IP
Sbjct  349  IP  350


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  465  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISRC  524

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  525  KLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNN  584

Query  595  LSGVIP  612
            LSG++P
Sbjct  585  LSGLVP  590


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  235

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  236  LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  295

Query  592  GLSGVIP  612
              +G IP
Sbjct  296  MFTGEIP  302


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  273  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  332

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  333  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  392

Query  595  LSGVIP  612
            L G IP
Sbjct  393  LFGSIP  398


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFG  427

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  428  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  487

Query  592  GLSGVIP  612
               G IP
Sbjct  488  KFEGPIP  494


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  447  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRL  500

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  501  QQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNH  560

Query  595  LSGVIP  612
            L G IP
Sbjct  561  LIGSIP  566


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P   S    L  L+LSNN      P  +   
Sbjct  417  LNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNF  476

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV ++  L  +    N FSG I PE  R   L ++ +S N 
Sbjct  477  TGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNE  536

Query  595  LSGVIP  612
            LSG IP
Sbjct  537  LSGEIP  542


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  297  FTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  356

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  357  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENF  416

Query  595  LSGVIP  612
            L+G IP
Sbjct  417  LNGSIP  422


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P   +  
Sbjct  393  LFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVS  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  L L NN L+G LP  +   T ++ L L GN F G IP E GR   L  +  S N 
Sbjct  453  VNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHNL  512

Query  595  LSGVI  609
             SG I
Sbjct  513  FSGGI  517



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  249
            V+E  ALL++K++ T D QS L++WN +T  C++  VTCD    HV SL+LS  NLSG L
Sbjct  24   VSEFQALLAVKSSITDDPQSYLSNWNATTPLCSFTGVTCDYTGRHVTSLNLSYFNLSGTL  83

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84   SPSFSHLQFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG+LP+ V  + +LRHLHLGGN+F+G+IP  YGR+ +LEYLAVSGN L G I
Sbjct  144  LDLYNNNMTGELPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEYLAVSGNELGGRI  203

Query  610  P  612
            P
Sbjct  204  P  204


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNK  367

Query  595  LSGVIP  612
            L+G++P
Sbjct  368  LTGILP  373


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGEL  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      L  L   GN 
Sbjct  332  PELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNKLTGILPPDMCSGNTLHTLITLGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGSIP  397


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F       +++ 
Sbjct  465  LSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFSGPVAPGISKC  524

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTMQSLTSVDFSYNN  584

Query  595  LSGVIP  612
            LSG++P
Sbjct  585  LSGLVP  590


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G+L PD+     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGILPPDMCSGNTLHTLITLGNFLFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFG  426

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L  ++L +N LTG+ PV    ++ +L  + L  N  SG +P   G F  ++ L + G
Sbjct  427  LPKLTQVELQDNYLTGEFPVTDSSISLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDG  486

Query  589  NGLSGVIP  612
            N  SG IP
Sbjct  487  NKFSGPIP  494


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSGP+P  +   S ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  455  LGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFS  514

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +   + K   L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  515  GPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIP  566


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  392  LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  415  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  452  SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511

Query  592  GLSGVI  609
              SG +
Sbjct  512  KFSGPV  517



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 141/181 (78%), Gaps = 2/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVL  249
            ++E  ALLS+KAA   D QS+L SWN S S C+W  VTCD S  HV SLDLS LNLSG+L
Sbjct  23   MSEYQALLSVKAAID-DPQSALVSWNSSNSLCSWSGVTCDPSGRHVTSLDLSSLNLSGIL  81

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            S D+  L +L NL++AANQLSGP+PP++SAI  LR LNLSNN+F  TFP QL+QL NLQV
Sbjct  82   SSDIAHLRYLQNLTLAANQLSGPIPPQLSAIPGLRSLNLSNNVFNGTFPSQLSQLKNLQV  141

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+T  LP+ V  M +LRHLHLGGN+FSG+IPPEYG++  LEYLA+SGN L G I
Sbjct  142  LDLYNNNMTDVLPLAVTDMPNLRHLHLGGNFFSGKIPPEYGKWEFLEYLAISGNELVGPI  201

Query  610  P  612
            P
Sbjct  202  P  202


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   ++L
Sbjct  246  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSEL  305

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+  NL  L +S N 
Sbjct  306  KNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNFTGSIPQGLGKNGNLVLLDLSSNK  365

Query  595  LSGVIP  612
            L+G +P
Sbjct  366  LTGNLP  371


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG + P+ G+  FL  L+I+ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  173  FSGKIPPEYGKWEFLEYLAISGNELVGPIPPEIGNLTRLQQLYIGYYNSYEGGLPPEIGN  232

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L++L   D  N  L+G++P E+ K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  233  LSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKSLKSMDLSNN  292

Query  592  GLSGVIP  612
             L+G IP
Sbjct  293  MLTGEIP  299


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  223  EGGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLK  282

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  283  SLKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNF  342

Query  598  SGVIP  612
            +G IP
Sbjct  343  TGSIP  347


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      +++Q 
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQC  521

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLIGSIPSSIATMQSLTSVDFSYNN  581

Query  595  LSGVIP  612
            L+G++P
Sbjct  582  LTGLVP  587


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDL  329

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + K  +L  L L  N  +G +PP       L+ L    N 
Sbjct  330  PKLEVLQLWENNFTGSIPQGLGKNGNLVLLDLSSNKLTGNLPPNMCLGNRLQTLITLSNF  389

Query  595  LSGVIP  612
            L G IP
Sbjct  390  LFGPIP  395


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  390  LFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLTGEFPVTDTIA  449

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN FSG IPP+ GR   L  +  S N 
Sbjct  450  MNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNK  509

Query  595  LSGVI  609
             SG I
Sbjct  510  FSGPI  514


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365  KLTGNLPPNMCLGNRLQTLITLSNFLFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFG  424

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLSQVELQDNLLTGEFPVTDTIAMNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGN  484

Query  592  GLSGVIP  612
              SG IP
Sbjct  485  KFSGAIP  491


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L  N F    P Q+ +L  L  +D  +N  +
Sbjct  452  LGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFS  511

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  512  GPITPEISQCKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLIGSIP  563


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  294  LTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNFTGSIPQGLGKN  353

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +LDL +N LTG+LP  +     L+ L    N+  G IP   G+  +L  + +  N 
Sbjct  354  GNLVLLDLSSNKLTGNLPPNMCLGNRLQTLITLSNFLFGPIPESLGKCESLSRIRMGENF  413

Query  595  LSGVIP  612
            L+G IP
Sbjct  414  LNGSIP  419


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P   +    L  ++LSNN    + P  +   
Sbjct  414  LNGSIPKGLFGLPKLSQVELQDNLLTGEFPVTDTIAMNLGQISLSNNRLSGSLPPSIGNF  473

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N  +G +P ++ ++  L  +    N FSG I PE  +   L ++ +S N 
Sbjct  474  SGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQCKLLTFVDLSRNE  533

Query  595  LSGVIP  612
            LSG IP
Sbjct  534  LSGAIP  539



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 136/191 (71%), Gaps = 8/191 (4%)
 Frame = +1

Query  58   GKPLGVTEQAALLSIKAAFTADSQ----SSLTSWNISTSHCTWRRVTCdsllhvvsldls  225
            G+P  ++E  ALLSIK++ +        S L +WN ST+ C W  VTCD+    V     
Sbjct  22   GRP--ISEFRALLSIKSSLSGAGDGPNSSPLATWNDSTTFCAWTGVTCDASGRHVISLDL  79

Query  226  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  402
              LNLSG LSPD+  L  L NLS+A+NQ+SGP+PPE+S++S LR+LNLSNN+F  +FP +
Sbjct  80   SGLNLSGTLSPDIAHLFLLQNLSVASNQISGPIPPEVSSLSGLRYLNLSNNVFNGSFPDE  139

Query  403  L-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  579
            L A   NL+VLDLYNNNLTGDLPV V  +T LRHLHLGGNYF+GRIPP YG +P LEYLA
Sbjct  140  LSAGAVNLRVLDLYNNNLTGDLPVSVTNLTHLRHLHLGGNYFAGRIPPAYGSWPVLEYLA  199

Query  580  VSGNGLSGVIP  612
            VSGN L G IP
Sbjct  200  VSGNELVGKIP  210


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P+VG+L  L  L +  N LSGP+  E+  +S+L+ ++LSNN+F    P   AQL
Sbjct  254  LTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNNMFTGEIPASFAQL  313

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G+   L++L +S N 
Sbjct  314  KNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQKLGQNGKLQFLDLSSNK  373

Query  595  LSGVIP  612
            L+G +P
Sbjct  374  LTGTLP  379


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             +G + P  G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  181  FAGRIPPAYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  240

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG +P EV K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  241  LSELVRFDAANCGLTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNN  300

Query  592  GLSGVIP  612
              +G IP
Sbjct  301  MFTGEIP  307


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ +GP+PP++  +  L  +++S+N        +++Q 
Sbjct  470  LSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQC  529

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  530  KLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGPIPASVASMQSLTSVDFSYNN  589

Query  595  LSGVIP  612
            LSG++P
Sbjct  590  LSGLVP  595


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG ++ ++GQ+      S++ NQLSGP+PP I     ++ L L  N F    P Q+ +L
Sbjct  452  VSGRVAVNLGQI------SLSNNQLSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKL  505

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D+ +N L+G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  506  QQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  565

Query  595  LSGVIP  612
            L G IP
Sbjct  566  LVGPIP  571


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP      
Sbjct  398  LFGSIPDSLGECESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLSGEFPVSGRVA  457

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +     ++ L L GN F+G IPP+ G+   L  + +S N 
Sbjct  458  VNLGQISLSNNQLSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQ  517

Query  595  LSGVI  609
            LSG I
Sbjct  518  LSGRI  522


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG  P        L  ++LSNN      P  +   
Sbjct  422  LNGSIPKGLFGLPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSNNQLSGPLPPAIGNF  481

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N  TG +P +V K+  L  + +  N  SGRI PE  +   L ++ +S N 
Sbjct  482  YGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNE  541

Query  595  LSGVIP  612
            LSG IP
Sbjct  542  LSGEIP  547


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 68/128 (53%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +GQ   L  L +++N+L+G +PP + + + L+  + LSN +FGS  P  L 
Sbjct  349  NFTGSIPQKLGQNGKLQFLDLSSNKLTGTLPPNLCSGNKLQTLITLSNFLFGS-IPDSLG  407

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG  P       NL  +++S 
Sbjct  408  ECESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSN  467

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  468  NQLSGPLP  475


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L   +N L G +P  +    +L  + +  N    + P  L  
Sbjct  373  KLTGTLPPNLCSGNKLQTLITLSNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLFG  432

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  433  LPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSNNQLSGPLPPAIGNFYGVQKLLLDGN  492

Query  592  GLSGVIP  612
              +G IP
Sbjct  493  KFTGPIP  499



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 140/193 (73%), Gaps = 6/193 (3%)
 Frame = +1

Query  37   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvs  213
            H +GA       V E  ALL++K++ T D QS L++WN +   C++  VTCD    HV S
Sbjct  17   HCSGART-----VLEFQALLAVKSSITGDPQSYLSNWNATIPLCSFTGVTCDYTGRHVTS  71

Query  214  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  393
            LDLS  NLSG LSP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +F
Sbjct  72   LDLSYFNLSGTLSPSFSHLRFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSF  131

Query  394  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  573
            P QL+QL NLQVLDLYNNN+TGDLP+ V  + +LRHLHLGGN+F+G+IP  YGR+ +LEY
Sbjct  132  PTQLSQLKNLQVLDLYNNNMTGDLPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEY  191

Query  574  LAVSGNGLSGVIP  612
            LAVSGN L G IP
Sbjct  192  LAVSGNELGGRIP  204


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGTLP  373


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  223  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  282

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ +DL NN L G++P     + +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  283  LKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWEN  342

Query  592  GLSGVIP  612
              +G IP
Sbjct  343  NFTGSIP  349


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGEL  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  +     L+ L L  N  +G +PP+      L  L   GN 
Sbjct  332  PELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNKLTGTLPPDMCSGNTLHTLITLGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGSIP  397


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F       +++ 
Sbjct  465  LSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFSGPVAPGISKC  524

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTMQSLTSVDFSYNN  584

Query  595  LSGVIP  612
            LSG++P
Sbjct  585  LSGLVP  590


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 59/125 (47%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V  LP L +L +  N  +G +P        L +L +S N  G   P ++  
Sbjct  150  NMTGDLPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGN  209

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  LQ L + Y N+  G LP E+  ++ L          SG IPPE G+   L+ L +  
Sbjct  210  LEKLQELYIGYYNSFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQV  269

Query  589  NGLSG  603
            N LSG
Sbjct  270  NALSG  274


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L G +P  +    +L  + +  N    + P  L +
Sbjct  367  KLTGTLPPDMCSGNTLHTLITLGNFLFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFR  426

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L  ++L +N LTG+ PV    ++ +L  + L  N  SG +P   G F  ++ L + G
Sbjct  427  LPKLTQVELQDNYLTGEFPVTDSSISLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDG  486

Query  589  NGLSGVIP  612
            N  SG IP
Sbjct  487  NKFSGPIP  494


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSGP+P  +   S ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  455  LGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFS  514

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +   + K   L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  515  GPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIP  566


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  392  LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFRLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  415  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  452  SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511

Query  592  GLSGVI  609
              SG +
Sbjct  512  KFSGPV  517



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 136/191 (71%), Gaps = 7/191 (4%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  225
            AG+P  ++E  AL+S+K++ T    D  S L SW  STS CTW  VTCD     V+    
Sbjct  19   AGRP--ISELHALISLKSSLTGAGEDPNSPLASWKSSTSFCTWTGVTCDISRRHVTSLDL  76

Query  226  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  402
              LNLSG LSPDV +LP L NLS+A NQ+SGP+PPEIS +  LR LNLSNN+F  +FP +
Sbjct  77   SGLNLSGTLSPDVSRLPLLQNLSVADNQISGPIPPEISNLYGLRHLNLSNNVFNGSFPDE  136

Query  403  LAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  579
            ++  L NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IP  YG +P +EYLA
Sbjct  137  ISSGLVNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGQIPSSYGSWPVIEYLA  196

Query  580  VSGNGLSGVIP  612
            VSGN L G IP
Sbjct  197  VSGNELVGKIP  207


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGALP  376


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  290

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGS  350

Query  607  IP  612
            IP
Sbjct  351  IP  352


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++  
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHC  526

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  527  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGTIPGSISSMQSLTSLDFSYNN  586

Query  595  LSGVIP  612
            LSG++P
Sbjct  587  LSGLVP  592


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGQIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  297

Query  592  GLSGVIP  612
              +G IP
Sbjct  298  MFTGEIP  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGSIPQKLGEN  358

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +    +L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  359  GKLNLVDLSSNKLTGALPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLSRIRMGQNF  418

Query  595  LSGVIP  612
            L+G IP
Sbjct  419  LNGSIP  424


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P        L  ++LSNN      P  +   
Sbjct  419  LNGSIPKGLFGLPKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  478

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE      L ++ +S N 
Sbjct  479  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNE  538

Query  595  LSGVIP  612
            LSG IP
Sbjct  539  LSGDIP  544


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGALPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLSRIRMGQNFLNGSIPKGLFG  429

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430  LPKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489

Query  592  GLSGVIP  612
               G IP
Sbjct  490  KFEGPIP  496


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 69/128 (54%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  346  NFTGSIPQKLGENGKLNLVDLSSNKLTGALPPNMCSGNNLETLITLGNFLFGS-IPDSLG  404

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G++P   G   NL  +++S 
Sbjct  405  KCESLSRIRMGQNFLNGSIPKGLFGLPKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSN  464

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  465  NQLSGPLP  472


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  395  LFGSIPDSLGKCESLSRIRMGQNFLNGSIPKGLFGLPKLTQVELQDNYLTGQLPVAGGVS  454

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N 
Sbjct  455  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNL  514

Query  595  LSGVI  609
             SG I
Sbjct  515  FSGRI  519



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 143/189 (76%), Gaps = 3/189 (2%)
 Frame = +1

Query  49   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldls  225
            + A +P  V+E  ALL++K++FT D +S L++WN +T  C++  V CD    HV S+DLS
Sbjct  17   SSAARP--VSEFRALLAVKSSFTDDPESYLSNWNATTRFCSFTGVACDYTGRHVTSIDLS  74

Query  226  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  405
              NLSG LSP    L FL +LS+AANQ+SGP+P E++A+S+LR+ NLSNN+F  +FP QL
Sbjct  75   NFNLSGTLSPSFSHLRFLQSLSLAANQISGPIPTELAALSSLRYFNLSNNVFNGSFPSQL  134

Query  406  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  585
            +QL NLQVLDLYNNN+TG+LP+ V ++ +L HLHLGGN+FSG+IP  YGR+  LEYLAVS
Sbjct  135  SQLKNLQVLDLYNNNMTGELPISVTELPNLLHLHLGGNFFSGQIPSSYGRWEFLEYLAVS  194

Query  586  GNGLSGVIP  612
            GN L G IP
Sbjct  195  GNELDGKIP  203


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  247  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFANL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  307  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGSIPQQLGSNKKLQLLDLSSNK  366

Query  595  LSGVIP  612
            L+G +P
Sbjct  367  LTGTLP  372


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN    T P  +  
Sbjct  415  LNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTESSISANLGQISLSNNKLSGTLPASVGN  474

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + +Q L L  N  +G +P E+ K+  L  +    N FSG I PE  +   L ++ +S N
Sbjct  475  FSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNKFSGTIAPEISKCKLLTFVDLSRN  534

Query  592  GLSGVIP  612
             LSG IP
Sbjct  535  ELSGEIP  541


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  KFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIAT  570

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGLVP  589



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 126/184 (68%), Gaps = 6/184 (3%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl------NLS  240
            EQ ALL IK+A T D QSSL+SWN ST HCTW  + C S   +              NL+
Sbjct  24   EQKALLGIKSAITDDPQSSLSSWNTSTHHCTWDFIKCSSSSSLNHHQSVVSLNISGLNLT  83

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G+LSPD+G L  L NLS+A N  SGP+P  +S +S L  LNLSNNIF STFP  L+ L N
Sbjct  84   GILSPDIGFLTNLQNLSVAGNSFSGPIPSSLSLLSNLYHLNLSNNIFNSTFPSSLSPLQN  143

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            LQ+LD+YNNNLTG LP+ V  M+ LRHLHLGGNYFSG IP EYG++  +EYLAVSGN L 
Sbjct  144  LQILDVYNNNLTGPLPLSVVNMSELRHLHLGGNYFSGEIPAEYGQWRKIEYLAVSGNELE  203

Query  601  GVIP  612
            G IP
Sbjct  204  GNIP  207


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N+    FP  +  +
Sbjct  395  LLGPIPESLGSCKSLSRVRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGGFPVTVDSI  454

Query  415  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            A NL  + L NN LTG+LP  +   + ++ L L GN FSG IPPE GR   L  +  S N
Sbjct  455  AVNLGQISLSNNQLTGELPSSIGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLSKIDFSSN  514

Query  592  GLSGVIP  612
              SG IP
Sbjct  515  KFSGEIP  521


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG +P E   +S+L+ ++LSNN+F    P   + L
Sbjct  251  LSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNNLFSGEIPESFSLL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLGFNGRLQLLDLSSNK  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 68/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +  + GQ   +  L+++ N+L G +P EI  +S+L+ L +   N +    P ++  
Sbjct  178  FSGEIPAEYGQWRKIEYLAVSGNELEGNIPAEIGNLSSLKELYIGYYNGYSGGIPPEIGN  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG +P E+G   +L+ + +S N
Sbjct  238  LSELVRFDGANCGLSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNN  297

Query  592  GLSGVIP  612
              SG IP
Sbjct  298  LFSGEIP  304


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG + P++G+L  L  +  ++N+ SG +P EIS    L F++LS N F    P ++  
Sbjct  491  KFSGSIPPEIGRLQQLSKIDFSSNKFSGEIPSEISKCKLLTFVDLSRNQFSGEIPKEITG  550

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L++  N+L+G +P  +  M SL  +    N FSG I PE G+F    Y +  GN
Sbjct  551  MRILNYLNISRNHLSGSIPGSISSMQSLTSVDFSYNNFSGLI-PESGQFSYFNYTSFLGN  609


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ NQL+G +P  I   S ++ L L  N F  + P ++ +L  L  +D  +N  +
Sbjct  458  LGQISLSNNQLTGELPSSIGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLSKIDFSSNKFS  517

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            G++P E+ K   L  + L  N FSG IP E      L YL +S N L
Sbjct  518  GEIPSEISKCKLLTFVDLSRNQFSGEIPKEITGMRILNYLNISRNHL  564


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 51/104 (49%), Gaps = 0/104 (0%)
 Frame = +1

Query  301  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  480
            N+L G +P  I  +  L  L L  N F  + P +L     LQ+LDL +N LTG LP  + 
Sbjct  321  NKLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLGFNGRLQLLDLSSNKLTGTLPPSLC  380

Query  481  KMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            K   L  L   GN+  G IP   G   +L  + +  N L+G IP
Sbjct  381  KGERLETLITLGNFLLGPIPESLGSCKSLSRVRMGENFLNGSIP  424



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 132/184 (72%), Gaps = 4/184 (2%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  243
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  22   ITELNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  81

Query  244  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  420
             LS DV  LP L NLS+AANQ+SGP+PPE S +  LR LNLSNN+F  ++P +L+  L N
Sbjct  82   TLSSDVSHLPLLQNLSLAANQISGPIPPEFSNLYELRLLNLSNNVFNGSYPDELSSGLVN  141

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L+VLDLYNNNLTG LP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L 
Sbjct  142  LRVLDLYNNNLTGHLPLSITNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNELI  201

Query  601  GVIP  612
            G IP
Sbjct  202  GKIP  205


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  249  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  309  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGTLP  374


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  465  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  524

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNN  584

Query  595  LSGVIP  612
            LSG++P
Sbjct  585  LSGLVP  590


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  229  LPPEIGNLSELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLK  288

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  289  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGG  348

Query  607  IP  612
            IP
Sbjct  349  IP  350


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  235

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG +P E+ K+ +L  L L  N FSG +  E G   +L+ + +S N
Sbjct  236  LSELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNN  295

Query  592  GLSGVIP  612
              +G IP
Sbjct  296  MFTGEIP  302


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P      S L  ++LSNN    + P  +   
Sbjct  417  LNGSIPKGLFGLPKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSNNQLSGSLPAAIGNF  476

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + +Q L L  N   G +P E+ ++  L  L    N FSGRI PE  R   L ++ +S N 
Sbjct  477  SGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  536

Query  595  LSGVIP  612
            LSG IP
Sbjct  537  LSGDIP  542


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 59/125 (47%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  393  LFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPVSGGVS  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L  + L NN L+G LP  +   + ++ L L GN F+G IPPE GR   L  L  S N 
Sbjct  453  SDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNL  512

Query  595  LSGVI  609
             SG I
Sbjct  513  FSGRI  517


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGTLPPNMCAGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFG  427

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+LPV     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  428  LPKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  487

Query  592  GLSGVIP  612
              +G IP
Sbjct  488  KFAGPIP  494


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 68/128 (53%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G    LV L +++N+L+G +PP + A + L   + L N +FGS  P  L 
Sbjct  344  NFTGGIPQKLGDNGRLVILDLSSNKLTGTLPPNMCAGNRLMTLITLGNFLFGS-IPDSLG  402

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   +L  +++S 
Sbjct  403  KCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSN  462

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  463  NQLSGSLP  470



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  249
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  +TCDS  HV SL+L+ L+LSG L
Sbjct  19   ISEYRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSRRHVTSLNLTSLSLSGTL  78

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            S D+  LPFL +LS+A N+ SGP+P   SA+S LRFLNLSNN+F +TFP QL +LANL+V
Sbjct  79   SDDLSHLPFLSHLSLADNKFSGPIPASFSALSALRFLNLSNNVFNATFPSQLNRLANLEV  138

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG+LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L+YLA+SGN L+G I
Sbjct  139  LDLYNNNMTGELPLSVAAMPLLRHLHLGGNFFSGQIPPEYGTWQHLQYLALSGNELAGTI  198


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   G    L  + +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNK  362

Query  595  LSGVIP  612
            ++G +P
Sbjct  363  ITGTLP  368


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLK  279

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  339

Query  598  SGVIP  612
            +G IP
Sbjct  340  TGSIP  344


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  267  LSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGEL  326

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  +     L  + L  N  +G +PP       L+ L   GN 
Sbjct  327  PALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNKITGTLPPNMCYGNRLQTLITLGNY  386

Query  595  LSGVIP  612
            L G IP
Sbjct  387  LFGPIP  392


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP   +  
Sbjct  387  LFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEDGSIA  446

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN L+G LP  +   TS++ L L GN F+GRIPP+ G    L  +  S N 
Sbjct  447  TDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHNK  506

Query  595  LSGVI  609
             SG I
Sbjct  507  FSGPI  511


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    +  L +  N+ +G +PP+I  +  L  ++ S+N F      ++++ 
Sbjct  459  LSGSLPSTIGNFTSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKC  518

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P ++  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  519  KLLTFIDLSGNELSGEIPNKITSMRILNYLNLSRNHLDGSIPGNIASMQSLTSVDFSYNN  578

Query  595  LSGVIP  612
             SG++P
Sbjct  579  FSGLVP  584


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G  P + S  + L  ++LSNN    + P  +   
Sbjct  411  LNGSIPKGLFGLPKLTQVELQDNLLTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNF  470

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             ++Q L L  N  TG +P ++  +  L  +    N FSG I PE  +   L ++ +SGN 
Sbjct  471  TSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNE  530

Query  595  LSGVIP  612
            LSG IP
Sbjct  531  LSGEIP  536


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             ++G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KITGTLPPNMCYGNRLQTLITLGNYLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFG  421

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG  P +    T L  + L  N  SG +P   G F +++ L ++GN
Sbjct  422  LPKLTQVELQDNLLTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGN  481

Query  592  GLSGVIP  612
              +G IP
Sbjct  482  EFTGRIP  488



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 134/192 (70%), Gaps = 8/192 (4%)
 Frame = +1

Query  55   AGKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl  222
             GKP  ++E  ALLS+K++ T     D  S L+SW ++TS CTW  VTCD     V+   
Sbjct  19   TGKP--ISEPRALLSLKSSLTVTGDDDKNSPLSSWKLTTSFCTWTGVTCDVSRRHVTSLD  76

Query  223  sg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  399
               LNL G LSP++  L  L NLS+A NQ+SG +PP+IS +S LR+LNLSNN+F  TFP 
Sbjct  77   LSGLNLPGTLSPEISHLRLLQNLSLAENQISGQIPPQISNLSGLRYLNLSNNVFNGTFPD  136

Query  400  QLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  576
            +++  L NL++LD+YNNNLTGDLP+ V  +T LRHLHLGGNYFSG IP  YG +P +EYL
Sbjct  137  EISSGLVNLRILDVYNNNLTGDLPISVTNLTQLRHLHLGGNYFSGSIPSSYGSWPVIEYL  196

Query  577  AVSGNGLSGVIP  612
            AVSGN L G IP
Sbjct  197  AVSGNELVGKIP  208


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  ++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLHLVDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++  
Sbjct  468  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  528  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGAIPSSISSMQSLTSLDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +P EI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N  +G 
Sbjct  292  SMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGS  351

Query  607  IP  612
            IP
Sbjct  352  IP  353


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FSGSIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNN  298

Query  592  GLSGVIP  612
              +G IP
Sbjct  299  MFTGEIP  305


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +    +L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLHLVDLSSNKLTGTLPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENF  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVELQDNYLTGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE      L ++ +S N 
Sbjct  480  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNE  539

Query  595  LSGVIP  612
            LSG IP
Sbjct  540  LSGDIP  545


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  430

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLTGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  592  GLSGVIP  612
               G IP
Sbjct  491  KFEGPIP  497


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   +G LP L  L +  N  +G +P ++     L  ++LS+N    T P  +  
Sbjct  323  KLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLHLVDLSSNKLTGTLPPNMCS  382

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              NL+ L    N L G +P  + K  SL  + +G N+ +G IP      P L  + +  N
Sbjct  383  GNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  442

Query  592  GLSGVIP  612
             L+G +P
Sbjct  443  YLTGELP  449


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 56/125 (45%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVAGGVS  455

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N 
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNL  515

Query  595  LSGVI  609
             SG I
Sbjct  516  FSGRI  520


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 68/128 (53%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G+   L  + +++N+L+G +PP + + + L   + L N +FGS  P  L 
Sbjct  347  NFTGSIPQKLGENGKLHLVDLSSNKLTGTLPPNMCSGNNLETLITLGNFLFGS-IPDSLG  405

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + +  N L G +P  ++ +  L  + L  NY +G +P   G   NL  +++S 
Sbjct  406  KCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVAGGVSVNLGQISLSN  465

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  466  NQLSGPLP  473



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 137/181 (76%), Gaps = 1/181 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  249
            ++E  ALLS KA+  T D  ++L+SWN ST++C+W  +TCDS LHV +L+L+  +LSG L
Sbjct  26   ISEYRALLSFKASSITDDPTNALSSWNSSTTYCSWLGITCDSRLHVTTLNLTSSSLSGTL  85

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
               +  LPFL  LS+A NQ SGP+P   S++S LR LNLSNN F +TFP  L++LANLQV
Sbjct  86   YDHLSHLPFLSYLSLADNQFSGPIPASFSSLSALRHLNLSNNAFNATFPSNLSRLANLQV  145

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L+YLAVSGN LSG I
Sbjct  146  LDLYNNNMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLQYLAVSGNELSGNI  205

Query  610  P  612
            P
Sbjct  206  P  206


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  D+G+L  +  L +  N LSG + PE+  + +L+ ++LSNNI     P    +L
Sbjct  250  LSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTEL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   GR   L  + +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNK  369

Query  595  LSGVIP  612
            L+G++P
Sbjct  370  LTGMLP  375


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  274  LSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGEL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + +   L  + L  N  +G +PP+      L+ L   GN 
Sbjct  334  PALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNKLTGMLPPDMCYGNRLQTLITLGNY  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGPIP  399


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG + P++G L  LV    A   LSG +P ++  +  +  L L  N    +   +L  L 
Sbjct  227  SGGIPPEIGNLSQLVRFDAAYCGLSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLK  286

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  287  SLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  346

Query  598  SGVIP  612
            +G IP
Sbjct  347  TGSIP  351


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG + P+ G    L  L+++ N+LSG +PPE+  ++ LR L +   N +    P ++  
Sbjct  177  FSGQIPPEYGTWQHLQYLAVSGNELSGNIPPELGNLTALRELYIGYYNAYSGGIPPEIGN  236

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D     L+G++P ++ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  237  LSQLVRFDAAYCGLSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNN  296

Query  592  GLSGVIP  612
             LSG +P
Sbjct  297  ILSGEVP  303


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L NN+    FP   +  
Sbjct  394  LFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFGLPKLTQVELQNNLLTGQFPEGGSIA  453

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   TS++ L L GN FSG+IP + GR   L  +  S N 
Sbjct  454  VNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGNKFSGQIPSQIGRLQQLSKIDFSRNE  513

Query  595  LSGVI  609
             SG I
Sbjct  514  FSGPI  518


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  
Sbjct  489  KFSGQIPSQIGRLQQLSKIDFSRNEFSGPIAPEISRCKLLTFIDLSRNELSGEIPNQITA  548

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  549  MRILNYLNLSRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFGYFNYTSFLGN  607


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G+L PD+     L  L    N L GP+P  I    +L  + +  N    + P  L  
Sbjct  369  KLTGMLPPDMCYGNRLQTLITLGNYLFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFG  428

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L NN LTG  P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  429  LPKLTQVELQNNLLTGQFPEGGSIAVNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGN  488

Query  592  GLSGVIP  612
              SG IP
Sbjct  489  KFSGQIP  495


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   ++++ L L  N F    P Q+ +L  L  +D   N  +
Sbjct  456  LGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGNKFSGQIPSQIGRLQQLSKIDFSRNEFS  515

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  SG IP +      L YL +S N L G IP
Sbjct  516  GPIAPEISRCKLLTFIDLSRNELSGEIPNQITAMRILNYLNLSRNHLVGSIP  567



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllh-vvsldlsglNLSG  243
            ++E  ALLS+K+A   D Q +L SWN +  +  CTW  VTCD     + SLDLS LNLSG
Sbjct  25   ISEYQALLSLKSAID-DPQGALASWNSTNKNNLCTWSFVTCDYNNRHITSLDLSSLNLSG  83

Query  244  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
             LSPD+  L +L NL++AANQ+SGP+P ++SAIS LR LNLSNN+F  +FP QL+QL NL
Sbjct  84   TLSPDIAHLRYLQNLTLAANQISGPIPIQLSAISGLRCLNLSNNVFNGSFPTQLSQLKNL  143

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
            QVLDLYNNN+TGDLP+ V +M +LRHLHLGGN+FSG IP EYG++  LEYLAVSGN L G
Sbjct  144  QVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFSGAIPREYGKWEFLEYLAVSGNELEG  203

Query  604  VIP  612
             IP
Sbjct  204  PIP  206


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   AQL
Sbjct  250  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            +NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+  NL  + +S N 
Sbjct  310  SNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGNLP  375


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L+G L   +G+   +  L +  N+ SGP+PPEI  +  L  ++ S+N F      +++Q
Sbjct  466  HLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQ  525

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  526  CKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLVGSIPASIATMQSLTSVDFSYN  585

Query  592  GLSGVIP  612
             L+G++P
Sbjct  586  NLTGLVP  592


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG +  + G+  FL  L+++ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  177  FSGAIPREYGKWEFLEYLAVSGNELEGPIPPEIGNLTKLQQLYIGYYNTYEGGLPPEIGN  236

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L++L   D  N  L+G++P E+ K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  237  LSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNN  296

Query  592  GLSGVIP  612
             LSG IP
Sbjct  297  MLSGEIP  303


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  227  EGGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLK  286

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L+G++P    ++++L  L+L  N   G IP   G  P LE L +  N  
Sbjct  287  SLKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNF  346

Query  598  SGVIP  612
            +G IP
Sbjct  347  TGSIP  351


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L  ++G L  L ++ ++ N LSG +P   + +S L  LNL  N      P  +  L
Sbjct  274  LSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + K  +L  + L  N  +G +PP+      L+ L    N 
Sbjct  334  PQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNF  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGPIP  399


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP    ++
Sbjct  394  LFGPIPESLGKCQSLSRIRMGENFLNGSLPKGLFGLPKLTQVELQDNLLTGEFPVTDDKI  453

Query  415  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            A NL  + L NN+LTG LP  + K + ++ L L GN FSG IPPE G+   L  +  S N
Sbjct  454  AVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHN  513

Query  592  GLSGVI  609
              SG I
Sbjct  514  KFSGPI  519


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGNLPPDMCSGDRLQTLITLSNFLFGPIPESLGKCQSLSRIRMGENFLNGSLPKGLFG  428

Query  412  LANLQVLDLYNNNLTGDLPVEVYKM-TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L  ++L +N LTG+ PV   K+  +L  + L  N+ +G +P   G+F  ++ L + G
Sbjct  429  LPKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDG  488

Query  589  NGLSGVIP  612
            N  SG IP
Sbjct  489  NKFSGPIP  496


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +     QL  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  298  LSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQGLGKN  357

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL ++DL +N LTG+LP ++     L+ L    N+  G IP   G+  +L  + +  N 
Sbjct  358  GNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNFLFGPIPESLGKCQSLSRIRMGENF  417

Query  595  LSGVIP  612
            L+G +P
Sbjct  418  LNGSLP  423


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  411
            L+G L   +  LP L  + +  N L+G  P     I+  L  ++LSNN    + P  + +
Sbjct  418  LNGSLPKGLFGLPKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLSNNHLTGSLPSSIGK  477

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + +Q L L  N  +G +P E+ K+  L  +    N FSG I PE  +   L ++ +S N
Sbjct  478  FSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQCKLLTFVDLSRN  537

Query  592  GLSGVIP  612
             LSG IP
Sbjct  538  ELSGAIP  544



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  249
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  VTCDS  HV  L+L+ L+LS  L
Sbjct  19   ISEYRALLSFKASSITNDPTHALSSWNSSTPFCSWFGVTCDSRRHVTGLNLTSLSLSATL  78

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
               +  LPFL +LS+A NQ SGP+P   SA+S LRFLNLSNN+F  TFP QLA+L+NL+V
Sbjct  79   YDHLSHLPFLSHLSLADNQFSGPIPVSFSALSALRFLNLSNNVFNQTFPSQLARLSNLEV  138

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LDLYNNN+TG LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L YLA+SGN L+G I
Sbjct  139  LDLYNNNMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLRYLALSGNELAGYI  198


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   G+   L  + +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNK  362

Query  595  LSGVIP  612
            ++G +P
Sbjct  363  ITGTLP  368


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLK  279

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNF  339

Query  598  SGVIP  612
            +G IP
Sbjct  340  TGSIP  344


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG L+ ++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +
Sbjct  266  SLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGE  325

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VL L+ NN TG +P  + K   L  + L  N  +G +PP       L+ L   GN
Sbjct  326  LPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNKITGTLPPYMCYGNRLQTLITLGN  385

Query  592  GLSGVIP  612
             L G IP
Sbjct  386  YLFGPIP  392


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP   +  
Sbjct  387  LFGPIPDSLGKCESLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEYGSIA  446

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  + L NN L+G LP  +   TS++ L L GN FSGRIPP+ GR   L  +  S N 
Sbjct  447  TDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHNK  506

Query  595  LSGVI  609
             SG I
Sbjct  507  FSGPI  511


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 64/124 (52%), Gaps = 6/124 (5%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G ++ D+GQ+      S++ N+LSGP+P  I   ++++ L L  N F    P Q+ +L  
Sbjct  443  GSIATDLGQI------SLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQ  496

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L  +D  +N  +G +  E+ +   L  + L GN  SG IP +      L YL +S N L 
Sbjct  497  LSKIDFSHNKFSGPIAPEISRCKLLTFIDLSGNELSGEIPNQITSMRILNYLNLSRNHLD  556

Query  601  GVIP  612
            G IP
Sbjct  557  GSIP  560


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             LSG L   +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      ++++
Sbjct  458  KLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISR  517

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  +DL  N L+G++P ++  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  518  CKLLTFIDLSGNELSGEIPNQITSMRILNYLNLSRNHLDGSIPGSIASMQSLTSVDFSYN  577

Query  592  GLSGVIP  612
              SG++P
Sbjct  578  NFSGLVP  584


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V  +P L +L +  N  SG +PPE      LR+L LS N        +L  
Sbjct  145  NMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLRYLALSGNELAGYIAPELGN  204

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L+ L+ L + Y N  +G +P E+  +++L  L       SG IP E G+  NL+ L +  
Sbjct  205  LSALRELYIGYYNTYSGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQV  264

Query  589  NGLSG  603
            N LSG
Sbjct  265  NSLSG  269


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +     +L  L  L++  N+L G +P  +  +  L  L L  N F  + P  L + 
Sbjct  291  LSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGKN  350

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N +TG LP  +     L+ L   GNY  G IP   G+  +L  + +  N 
Sbjct  351  GRLTLVDLSSNKITGTLPPYMCYGNRLQTLITLGNYLFGPIPDSLGKCESLNRIRMGENF  410

Query  595  LSGVIP  612
            L+G IP
Sbjct  411  LNGSIP  416



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 136/192 (71%), Gaps = 5/192 (3%)
 Frame = +1

Query  40   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvvsl  216
            +A +G G+   V E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VVSL
Sbjct  19   AAASGRGR---VVEHRALLDLKAAL-GDPSGALAGWDATADHCQAWSGVACDAAGRVVSL  74

Query  217  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  396
            ++S LNLSG L   V +L  L++LS AAN+LSGP+PPE+S +S LRFLNLSNN F  T P
Sbjct  75   NISXLNLSGPLPRAVSRLRSLLHLSAAANELSGPIPPELSLLSGLRFLNLSNNAFNRTLP  134

Query  397  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  576
              L++L NL VLDLYNNNLTG LPV+V  + +LRHLHLGGN+FSG IPPEYGR+ +LEYL
Sbjct  135  SALSRLKNLHVLDLYNNNLTGVLPVQVADLPALRHLHLGGNFFSGAIPPEYGRWEHLEYL  194

Query  577  AVSGNGLSGVIP  612
            A+SGN L G IP
Sbjct  195  AISGNELGGPIP  206


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAEL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGSLP  375


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G+   +  L +  NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  NN +G++P E+  M  L +L+L  N+  G+IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNNFSGEIPAEITGMRILNYLNLSRNHLEGKIPASISTMQSLTAVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+GVL   V  LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPVQVADLPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAISGNELGGPIPPELGN  211

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  L+ L + Y N+  G LP  +  +T+L  L       SG IPPE G   NL+ L +  
Sbjct  212  VTTLRELYIGYFNSFQGGLPAAIGNITALVRLDAANCGLSGEIPPEIGNLQNLDTLFLQV  271

Query  589  NGLSGVI  609
            NGLSG I
Sbjct  272  NGLSGEI  278


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG ++P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP       L+ L   GN 
Sbjct  334  PRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSGDQLQVLIALGNF  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGSIP  399


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L +
Sbjct  225  SFQGGLPAAIGNITALVRLDAANCGLSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGK  284

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  285  LRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQLWEN  344

Query  592  GLSGVIP  612
              +G IP
Sbjct  345  NFTGEIP  351


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 61/122 (50%), Gaps = 6/122 (5%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            +SP +GQ+       ++ N+LSG +PP I   S ++ L L+ N F    P ++ +L  L 
Sbjct  454  ISPTLGQI------ILSNNRLSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLS  507

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +D   N  +G +  E+ K   L  + L  N FSG IP E      L YL +S N L G 
Sbjct  508  KMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGMRILNYLNLSRNHLEGK  567

Query  607  IP  612
            IP
Sbjct  568  IP  569


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321  KLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCS  380

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               LQVL    N L G +P    +  SL  + +G NY +G +P      P L  + +  N
Sbjct  381  GDQLQVLIALGNFLFGSIPESFGRCKSLSRIRMGENYLNGSVPSGLFGLPKLAQVELQDN  440

Query  592  GLSGVIP  612
             L+G  P
Sbjct  441  LLTGGFP  447



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   190 bits (482),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 123/167 (74%), Gaps = 3/167 (2%)
 Frame = +1

Query  121  DSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  294
            D Q S L SW++STS C W  VTCD+ L  V       LNLSG L   V  LP L NLS+
Sbjct  42   DQQHSPLASWDLSTSFCLWTGVTCDASLRHVISLDLSGLNLSGTLPSSVAHLPLLRNLSL  101

Query  295  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPV  471
            AANQ+SG +PPE++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV
Sbjct  102  AANQISGHIPPEMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPV  161

Query  472  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             +  +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP
Sbjct  162  SITNLTELRHLHLGGNYFAGRIPPAYGSWPALEYLAVSGNELAGKIP  208


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P +  QL
Sbjct  252  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPRFEQL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  312  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGENGRLVILDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (54%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  452  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  505

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LD  +N  +G +P E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  506  QQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNH  565

Query  595  LSGVIP  612
            L G IP
Sbjct  566  LVGSIP  571


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G L  ++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  228  FDGGLPAEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  287

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  288  SSLKSMDLSNNMFTGEIPPRFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENN  347

Query  595  LSGVIP  612
             +G IP
Sbjct  348  FTGSIP  353


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 72/151 (48%), Gaps = 25/151 (17%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPAEIGN  238

Query  412  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  519
            L+ L  LD  N  L G++P E+ ++                        +SL+ + L  N
Sbjct  239  LSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  298

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             F+G IPP + +  NL  L +  N L G IP
Sbjct  299  MFTGEIPPRFEQLRNLTLLNLFRNKLYGAIP  329


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 2/120 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG +  ++G+L  L  L  + N  SG +PPEIS    L +++LS N      P+++  
Sbjct  493  KFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEITS  552

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP--EYGRFPNLEYLAVS  585
            +  L  L++  N+L G +PV +  M SL  +    N  SG +P   ++G F +  +L  S
Sbjct  553  MRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNNLSGLVPSTGQFGYFNHTSFLGNS  612


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 2/117 (2%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  441
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  431  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  442  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             N  +G +P E+ ++  L  L    N FSG IPPE  R   L Y+ +S N LSG IP
Sbjct  491  GNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIP  547


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 2/129 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     LV L    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  371  KLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNGLFG  430

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  585
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  431  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  586  GNGLSGVIP  612
            GN  SG IP
Sbjct  491  GNKFSGAIP  499



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 135/194 (70%), Gaps = 7/194 (4%)
 Frame = +1

Query  49   AGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsllhvvs  213
            AGA  P G     +QA LLS+K+A + D  ++L  WN + +  HC W  V CD+ L  V 
Sbjct  25   AGAPPPDGEASADDQATLLSLKSALS-DPGAALAGWNATAAPDHCAWHGVACDATLRRVV  83

Query  214  ldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  390
                  LNLSG L   VG L  L+NLS A N LSGP+PPE+S +S LR LNLSNN+F  +
Sbjct  84   SLDLSGLNLSGSLPTAVGHLRHLLNLSAATNFLSGPIPPELSFLSDLRHLNLSNNLFNGS  143

Query  391  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  570
            FP  L +L NL+VLDLYNNNLTG LPVEV ++++LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  144  FPSALRRLKNLEVLDLYNNNLTGLLPVEVAELSNLRHLHLGGNFFSGVIPPEYGRWDHIE  203

Query  571  YLAVSGNGLSGVIP  612
            YLAVSGN L G IP
Sbjct  204  YLAVSGNELVGAIP  217


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +PPE+  + +L+ L+LSNN      P   A L
Sbjct  261  LSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADL  320

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  321  WNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  380

Query  595  LSGVIP  612
            L+G +P
Sbjct  381  LTGDLP  386


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SGV+ P+ G+   +  L+++ N+L G +PPEI  +S LR L +   N +    P ++  
Sbjct  188  FSGVIPPEYGRWDHIEYLAVSGNELVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGN  247

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L+G +P E+ ++ +L  L L  N  +G +PPE GR  +L+ L +S N
Sbjct  248  LSALVRFDAANCGLSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNN  307

Query  592  GLSGVIP  612
             L+G IP
Sbjct  308  ALTGEIP  314


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L 
Sbjct  238  DGGIPPEIGNLSALVRFDAANCGLSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLR  297

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ LDL NN LTG++P     + +L  L+L  N   G +P   G  P LE L +  N  
Sbjct  298  SLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNF  357

Query  598  SGVIP  612
            +G+IP
Sbjct  358  TGIIP  362


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    L  L ++ NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  479  LSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPEISKC  538

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  NNL+G++P E+  +  L +L++  N+  G IPP      +L  +  S N 
Sbjct  539  KLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEGSIPPSIATMQSLTAVDFSYNN  598

Query  595  LSGVIP  612
            LSG++P
Sbjct  599  LSGLVP  604


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             L G + P++G L  L  L +   N   G +PPEI  +S L   + +N     + P +L 
Sbjct  211  ELVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGNLSALVRFDAANCGLSGSIPPELG  270

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +L NL  L L  N L G+LP E+ ++ SL+ L L  N  +G IPP +    NL  L +  
Sbjct  271  RLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFR  330

Query  589  NGLSGVIP  612
            N L G +P
Sbjct  331  NKLDGTVP  338


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L P++G+L  L +L ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  285  LAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDL  344

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L++NN TG +P  + +   L+ L L  N  +G +P +      L  L   GN 
Sbjct  345  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPLDLCSGNKLHTLIALGNA  404

Query  595  LSGVIP  612
            L G IP
Sbjct  405  LFGPIP  410


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (50%), Gaps = 3/123 (2%)
 Frame = +1

Query  253  PDVGQLPF---LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
            PD G  P    L  +S++ N+LSGP+P  I   S L+ L LS N F    P ++ +L  L
Sbjct  458  PDTGDAPISSSLGQISLSNNRLSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQL  517

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
              +D   N  +G++  E+ K   L  + L  N  SG IP E      L YL VS N L G
Sbjct  518  SKVDFSGNRFSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEG  577

Query  604  VIP  612
             IP
Sbjct  578  SIP  580


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 66/150 (44%), Gaps = 24/150 (16%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P    L  L  L++  N+L G VP  I  +  L  L L +N F    P  + + 
Sbjct  309  LTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNFTGIIPRGIGRS  368

Query  415  ANLQVLDLYNNNLTGDLPVEVY------------------------KMTSLRHLHLGGNY  522
              LQ+LDL +N LTGDLP+++                         +  SL  + LG NY
Sbjct  369  GKLQLLDLSSNKLTGDLPLDLCSGNKLHTLIALGNALFGPIPESLGRCFSLSRVRLGQNY  428

Query  523  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             +G IP      PNL  + +  N L+G  P
Sbjct  429  LNGSIPSGLFCLPNLAQVELQDNLLAGGFP  458



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 138/194 (71%), Gaps = 4/194 (2%)
 Frame = +1

Query  34   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  210
            R SA A  G  +G  E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VV
Sbjct  16   RPSAAASGGGRVG--EHRALLDLKAAL-GDPSGALAGWDAAADHCQAWVGVACDAAGRVV  72

Query  211  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  390
            SL++S LNLSG L P V +L  L+ LS AANQLSGP+PPE+S +S LRFLNLSNN F  T
Sbjct  73   SLNISNLNLSGPLPPAVSRLRSLLRLSTAANQLSGPIPPELSLLSGLRFLNLSNNAFNET  132

Query  391  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  570
            FP  L++L NL VLDLYNNNLTG LP+EV ++ +LRHLHLGGN+FSG IPPEYGR+ +LE
Sbjct  133  FPSALSRLKNLHVLDLYNNNLTGVLPLEVAELPALRHLHLGGNFFSGAIPPEYGRWEHLE  192

Query  571  YLAVSGNGLSGVIP  612
            YLAVSGN L G IP
Sbjct  193  YLAVSGNELGGPIP  206


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN      P   A+L
Sbjct  250  LSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAEL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGSLP  375


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 68/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+GVL  +V +LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPLEVAELPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAVSGNELGGPIPPELGN  211

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  L+ L + Y N+  G LP  +  +T+L  L       SG+IPPE G   NL+ L +  
Sbjct  212  VTTLRELYIGYFNSFQGSLPAAIGNITALVRLDAANCGLSGKIPPEIGNLQNLDTLFLQV  271

Query  589  NGLSGVI  609
            NGLSG I
Sbjct  272  NGLSGGI  278


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G+   +  L +  NQ SG +P EI  +  L  ++ S N F      ++ + 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  NNL+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNNLSGEIPAEITGMRILNYLNLSRNHLEGEIPASISTMQSLTAVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG ++P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP      NL+ L   GN 
Sbjct  334  PRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSGNNLQVLIALGNF  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGSIP  399


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 62/127 (49%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L  
Sbjct  225  SFQGSLPAAIGNITALVRLDAANCGLSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGM  284

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  285  LRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWEN  344

Query  592  GLSGVIP  612
              +G IP
Sbjct  345  NFTGEIP  351


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L   
Sbjct  322  LHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSG  381

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NLQVL    N L G +P  + +  SL  + +G NY +G IP      PNL  + +  N 
Sbjct  382  NNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENYLNGSIPSGLFSLPNLAQVELQDNL  441

Query  595  LSGVIP  612
            L+G  P
Sbjct  442  LTGGFP  447


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 2/128 (2%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI--SAISTLRFLNLSNNIFGSTFPHQLA  408
            L+G +   +  LP L  + +  N L+G  P     S  STL  ++LSNN      P  + 
Sbjct  418  LNGSIPSGLFSLPNLAQVELQDNLLTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIG  477

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            + + +Q L L  N  +G +P+E+ ++  L  +   GN FSG I PE  +   L ++ +S 
Sbjct  478  KFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKCKLLTFVDLSR  537

Query  589  NGLSGVIP  612
            N LSG IP
Sbjct  538  NNLSGEIP  545


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 56/112 (50%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L+ N F    P ++ +L  L  +D   N  +
Sbjct  458  LGQISLSNNRLSGALPPSIGKFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFS  517

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ K   L  + L  N  SG IP E      L YL +S N L G IP
Sbjct  518  GPITPEIRKCKLLTFVDLSRNNLSGEIPAEITGMRILNYLNLSRNHLEGEIP  569


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  I  +  L  L L  N F    P +L   
Sbjct  298  LTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTN  357

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP  +    +L+ L   GN+  G IP   GR  +L  + +  N 
Sbjct  358  GRLQLLDLSSNKLTGSLPPNLCSGNNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENY  417

Query  595  LSGVIP  612
            L+G IP
Sbjct  418  LNGSIP  423



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +1

Query  76   TEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGV  246
            ++  ALLS+KA F+  + + L++WN S    HC+W  V+CD     VVSLDL+GLNLSG 
Sbjct  30   SDVEALLSLKADFSDATSAVLSAWNSSADDDHCSWPGVSCDPLQGFVVSLDLTGLNLSGT  89

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            LSP VG+L  L+NLS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  LA+L NL 
Sbjct  90   LSPAVGRLRHLLNLSAASNSLSGPIPAELSRLSDLRHLNLSNNLFNGSFPSALARLKNLL  149

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTG LP EV ++  LRHLHLGGN+F+G IPPE+GR+  LEYLAVSGN L G 
Sbjct  150  VLDLYNNNLTGPLPTEVAELPELRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGP  209

Query  607  IP  612
            IP
Sbjct  210  IP  211


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  + +  N L+G +PPE+  +  L+ ++LSNN      P   A L
Sbjct  255  LSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADL  314

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP   G+   LE L +S N 
Sbjct  315  QNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNK  374

Query  595  LSGVIP  612
            L+G +P
Sbjct  375  LTGNLP  380


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 73/151 (48%), Gaps = 25/151 (17%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  354
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++TLR                    
Sbjct  182  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGKLTTLRQLYLGYFNSFEGRIPPEIGG  241

Query  355  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  519
                  L+++N       P +L  L NL  + L  N LTGDLP E+ ++ +L+ + L  N
Sbjct  242  LAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNN  301

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              +G IP  +    NL  L +  N L G IP
Sbjct  302  ALAGEIPATFADLQNLTLLNLFRNKLHGSIP  332


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G L  +V +LP L +L +  N  +G +PPE      L +L +S N  G   P +L +
Sbjct  157  NLTGPLPTEVAELPELRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGK  216

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L+ L L Y N+  G +P E+  + +L  L +     SG IPPE G   NL+ + +  
Sbjct  217  LTTLRQLYLGYFNSFEGRIPPEIGGLAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQV  276

Query  589  NGLSGVIP  612
            NGL+G +P
Sbjct  277  NGLTGDLP  284


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P VG    +  L +  NQ SG +PPEI  +  L  ++ S N F      +++Q 
Sbjct  473  LSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSGNQFSGLISPEISQC  532

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  533  KLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQLEGNIPSSIATMQSLTAIDFSYNN  592

Query  595  LSGVIP  612
            LSG++P
Sbjct  593  LSGLVP  598


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +A L
Sbjct  279  LTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADL  338

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + +   L  L L  N  +G +PP+      L+ L V GN 
Sbjct  339  PTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNF  398

Query  595  LSGVIP  612
            L G IP
Sbjct  399  LFGPIP  404


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G + P++G L  LV L +A   LSG +PPE+  +  L  + L  N      P ++ +
Sbjct  230  SFEGRIPPEIGGLAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGR  289

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL+ +DL NN L G++P     + +L  L+L  N   G IP      P LE L +  N
Sbjct  290  LRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWEN  349

Query  592  GLSGVIP  612
              +G IP
Sbjct  350  NFTGGIP  356


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +      L  L  L++  N+L G +P  I+ + TL  L L  N F    P +L Q 
Sbjct  303  LAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWENNFTGGIPRRLGQS  362

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L++LDL +N LTG+LP ++     L+ L + GN+  G IP   GR  +L  + +  N 
Sbjct  363  GQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNFLFGPIPDTLGRCESLSRIRMGENY  422

Query  595  LSGVIP  612
            L+G IP
Sbjct  423  LNGSIP  428


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 65/125 (52%), Gaps = 6/125 (5%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            + ++SPD+GQ+      S++ N+LSGP+PP +   S ++ L L+ N F    P ++ +L 
Sbjct  456  AALISPDLGQI------SLSNNRLSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQ  509

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L  +D   N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  510  QLSKVDFSGNQFSGLISPEISQCKLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQL  569

Query  598  SGVIP  612
             G IP
Sbjct  570  EGNIP  574


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 73/176 (41%), Gaps = 50/176 (28%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI--------------------------  333
            N +G +   +GQ   L  L +++N+L+G +PP++                          
Sbjct  350  NFTGGIPRRLGQSGQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNFLFGPIPDTLGR  409

Query  334  -SAISTLRF---------------------LNLSNNIFGSTFPHQLAQLA--NLQVLDLY  441
              ++S +R                      + L +N+    FP   A L   +L  + L 
Sbjct  410  CESLSRIRMGENYLNGSIPDGLLSLPRLSQIELQDNLLTGGFPDTGAALISPDLGQISLS  469

Query  442  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            NN L+G LP  V   + ++ L L  N FSGRIPPE GR   L  +  SGN  SG+I
Sbjct  470  NNRLSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSGNQFSGLI  525



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  127  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  306
            +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+
Sbjct  2    KSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANE  61

Query  307  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  486
             SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VLDLYNNN+TGD P+ V +M
Sbjct  62   FSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVLDLYNNNMTGDFPIVVTEM  121

Query  487  TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            +SLRHLHLGGN+F+GRIPPE GR  +LEYLAVSGN LSG IP
Sbjct  122  SSLRHLHLGGNFFAGRIPPEVGRMQSLEYLAVSGNELSGPIP  163


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  207  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  266

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+  IP   G+   L+ L +S N 
Sbjct  267  KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNK  326

Query  595  LSGVIP  612
            L+G +P
Sbjct  327  LTGTLP  332


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  446  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  505

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  506  MRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  564


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL 
Sbjct  184  DGGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLN  243

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ LDL NN L G++PV   ++ +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  244  SLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNF  303

Query  598  SGVIP  612
            +  IP
Sbjct  304  TEAIP  308


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  231  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  290

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN T  +P  + K   L+ L L  N  +G +PP+      L+ L    N 
Sbjct  291  PKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNKLTGTLPPDMCFGNRLQILIALSNF  350

Query  595  LSGVIP  612
            L G IP
Sbjct  351  LFGPIP  356


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  351  LFGPIPESLGKCASLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  410

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPPE GR   L  +  S N 
Sbjct  411  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPPEIGRLQQLSKIDFSSNM  470

Query  595  LSGVI  609
            LSG I
Sbjct  471  LSGPI  475


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 64/130 (49%), Gaps = 6/130 (5%)
 Frame = +1

Query  232  NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  402
             L+G L PD+    +L  L+ LS   N L GP+P  +   ++L  + +  N    + P  
Sbjct  326  KLTGTLPPDMCFGNRLQILIALS---NFLFGPIPESLGKCASLNRIRMGENFLNGSIPKG  382

Query  403  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  582
            L  L  L  ++L +N L+G+ P+      +L  + L  N  +G IPP  G F  ++ L +
Sbjct  383  LLSLPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLL  442

Query  583  SGNGLSGVIP  612
             GN  SG IP
Sbjct  443  DGNKFSGQIP  452



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  118  ADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  294
            A   S+L +W  STS C W  VTCD+    V       LNLSG LS D+  L  L N S+
Sbjct  40   AGDDSALATWTDSTSFCGWAGVTCDASRRHVISLDLSGLNLSGTLSSDIAHLRLLQNFSV  99

Query  295  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPV  471
            +ANQ+SGP+PPEIS++  LR+LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV
Sbjct  100  SANQISGPIPPEISSLFGLRYLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPV  159

Query  472  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             V  +T LRHLHLGGNYF+GRIP  YG +P +EYLAVSGN L G IP
Sbjct  160  SVTNLTQLRHLHLGGNYFAGRIPAAYGSWPVIEYLAVSGNELVGKIP  206


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N LSGP+ PE+  +  L  ++LSNN+F    P   AQL
Sbjct  250  LTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGTLP  375


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G LP L ++ ++ N   G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P ++ +   L+ L L  N  +G +PP      NL+ L    N 
Sbjct  334  PELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNKLTGTLPPNMCSGNNLQTLITLSNF  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGPIP  399


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             +G +    G  P +  L+++ N+L G +PPEI  +STLR L +   N F    P ++  
Sbjct  177  FAGRIPAAYGSWPVIEYLAVSGNELVGKIPPEIGNLSTLRELYIGYYNAFEDGLPPEIGN  236

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  LTG +P E+ K+  L  L L  N  SG + PE G  P LE + +S N
Sbjct  237  LSELVRFDAANCGLTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNN  296

Query  592  GLSGVIP  612
               G IP
Sbjct  297  MFVGEIP  303


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = +1

Query  253  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            P  G++ F L  +S++ NQLSGP+PP I   S ++ L L  N F    P Q+ +L  L  
Sbjct  447  PVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGNKFTGLIPQQIGKLQQLSK  506

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            +D  +N  +G +  E+ +   L  + L  N  +G IP E      L YL +S N L G I
Sbjct  507  MDFSHNRFSGRIAPEISQCKLLTFVDLSRNELAGEIPNEITGMRILNYLNLSRNHLVGPI  566

Query  610  P  612
            P
Sbjct  567  P  567


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 61/127 (48%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNNLQTLITLSNFLFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFG  428

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  429  LPKLTQVELQDNYLTGEFPVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGN  488

Query  592  GLSGVIP  612
              +G+IP
Sbjct  489  KFTGLIP  495


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 60/127 (47%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   +G LP L  L +  N  +G +P ++     L+ L+LS+N    T P  +  
Sbjct  321  KLHGAIPEFIGDLPELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNKLTGTLPPNMCS  380

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              NLQ L   +N L G +P  + +  SL  + +G N+ +G IP      P L  + +  N
Sbjct  381  GNNLQTLITLSNFLFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  440

Query  592  GLSGVIP  612
             L+G  P
Sbjct  441  YLTGEFP  447


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 58/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP      
Sbjct  394  LFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTGRVA  453

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN F+G IP + G+   L  +  S N 
Sbjct  454  FNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGNKFTGLIPQQIGKLQQLSKMDFSHNR  513

Query  595  LSGVI  609
             SG I
Sbjct  514  FSGRI  518


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG ++P++ Q   L  + ++ N+L+G +P EI+ +  L +LNLS N      P  ++ +
Sbjct  514  FSGRIAPEISQCKLLTFVDLSRNELAGEIPNEITGMRILNYLNLSRNHLVGPIPASISSM  573

Query  415  ANLQVLDLYNNNLTGDLP  468
             +L  +D   NNL+G +P
Sbjct  574  QSLTSVDFSYNNLSGLVP  591



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 135/191 (71%), Gaps = 4/191 (2%)
 Frame = +1

Query  40   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  219
            +A  GAG      E  ALLS+KA  + D  ++L  W+ +T HC+W  VTCD    VVSLD
Sbjct  20   AADDGAGY---AEEHRALLSLKAQLS-DPGAALGPWDATTDHCSWPGVTCDDAGAVVSLD  75

Query  220  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  399
            LSG NLSG+L P VG+L  L+ LS AAN  SGP+P E++ +  LR LNLSNNIF  +FP 
Sbjct  76   LSGRNLSGLLPPAVGRLRSLLRLSAAANSFSGPIPSELALLPALRHLNLSNNIFNGSFPA  135

Query  400  QLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  579
             LA+LA+L+VLDLYNNNLTG LP E+  +  LRH+HLGGN+FSG IPPEYG +  LEYLA
Sbjct  136  PLARLADLRVLDLYNNNLTGPLPRELAALPQLRHIHLGGNFFSGSIPPEYGSWQFLEYLA  195

Query  580  VSGNGLSGVIP  612
            +SGN L G IP
Sbjct  196  ISGNELGGPIP  206


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L G +PPE+S + +L+ ++LSNN      P   A L
Sbjct  250  LSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAAL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP   G    L+ L +S N 
Sbjct  310  SNLTLLNLFRNKLFGAIPEFVGDLPELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNK  369

Query  595  LSGVIP  612
            L+G +P
Sbjct  370  LTGSLP  375


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 67/125 (54%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N  G   P +L++L 
Sbjct  227  DGGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLR  286

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN LTG++P     +++L  L+L  N   G IP   G  P LE L V  N  
Sbjct  287  SLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDLPELEVLQVWENNF  346

Query  598  SGVIP  612
            +G IP
Sbjct  347  TGSIP  351


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             L G + P++G L  L  L I   N   G +PPEI  +STL  L+ +N       P ++ 
Sbjct  200  ELGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGNLSTLLRLDAANCGLSGRIPPEMG  259

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
             L NL  L L  N L G++P E+ ++ SL+ + L  N  +G IPP +    NL  L +  
Sbjct  260  NLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFR  319

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  320  NKLFGAIP  327


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L P +G    L  L +  N  +G +PPE+  +  L  L+LS+N F      ++++ 
Sbjct  468  LAGPLPPSIGNYSGLQKLLLNQNSFTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P +V  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNELSGDVPADVAAMRILNYLNLSRNHLEGPIPVAISTMQSLTAVDFSYNN  587

Query  595  LSGVIP  612
            LSGV+P
Sbjct  588  LSGVVP  593


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G + P++ +L  L ++ ++ N L+G +PP  +A+S L  LNL  N      P  +  L
Sbjct  274  LGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL ++ NN TG +P  +     L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  334  PELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCYGNKLQTLIALGNF  393

Query  595  LSGVIP  612
            L G IP
Sbjct  394  LFGQIP  399


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + +G + P+VG+L  L  L +++N+ SGP+ PE+S    L F++LS N      P  +A 
Sbjct  491  SFTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAA  550

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  551  MRILNYLNLSRNHLEGPIPVAISTMQSLTAVDFSYNNLSGVV-PSTGQFSYFNATSFVGN  609


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 6/125 (5%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            S  +SP++GQ+       ++ N+L+GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  451  SSSISPNLGQV------CLSNNRLAGPLPPSIGNYSGLQKLLLNQNSFTGKIPPEVGRLQ  504

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L  LDL +N  +G +  EV K   L  + L  N  SG +P +      L YL +S N L
Sbjct  505  QLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAAMRILNYLNLSRNHL  564

Query  598  SGVIP  612
             G IP
Sbjct  565  EGPIP  569


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   VG LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321  KLFGAIPEFVGDLPELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCY  380

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               LQ L    N L G +P  + +  SL  + +G NY +G IP      PNL  + +  N
Sbjct  381  GNKLQTLIALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLSLPNLSQVELQDN  440

Query  592  GLSGVIP  612
             L+G  P
Sbjct  441  YLTGGFP  447



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLSP  255
            E   LLS+KAA   D  +SL SWN ST +C+W  V CD+  + VVSLDLS  NL+G L+P
Sbjct  28   EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAP  86

Query  256  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  435
            ++G+L  LVN+++A NQ +G +P EIS I+ L+ LNLSNN F + FP   + L NL+VLD
Sbjct  87   EIGRLRSLVNITVAENQFAGGIPLEISQINGLKLLNLSNNYFSANFPANFSGLKNLEVLD  146

Query  436  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            LYNNNLTG LP+EV +M +LRHLHLGGN+F+G IPPEYG++  +EYLAVSGN L+G IP
Sbjct  147  LYNNNLTGPLPLEVTEMEALRHLHLGGNFFTGTIPPEYGKWGFIEYLAVSGNELTGKIP  205


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P+  +L  L  L +  N LSGP+ PE+ ++ +L+ ++LSNN+     P + ++L
Sbjct  249  LSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSEL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L+ L L  N F+G +P + G   NL  L +S N 
Sbjct  309  KNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNFTGSVPQQLGMNGNLILLDISSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGSVP  374


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G+   L  L +  N  SG +PP+I  +  L  L+ S+N F      ++   
Sbjct  465  LSGQLPASIGKFSSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNC  524

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L V+DL  N L G +P E+ KM  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  525  KLLTVVDLSGNELNGTIPSEITKMRILNYLNLSRNHLMGGIPPSIQTMQSLTSVDFSYNN  584

Query  595  LSGVIP  612
            LSG++P
Sbjct  585  LSGLVP  590


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P+ G+  F+  L+++ N+L+G +P E+  ++ L+ L L   NI+    P +L  
Sbjct  176  FTGTIPPEYGKWGFIEYLAVSGNELTGKIPGELGNLTKLQQLYLGYYNIYEGGIPPELGN  235

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD+ N  L+G +P E  K+  L  L L  N  SG I PE G   +L+ + +S N
Sbjct  236  LSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNN  295

Query  592  GLSGVIP  612
             L G IP
Sbjct  296  MLDGQIP  302


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P++G L  LV L +A   LSG +PPE   +  L  L L  N        +L  L 
Sbjct  226  EGGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLK  285

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L G +PVE  ++ +L  L+L  N   G IP   G  P L+ L +  N  
Sbjct  286  SLKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNF  345

Query  598  SGVIP  612
            +G +P
Sbjct  346  TGSVP  350


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG ++P++G L  L ++ ++ N L G +P E S +  L  LNL  N    + P  +  L
Sbjct  273  LSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDL  332

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P ++    +L  L +  N  +G +PP+      L  L    N 
Sbjct  333  PELQVLQLWENNFTGSVPQQLGMNGNLILLDISSNKLTGSVPPQLCYGGKLTTLITLDNF  392

Query  595  LSGVIP  612
            L G IP
Sbjct  393  LFGPIP  398


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP LV + + AN L+G +P    A   L  L+LSNN      P  + + 
Sbjct  417  LNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKF  476

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++LQ L L  N  +G +P ++ K+  L  L    N FSG I PE      L  + +SGN 
Sbjct  477  SSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNCKLLTVVDLSGNE  536

Query  595  LSGVIP  612
            L+G IP
Sbjct  537  LNGTIP  542


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L  N      P      
Sbjct  393  LFGPIPESLGECVSLARIRMGENYLNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKAS  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  L L NN L+G LP  + K +SL+ L L GN FSG+IPP+ G+   L  L  S N 
Sbjct  453  ENLGQLSLSNNRLSGQLPASIGKFSSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNK  512

Query  595  LSGVI  609
             SG I
Sbjct  513  FSGEI  517


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 65/130 (50%), Gaps = 6/130 (5%)
 Frame = +1

Query  232  NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  402
             L+G + P +   G+L  L+ L    N L GP+P  +    +L  + +  N    + P  
Sbjct  368  KLTGSVPPQLCYGGKLTTLITLD---NFLFGPIPESLGECVSLARIRMGENYLNGSIPKG  424

Query  403  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  582
            L  L NL  ++L  N LTG+LP       +L  L L  N  SG++P   G+F +L+ L +
Sbjct  425  LLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKFSSLQKLLL  484

Query  583  SGNGLSGVIP  612
             GNG SG IP
Sbjct  485  DGNGFSGQIP  494



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TG LP+ V ++ +LRHLHLGGNY +G+IPPEYG + +L+YLAVSGN L G IP
Sbjct  145  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIP  204


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGTLP  373


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199  LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP  +G   NL  L +  N
Sbjct  259  LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRN  318

Query  592  GLSGVIP  612
             L G IP
Sbjct  319  KLHGAIP  325


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V +LP L +L +  N L+G +PPE  +   L++L +S N    T P ++  
Sbjct  150  NMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGN  209

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L +L+ L + Y N  TG +P ++  +T L  L       SG IP E G+  NL+ L +  
Sbjct  210  LTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQV  269

Query  589  NGLSG  603
            N LSG
Sbjct  270  NALSG  274


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G + P +G L  L+ L  A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLK  284

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N  
Sbjct  285  SLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNF  344

Query  598  SGVIP  612
            +G IP
Sbjct  345  TGNIP  349


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  ++++ NQLSGP+PP I   S ++ L L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  454  LGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNRFS  513

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ K   L  + L  N  SG IP E      L Y  +S N L G IP
Sbjct  514  GPIAPEISKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHLVGSIP  565


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+V+ L+ NN TG++P+ +     L  L +  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGPIP  397


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L   ++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P +     L  L    N L GP+P  +    +L  + +  N F  + P  L  
Sbjct  367  KLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFG  426

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  592  GLSGVIP  612
               G IP
Sbjct  487  MFEGKIP  493


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G    L  + +  N  +G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVS  451

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN F G+IP + GR   L  +  S N 
Sbjct  452  VNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNR  511

Query  595  LSGVI  609
             SG I
Sbjct  512  FSGPI  516


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 0/115 (0%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            LP L  + +  N LSG  P   S    L  + LSNN      P  +   + +Q L L  N
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
               G +P ++ ++  L  +    N FSG I PE  +   L ++ +S N LSG+IP
Sbjct  487  MFEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIP  541


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   +G +P L  + +  N  +G +P  +     L  L++S+N    T P  L  
Sbjct  319  KLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCS  378

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               LQ L    N L G +P  +    SL  + +G N+F+G IP      P L  + +  N
Sbjct  379  GNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDN  438

Query  592  GLSGVIP  612
             LSG  P
Sbjct  439  YLSGNFP  445


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +    G+L  L  L++  N+L G +P  I  +  L  + L  N F    P  L   
Sbjct  296  LTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTN  355

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +LD+ +N LTG LP  +     L+ L   GN+  G IP   G   +L  + +  N 
Sbjct  356  GKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENF  415

Query  595  LSGVIP  612
             +G IP
Sbjct  416  FNGSIP  421


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 63/128 (49%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G    L  L I++N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  343  NFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGP-IPESLG  401

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
               +L  + +  N   G +P  ++ +  L  + L  NY SG  P  +    NL  + +S 
Sbjct  402  GCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSN  461

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  462  NQLSGPLP  469



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TG LP+ V ++ +LRHLHLGGNY +G+IPPEYG + +L+YLAVSGN L G IP
Sbjct  145  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIP  204


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGTLP  373


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ 
Sbjct  198  ELDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIG  257

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP  +G   NL  L +  
Sbjct  258  KLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFR  317

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  318  NKLHGAIP  325


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 1/125 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N++G L   V +LP L +L +  N L+G +PPE  +   L++L +S N    T P ++  
Sbjct  150  NMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGN  209

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L +L+ L + Y N  TG +P ++  +T L  L       SG IP E G+  NL+ L +  
Sbjct  210  LTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQV  269

Query  589  NGLSG  603
            N LSG
Sbjct  270  NALSG  274


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G + P +G L  L+ L  A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLK  284

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N  
Sbjct  285  SLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNF  344

Query  598  SGVIP  612
            +G IP
Sbjct  345  TGNIP  349


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  ++++ NQLSGP+PP I   S ++ L L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  454  LGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNRFS  513

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ K   L  + L  N  SG IP E      L Y  +S N L G IP
Sbjct  514  GPIAPEISKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHLVGSIP  565


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+V+ L+ NN TG++P+ +     L  L +  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGPIP  397


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L   ++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P +     L  L    N L GP+P  +    +L  + +  N F  + P  L  
Sbjct  367  KLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFG  426

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  592  GLSGVIP  612
               G IP
Sbjct  487  MFEGKIP  493


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G    L  + +  N  +G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVS  451

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   + ++ L L GN F G+IP + GR   L  +  S N 
Sbjct  452  VNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNR  511

Query  595  LSGVI  609
             SG I
Sbjct  512  FSGPI  516


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 54/115 (47%), Gaps = 0/115 (0%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            LP L  + +  N LSG  P   S    L  + LSNN      P  +   + +Q L L  N
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
               G +P ++ ++  L  +    N FSG I PE  +   L ++ +S N LSG+IP
Sbjct  487  MFEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIP  541


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   +G +P L  + +  N  +G +P  +     L  L++S+N    T P  L  
Sbjct  319  KLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCS  378

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               LQ L    N L G +P  +    SL  + +G N+F+G IP      P L  + +  N
Sbjct  379  GNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDN  438

Query  592  GLSGVIP  612
             LSG  P
Sbjct  439  YLSGNFP  445


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 58/126 (46%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +    G+L  L  L++  N+L G +P  I  +  L  + L  N F    P  L   
Sbjct  296  LTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTN  355

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +LD+ +N LTG LP  +     L+ L   GN+  G IP   G   +L  + +  N 
Sbjct  356  GKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENF  415

Query  595  LSGVIP  612
             +G IP
Sbjct  416  FNGSIP  421


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 63/128 (49%), Gaps = 2/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G    L  L I++N+L+G +PP + + + L+  + L N +FG   P  L 
Sbjct  343  NFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGP-IPESLG  401

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
               +L  + +  N   G +P  ++ +  L  + L  NY SG  P  +    NL  + +S 
Sbjct  402  GCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSN  461

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  462  NQLSGPLP  469



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 122/178 (69%), Gaps = 2/178 (1%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  258
            E  ALLSIK+  + D  ++LT+W+ +T HC W  VTCD    V        NLSG LSP 
Sbjct  30   EHHALLSIKSQLS-DPGAALTAWDPATDHCAWPGVTCDRAAVVELDLSGR-NLSGPLSPA  87

Query  259  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  438
             G L  L+ LS A N LSGP+PP ++ ++ LR LNLSNN+F  +FP  LA LA+L+VLDL
Sbjct  88   FGSLRSLLRLSAAENSLSGPIPPALALLTVLRHLNLSNNLFDGSFPPALAGLADLRVLDL  147

Query  439  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            YNNNLTG LP EV  +  LRHLHLGGN+FSG IP EYGR+  LEYLAVSGN L G IP
Sbjct  148  YNNNLTGPLPREVAALHQLRHLHLGGNFFSGSIPSEYGRWQFLEYLAVSGNELGGPIP  205


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L +L +  N L G +P E+  + +L+ ++LSNN      P   A L
Sbjct  249  LSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V  +  L  L L  N F+G +P   G+   L+ L +S N 
Sbjct  309  GNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNK  368

Query  595  LSGVIP  612
            L+G +P
Sbjct  369  LTGSLP  374


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG +  + G+  FL  L+++ N+L GP+PPEI  +S+LR L +   N +    P ++  
Sbjct  176  FSGSIPSEYGRWQFLEYLAVSGNELGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPEIGN  235

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD+ N  L+G +P E+  +  L  L L  N   G IP E GR  +L+ + +S N
Sbjct  236  LSTLLRLDVANCGLSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNN  295

Query  592  GLSGVIP  612
             L+G IP
Sbjct  296  ALTGEIP  302


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 65/125 (52%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G L P++G L  L+ L +A   LSG +PPEI  +  L  L L  N      P +L +L 
Sbjct  226  EGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLR  285

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  286  SLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNF  345

Query  598  SGVIP  612
            +G +P
Sbjct  346  TGSVP  350


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L P +     L  L +  N  +G +PPE+  +  L  L+ S N F      ++++ 
Sbjct  467  LTGPLPPSIANFFGLQKLLLNQNSFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKC  526

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G+IP       +L  +  S N 
Sbjct  527  KLLTFVDLSRNELSGDIPEEIAAMRILNYLNLSRNHLEGQIPAAISTMQSLTQVDFSYNN  586

Query  595  LSGVIP  612
            LSGV+P
Sbjct  587  LSGVVP  592


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             L G + P++G L  L  L I   N   G +PPEI  +STL  L+++N       P ++ 
Sbjct  199  ELGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIG  258

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
             L  L  L L  N L G++P+E+ ++ SL+ + L  N  +G IPP +    NL  L +  
Sbjct  259  NLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADLGNLTLLNLFR  318

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  319  NKLFGAIP  326


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +  ++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  273  LVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDL  332

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  333  PELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNKLTGSLPPDLCYGNKLQTLIALGNF  392

Query  595  LSGVIP  612
            L G IP
Sbjct  393  LFGPIP  398


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + +G + P+VG+L  L  L  + N+ +GP+ PEIS    L F++LS N      P ++A 
Sbjct  490  SFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAA  549

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  550  MRILNYLNLSRNHLEGQIPAAISTMQSLTQVDFSYNNLSGVVP  592


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 3/123 (2%)
 Frame = +1

Query  253  PDVGQLPFLVNL---SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
            PD G+ P   NL    ++ N+L+GP+PP I+    L+ L L+ N F    P ++ +L  L
Sbjct  446  PDTGRSPISPNLGQICLSNNRLTGPLPPSIANFFGLQKLLLNQNSFTGGIPPEVGRLQQL  505

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
              LD   N   G +  E+ K   L  + L  N  SG IP E      L YL +S N L G
Sbjct  506  SKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAAMRILNYLNLSRNHLEG  565

Query  604  VIP  612
             IP
Sbjct  566  QIP  568


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F  + P +L + 
Sbjct  297  LTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKN  356

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ LDL +N LTG LP ++     L+ L   GN+  G IP   GR  +L  + ++ N 
Sbjct  357  GRLQSLDLSSNKLTGSLPPDLCYGNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENY  416

Query  595  LSGVIP  612
            L+G IP
Sbjct  417  LNGSIP  422


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 57/127 (45%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   VG LP L  L +  N  +G VP  +     L+ L+LS+N    + P  L  
Sbjct  320  KLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNKLTGSLPPDLCY  379

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               LQ L    N L G +P  + +  SL  + +  NY +G IP      PNL  + +  N
Sbjct  380  GNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENYLNGSIPRGLFSLPNLSQVELQDN  439

Query  592  GLSGVIP  612
             L+G  P
Sbjct  440  LLTGGFP  446



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = +1

Query  67   LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  246
            L  +E  ALLS+++A T  +   L+SWN STS+C+W  VTCDS  HV++L+L+GL+LSG 
Sbjct  18   LPFSEYTALLSLRSAITDATPPVLSSWNASTSYCSWLGVTCDSHRHVIALNLTGLDLSGT  77

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            LS D+  LPFL NLS+A N+ SGP+PP +S++S+LR LNLSNN F  TFP +L++L +L+
Sbjct  78   LSADIAHLPFLSNLSLATNKFSGPIPPALSSLSSLRLLNLSNNGFNQTFPPELSRLQSLE  137

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNN+TG LP+   +M +LRHLHLGGN+FSGRIPPEYG++  LEYLAVSGN L G 
Sbjct  138  VLDLYNNNMTGALPLAAAQMLNLRHLHLGGNFFSGRIPPEYGQWQRLEYLAVSGNELEGK  197

Query  607  IP  612
            IP
Sbjct  198  IP  199


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG ++  +G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   ++L
Sbjct  243  LSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSEL  302

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N L G +P  + ++ SL  + L  N F+G IP   G+   L  L +S N 
Sbjct  303  KNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWENNFTGSIPEGLGKNGRLSVLDISSNK  362

Query  595  LSGVIP  612
            L+G +P
Sbjct  363  LTGALP  368


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N  SGP+PP+I  +  L  ++ S N F      +++Q 
Sbjct  459  LSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEPEISQC  518

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  N+L+G++P E+  M  L  L+L  N+  G IP       +L  +  S N 
Sbjct  519  KLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSIPSSISSMQSLTSVDFSYNN  578

Query  595  LSGVIP  612
            LSG++P
Sbjct  579  LSGLVP  584


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  411
             SG + P+ GQ   L  L+++ N+L G +PPEI  +++LR L +   N +    P ++  
Sbjct  170  FSGRIPPEYGQWQRLEYLAVSGNELEGKIPPEIGNLTSLRELYIGYYNTYEGGIPPEIGN  229

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD     L+G++   + K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  230  LSELVRLDAAYCGLSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNN  289

Query  592  GLSGVIP  612
             LSG IP
Sbjct  290  MLSGEIP  296


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+P++G L  L ++ ++ N LSG +P   S +  +  LNL  N      P  + +L
Sbjct  267  LSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGEL  326

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+V+ L+ NN TG +P  + K   L  L +  N  +G +PP       L+ L    N 
Sbjct  327  PSLEVVQLWENNFTGSIPEGLGKNGRLSVLDISSNKLTGALPPYLCSGNTLQTLITLENF  386

Query  595  LSGVIP  612
            L G IP
Sbjct  387  LFGPIP  392


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  387  LFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVA  446

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   +S++ L L GN FSG IPP+ GR   L  +  SGN 
Sbjct  447  VNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNK  506

Query  595  LSGVI  609
             SG I
Sbjct  507  FSGRI  511


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 1/121 (1%)
 Frame = +1

Query  253  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            P+ G +   L  ++++ NQLSGP+PP I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  440  PEAGSVAVNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSK  499

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L  L +S N L G I
Sbjct  500  IDFSGNKFSGRIEPEISQCKLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSI  559

Query  610  P  612
            P
Sbjct  560  P  560


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG  P   S    L  + LSNN      P  +   
Sbjct  411  LNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSNNQLSGPLPPSIGNF  470

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            +++Q L L  N  +G +P ++ ++  L  +   GN FSGRI PE  +   L +L +S N 
Sbjct  471  SSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEPEISQCKLLTFLDLSRND  530

Query  595  LSGVIP  612
            LSG IP
Sbjct  531  LSGEIP  536


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P++G L  LV L  A   LSG +   +  +  L  L L  N        +L  L 
Sbjct  220  EGGIPPEIGNLSELVRLDAAYCGLSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLK  279

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P+LE + +  N  
Sbjct  280  SLKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWENNF  339

Query  598  SGVIP  612
            +G IP
Sbjct  340  TGSIP  344


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P +     L  L    N L GP+P  + +  +L  + +  N    + P  L  
Sbjct  362  KLTGALPPYLCSGNTLQTLITLENFLFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFG  421

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G  P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  422  LPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGN  481

Query  592  GLSGVIP  612
              SG IP
Sbjct  482  MFSGPIP  488



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L G LS D+  L FL N ++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ 
Sbjct  26   DLVGTLSSDIAHLRFLSNGTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSN  85

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPPE+GRFP LEYLAVSGN
Sbjct  86   LTRLAVLDLYNNNLTGDLPVAVTHMTSLRHLHLGGNFFSGRIPPEFGRFPLLEYLAVSGN  145

Query  592  GLSGVIP  612
             L G IP
Sbjct  146  ELGGSIP  152


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ G+ P L  L+++ N+L G +PPEI  +++L+ L +   N++    P ++  
Sbjct  123  FSGRIPPEFGRFPLLEYLAVSGNELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGN  182

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD  N NLTG++P E+ ++ ++  L L  N  SG +  E G   +L+ + +S N
Sbjct  183  LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNN  242

Query  592  GLSGVIP  612
              SG IP
Sbjct  243  MFSGEIP  249


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  195  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  254

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L  L +S N
Sbjct  255  LKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSN  314

Query  592  GLSGVIP  612
             L+G +P
Sbjct  315  KLTGTLP  321


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  220  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  279

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQVL L+ NN TG +P  + K   L  L L  N  +G +PP+     NL+ L   GN 
Sbjct  280  PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNF  339

Query  595  LSGVIP  612
            L G IP
Sbjct  340  LFGPIP  345


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  412  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  471

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  472  KLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  531

Query  595  LSGVIP  612
            LSG++P
Sbjct  532  LSGLVP  537


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  340  LFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLAGSFPETETIS  399

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ANL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +  S N 
Sbjct  400  ANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNK  459

Query  595  LSGVI  609
              G I
Sbjct  460  FLGPI  464


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 56/127 (44%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  315  KLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFG  374

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  375  LPKLTQVELQDNLLAGSFPETETISANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  434

Query  592  GLSGVIP  612
              SG IP
Sbjct  435  KFSGRIP  441


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  402  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFL  461

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+ +   L  + L  N  +G IP E      L YL +S N L G IP
Sbjct  462  GPIAPEISQCKLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIP  513


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 76/176 (43%), Gaps = 8/176 (5%)
 Frame = +1

Query  85   AALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  264
            A L S+K+  + D  +++ S  I  S    + +T  +L            L G +   +G
Sbjct  226  AELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRN--------KLHGAIPEFIG  277

Query  265  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  444
             LP L  L +  N  +G +P  +     L  L+LS+N    T P  +    NLQ L    
Sbjct  278  DLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLG  337

Query  445  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N L G +P  + K  SL  + +G N+ +G IP      P L  + +  N L+G  P
Sbjct  338  NFLFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLAGSFP  393



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 134/182 (74%), Gaps = 4/182 (2%)
 Frame = +1

Query  76   TEQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGV  246
            TE  ALL +KAA  +D  ++L++WN S    HC+W  V CD     VVSLDLSGLNLSG 
Sbjct  29   TEVEALLELKAA-VSDPSAALSAWNSSDGVDHCSWPGVACDPLRGSVVSLDLSGLNLSGT  87

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            LSP VG+L  L+NLS+A+N LSGP+P ++S ++ LR LNLS+N+   +FP  LA L NL 
Sbjct  88   LSPAVGRLRHLLNLSVASNSLSGPIPADLSRLADLRHLNLSDNLLNGSFPSALAHLKNLL  147

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTG LP EV ++ +LRHLHLGGN+F+G IPPE+G +  LEYLAVSGN L G 
Sbjct  148  VLDLYNNNLTGPLPAEVAELPNLRHLHLGGNFFTGVIPPEFGGWEFLEYLAVSGNDLGGP  207

Query  607  IP  612
            IP
Sbjct  208  IP  209


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 65/124 (52%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G + P++G+L  LV L +A   LSG +PPE+  +  L  L L  N      P  L +L +
Sbjct  231  GGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNLDTLFLQVNGLAGDIPSALGRLRS  290

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L+ +D+ NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  291  LKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDLPALEVLQLWENNFT  350

Query  601  GVIP  612
            G IP
Sbjct  351  GGIP  354


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 63/122 (52%), Gaps = 6/122 (5%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            +SPD+G    L+NLS   N+LSGP+P  I   S ++ L L+ N F    P +  +L  L 
Sbjct  457  ISPDLG----LINLS--NNRLSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELC  510

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             LDL  N  +G +  E+ +   L  + L  N  SG IPP+      L YL +S N L G 
Sbjct  511  KLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLEGS  570

Query  607  IP  612
            IP
Sbjct  571  IP  572


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G+   +  L +  NQ SG +PPE   +  L  L+LS N F      ++++ 
Sbjct  471  LSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRC  530

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N ++G++P ++  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  531  KLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLEGSIPQSLATIQSLTAVDFSYNN  590

Query  595  LSGVI  609
            LSG++
Sbjct  591  LSGLV  595


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +G+L  L ++ I+ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  277  LAGDIPSALGRLRSLKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDL  336

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP+      L+ L V  N 
Sbjct  337  PALEVLQLWENNFTGGIPQRLGESARLQLLDVSSNKLTGNLPPDLCSGNRLQTLIVLRNF  396

Query  595  LSGVIP  612
            L G IP
Sbjct  397  LFGPIP  402


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 67/152 (44%), Gaps = 26/152 (17%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L +  N L GP+P  +    +L  + +  N   ++ P  L  
Sbjct  372  KLTGNLPPDLCSGNRLQTLIVLRNFLFGPIPETLGRCESLGRIRMGQNYLNASIPDALFS  431

Query  412  L--------------------------ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  513
            L                           +L +++L NN L+G LP  + K + ++ L L 
Sbjct  432  LPKLSQIELEDNLLTGGFPDTGNAAISPDLGLINLSNNRLSGPLPRSIGKYSGVQKLLLN  491

Query  514  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
             N FSGRIPPE GR   L  L +SGN  SG I
Sbjct  492  QNQFSGRIPPETGRLQELCKLDLSGNRFSGPI  523


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L + 
Sbjct  301  LTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDLPALEVLQLWENNFTGGIPQRLGES  360

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A LQ+LD+ +N LTG+LP ++     L+ L +  N+  G IP   GR  +L  + +  N 
Sbjct  361  ARLQLLDVSSNKLTGNLPPDLCSGNRLQTLIVLRNFLFGPIPETLGRCESLGRIRMGQNY  420

Query  595  LSGVIP  612
            L+  IP
Sbjct  421  LNASIP  426



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 118/166 (71%), Gaps = 1/166 (1%)
 Frame = +1

Query  118  ADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSI  294
            +D   +L SW N + SHC W  VTC +   VV LD++GLNLSG L P + +L  L  LS+
Sbjct  36   SDPTGALASWANGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALPPALSRLRGLFRLSV  95

Query  295  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  474
            AAN  SGP+P  ++ +  L  LNLSNN F  +FP  LA+L +L+VLDLYNNNLT  LP+E
Sbjct  96   AANAFSGPIPASLARLQFLVHLNLSNNAFDGSFPAPLARLRSLRVLDLYNNNLTSPLPLE  155

Query  475  VYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            V +M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP
Sbjct  156  VVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIP  201


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  
Sbjct  147  NLTSPLPLEVVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGN  206

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  576
            L +L+ L + Y N+ +G LP E+  +T L          SG IPPE G+   L+ L
Sbjct  207  LTSLRELYIGYYNSYSGGLPPELGNLTELVRFDAANCGLSGEIPPELGKLQTLDTL  262



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 123/182 (68%), Gaps = 27/182 (15%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  249
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  426
              DV +     NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63   --DVSRRH---NLSLADNQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDKISSGLANLR  117

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L+G 
Sbjct  118  VLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNELTGK  177

Query  607  IP  612
            IP
Sbjct  178  IP  179


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  223  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  282

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  283  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  342

Query  595  LSGVIP  612
            L+G +P
Sbjct  343  LTGTLP  348


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  203  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  262

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N  +G 
Sbjct  263  SMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGS  322

Query  607  IP  612
            IP
Sbjct  323  IP  324


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  439  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISRC  498

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  499  KLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNN  558

Query  595  LSGVIP  612
            LSG++P
Sbjct  559  LSGLVP  564


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  150  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  209

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  210  LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  269

Query  592  GLSGVIP  612
              +G IP
Sbjct  270  MFTGEIP  276


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  247  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  307  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  366

Query  595  LSGVIP  612
            L G IP
Sbjct  367  LFGSIP  372


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  421  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  474

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  475  QQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNH  534

Query  595  LSGVIP  612
            L G IP
Sbjct  535  LIGSIP  540


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  342  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGRCESLTRIRMGENFLNGSIPKGLFG  401

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  402  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  461

Query  592  GLSGVIP  612
               G IP
Sbjct  462  KFEGPIP  468


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P   S    L  L+LSNN      P  +   
Sbjct  391  LNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNF  450

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSG I PE  R   L ++ +S N 
Sbjct  451  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNE  510

Query  595  LSGVIP  612
            LSG IP
Sbjct  511  LSGEIP  516


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  271  FTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  330

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   GR  +L  + +  N 
Sbjct  331  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGRCESLTRIRMGENF  390

Query  595  LSGVIP  612
            L+G IP
Sbjct  391  LNGSIP  396


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P   +  
Sbjct  367  LFGSIPESLGRCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVS  426

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  L L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N 
Sbjct  427  VNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNL  486

Query  595  LSGVI  609
             SG I
Sbjct  487  FSGGI  491



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 133/182 (73%), Gaps = 5/182 (3%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl--lhvvsldlsglNLSGV  246
            E+ ALLS+K+A + D  ++L  WN S    HC+W  V CD      V++LDLSGLNLSG 
Sbjct  33   ERVALLSLKSALS-DPGAALAGWNASANPDHCSWPGVACDDAPLRRVIALDLSGLNLSGS  91

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P V  L  L+NLS AAN LSGP+P ++S +S LR+LNLSNN+F  +FP  L +L NL+
Sbjct  92   LPPAVAHLRHLLNLSTAANLLSGPIPLDLSLLSDLRYLNLSNNVFNGSFPSALRRLKNLE  151

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTG LP EV  + +LRHLHLGGN+FSG IP EYGR+ +LEYLAVSGN LSG 
Sbjct  152  VLDLYNNNLTGILPAEVADLHNLRHLHLGGNFFSGVIPREYGRWEHLEYLAVSGNELSGA  211

Query  607  IP  612
            IP
Sbjct  212  IP  213


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  NQ SG +PPEI  +  L  ++ S+N F S  P ++++ 
Sbjct  475  LSGPLPPSIGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKC  534

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  NNL+GD+P E+  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  535  KLLTFVDLSRNNLSGDIPAEIAGMRILNYLNLSRNHLEGSIPPSISTMQSLTAVDFSYNN  594

Query  595  LSGVIP  612
            LSG++P
Sbjct  595  LSGLVP  600


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  257  LSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADL  316

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  317  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  376

Query  595  LSGVIP  612
            L+G +P
Sbjct  377  LTGDLP  382


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  281  LSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  340

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L++NN TG +P  + +   L+ L L  N  +G +PPE      L+ L    N 
Sbjct  341  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELCSGNKLQTLIALANA  400

Query  595  LSGVIP  612
            L G IP
Sbjct  401  LFGPIP  406


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SGV+  + G+   L  L+++ N+LSG +PPEI  ++ LR L +   N +    P ++  
Sbjct  184  FSGVIPREYGRWEHLEYLAVSGNELSGAIPPEIGNLTRLRQLYVGYFNSYDGGIPPEIGH  243

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L+G +P E+  +  L  L L  N  SG +PPE GR  +L+ + +S N
Sbjct  244  LSALVRFDAANCGLSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNN  303

Query  592  GLSGVIP  612
             L+G IP
Sbjct  304  ALTGEIP  310


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L 
Sbjct  234  DGGIPPEIGHLSALVRFDAANCGLSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLR  293

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  294  SLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNF  353

Query  598  SGVIP  612
            +G+IP
Sbjct  354  TGIIP  358


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             LSG + P++G L  L  L +   N   G +PPEI  +S L   + +N       P +L 
Sbjct  207  ELSGAIPPEIGNLTRLRQLYVGYFNSYDGGIPPEIGHLSALVRFDAANCGLSGQIPPELG  266

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
             L +L  L L  N L+G+LP E+ ++ SL+ + L  N  +G IPP +    NL  L +  
Sbjct  267  HLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFR  326

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  327  NKLYGTIP  334


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 2/128 (2%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP--EISAISTLRFLNLSNNIFGSTFPHQLA  408
            L+G +   +  LP L  + +  N L+G  P   ++S    L  ++LSNN      P  + 
Sbjct  425  LNGSIPRGLFSLPNLAQVELQDNLLAGEFPDTGDVSISLGLGQISLSNNRLSGPLPPSIG  484

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
              + +Q L L  N  +G +P E+ ++  L  +    N FS  IPPE  +   L ++ +S 
Sbjct  485  NFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKCKLLTFVDLSR  544

Query  589  NGLSGVIP  612
            N LSG IP
Sbjct  545  NNLSGDIP  552



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            ++E  +LLS K++ T D Q+ LTSWN  T +C+W  + C    HV+SL+L+ L+L+G LS
Sbjct  25   ISEYHSLLSFKSSITNDPQNILTSWNPKTPYCSWYGIKCSQHRHVISLNLTSLSLTGTLS  84

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
              +  LPFL NLS+A N+ SGP+P  +S++S+LRFLNLSNNIF  T P +L+ L NLQVL
Sbjct  85   --LSNLPFLTNLSLADNKFSGPIPSSLSSLSSLRFLNLSNNIFNGTLPQELSNLFNLQVL  142

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            DLYNNN+TG LPV V  ++ LRHLHLGGN+F+G+IPPEYG + +LEYLAVSGN LSG IP
Sbjct  143  DLYNNNMTGSLPVSVTHLSFLRHLHLGGNFFTGKIPPEYGSWTHLEYLAVSGNELSGHIP  202


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN F    P   A+L
Sbjct  246  LTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAEL  305

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + +M SL  L +  N F+G IP   G+   L  + VS N 
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNK  365

Query  595  LSGVIP  612
            L+G +P
Sbjct  366  LTGSLP  371


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P++G L  +V    A   L+G VPPE+  +  L  L L  N    +   +L  L 
Sbjct  223  DGGIPPEIGNLSEMVRFDAAYCGLTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLK  282

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN  TG++PV   ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  283  SLKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWENNF  342

Query  598  SGVIP  612
            +G IP
Sbjct  343  TGSIP  347


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  390  LFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMS  449

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +   TS++ L L GN FSG+IP E G+   L  +  S N 
Sbjct  450  INLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNK  509

Query  595  LSGVI  609
             SG I
Sbjct  510  FSGPI  514


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  ++++ N+LSGP+PP I   ++++ L L  N F    P ++ +L  L  +D  +N  +
Sbjct  452  LGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNKFS  511

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +  E+     L  + L  N  SG IP E  +   L YL +S N L G IP
Sbjct  512  GPIAPEISHCKLLTFVDLSRNELSGEIPKEITKMKILNYLNLSRNHLVGTIP  563


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG +  ++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++ ++
Sbjct  486  FSGKIPAEIGKLHQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPKEITKM  545

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L  L+L  N+L G +P  +  M SL  +    N  +G +P   G+F    Y +  GN
Sbjct  546  KILNYLNLSRNHLVGTIPGSIASMQSLTSVDFSYNNLTGLVPGT-GQFSYFNYTSFLGN  603


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L+ ++G L  L ++ ++ N  +G VP   + +  L  LNL  N      P  + ++
Sbjct  270  LSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEM  329

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL ++ NN TG +P  + K   L  + +  N  +G +PP       L+ L   GN 
Sbjct  330  PSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPPFMCFGNKLQTLIALGNF  389

Query  595  LSGVIP  612
            L G IP
Sbjct  390  LFGPIP  395


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N LSG  P  +S    L  + LSNN      P  +   
Sbjct  414  LNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNF  473

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             ++Q L L  N  +G +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  474  TSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNE  533

Query  595  LSGVIP  612
            LSG IP
Sbjct  534  LSGEIP  539


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365  KLTGSLPPFMCFGNKLQTLIALGNFLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFG  424

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N L+G+ P  V    +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  425  LPELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGN  484

Query  592  GLSGVIP  612
              SG IP
Sbjct  485  QFSGKIP  491



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +1

Query  97   SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl--lhvvsldlsglNLSGVLSPDVG  264
            S+K+A + D  ++L  WN S    HC+W  V CD+     V+SLDL+GLNLSG L P V 
Sbjct  42   SLKSALS-DPGAALAGWNASAYPDHCSWPGVACDNAPLRRVISLDLTGLNLSGSLPPAVA  100

Query  265  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  444
             L  L+NLS AAN LSGP+PPE+S +  LR LNLSNN+F  +FP  L +L +L+VLDLYN
Sbjct  101  HLRHLLNLSAAANLLSGPIPPELSLLFDLRHLNLSNNVFNGSFPSALRRLKHLEVLDLYN  160

Query  445  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            NNLTG LP E   + +LRHLHLGGN+FSG IPPEYGR+ +LEYLAVSGN L G IP
Sbjct  161  NNLTGVLPAEAADLPNLRHLHLGGNFFSGVIPPEYGRWEHLEYLAVSGNELGGAIP  216


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN F    P   A L
Sbjct  260  LSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADL  319

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  320  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  379

Query  595  LSGVIP  612
            L+G +P
Sbjct  380  LTGDLP  385


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 67/128 (52%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+GVL  +   LP L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  162  NLTGVLPAEAADLPNLRHLHLGGNFFSGVIPPEYGRWEHLEYLAVSGNELGGAIPPEIGN  221

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L+ L + Y N+  G +P E  K+++L          SG IPPE GR  NL+ L +  
Sbjct  222  LTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPPELGRLENLDTLFLQV  281

Query  589  NGLSGVIP  612
            NGLSG +P
Sbjct  282  NGLSGELP  289


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P++G+L  L ++ ++ N  +G +PP  + +  L  LNL  N    T P  +  L
Sbjct  284  LSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  343

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L++NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  344  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELCSGNKLQTLIALGNA  403

Query  595  LSGVIP  612
            L G IP
Sbjct  404  LFGPIP  409


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  NQ SG +P EI  +  L  ++ S+N F    P ++++ 
Sbjct  478  LSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQLSKVDFSSNSFSGGIPPEMSKC  537

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  NNL+G++P E+  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  538  KLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPPSIATMQSLTAVDFSYNN  597

Query  595  LSGVIP  612
            LSG++P
Sbjct  598  LSGLVP  603


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             L G + P++G L  L  L I   N   G +PPE   +S L   + +N       P +L 
Sbjct  210  ELGGAIPPEIGNLTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPPELG  269

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +L NL  L L  N L+G+LP E+ ++ SL+ + L  N F+G IPP +    NL  L +  
Sbjct  270  RLENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFR  329

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  330  NKLYGTIP  337


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P+ G+L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L 
Sbjct  237  DGGIPPEFGKLSALVRFDAANCGLSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLR  296

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN  TG++P     + +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  297  SLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNF  356

Query  598  SGVIP  612
            +G+IP
Sbjct  357  TGIIP  361


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +1

Query  253  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
            PD G     P L  +S++ N+LSGP+PP I   S ++ L L+ N F    P ++ +L  L
Sbjct  457  PDTGNASISPSLGQISLSNNRLSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQL  516

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
              +D  +N+ +G +P E+ K   L  + LG N  SG IP E      L YL +S N L G
Sbjct  517  SKVDFSSNSFSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEG  576

Query  604  VIP  612
             IP
Sbjct  577  SIP  579


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SG + P++ +   L  + +  N LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  525  SFSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPPSIAT  584

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L  +D   NNL+G +P
Sbjct  585  MQSLTAVDFSYNNLSGLVP  603



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +1

Query  121  DSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  297
            D   +L +WN +  HC+W  V CD   + V+SLDL+GLNLSG LSP VG+L  LVNLS A
Sbjct  46   DPSGALYAWNSADGHCSWPGVACDPIRVFVLSLDLTGLNLSGTLSPAVGRLHHLVNLSTA  105

Query  298  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  477
            +N LSGP+P E+S +S LR LNLSNN+F  +FP   ++L NL VLDLYNNNL G LP EV
Sbjct  106  SNSLSGPLPAELSHLSNLRHLNLSNNLFNGSFPSAFSRLKNLLVLDLYNNNLAGTLPPEV  165

Query  478  YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             ++ +L HLHLGGN+FSG IPPE+G +  LEYLAVSGN L G IP
Sbjct  166  SELPNLLHLHLGGNFFSGVIPPEFGHWEFLEYLAVSGNELGGPIP  210


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SGV+ P+ G   FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  181  FSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGG  240

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD+ N  LTGD+P E+ K+ +L  L L  N  SGR+PPE G   +L+ + +S N
Sbjct  241  LSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNN  300

Query  592  GLSGVIP  612
             L+G IP
Sbjct  301  ALTGEIP  307


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  254  LTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADL  313

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  314  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNK  373

Query  595  LSGVIP  612
            L+G +P
Sbjct  374  LTGTLP  379


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G + P++G L  LV L +A   L+G +PPE+  +  L  L L  N      P +L  
Sbjct  229  SFEGGIPPEIGGLSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGG  288

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  289  LRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWEN  348

Query  592  GLSGVIP  612
              +G IP
Sbjct  349  NFTGGIP  355


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P++G L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  278  LSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDL  337

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP       L+ L   GN 
Sbjct  338  PALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNF  397

Query  595  LSGVIP  612
            L G IP
Sbjct  398  LFGSIP  403


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 6/125 (5%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +  +SPD+GQ    +NLS   N+L GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  455  AAAISPDLGQ----INLS--NNRLLGPLPPSIGNFSGLQKLLLNQNQFSGGIPPEIGRLQ  508

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L  +D   N  +G +  E+ +   L  + L  N  SG I PE      L YL +S N L
Sbjct  509  QLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGMRILNYLNLSRNQL  568

Query  598  SGVIP  612
             G IP
Sbjct  569  EGSIP  573


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
              SG + P++G+L  L  +  + NQ SGP+ PEIS    L F++LS N        ++A 
Sbjct  495  QFSGGIPPEIGRLQQLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAG  554

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
            +  L  L+L  N L G +P  +  M SL  +    N FSG +P
Sbjct  555  MRILNYLNLSRNQLEGSIPPSISTMQSLTAVDFSYNNFSGLVP  597


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L Q 
Sbjct  302  LTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQS  361

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LD+ +N LTG LP  +     L+ L   GN+  G IP   G+  ++  + +  N 
Sbjct  362  GRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNFLFGSIPETLGQCQSVSRIRMGENY  421

Query  595  LSGVIP  612
            L+G IP
Sbjct  422  LNGSIP  427


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 69/176 (39%), Gaps = 50/176 (28%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPP---------------------------E  330
            N +G +   +GQ   L  L I++N+L+G +PP                           +
Sbjct  349  NFTGGIPRRLGQSGRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNFLFGSIPETLGQ  408

Query  331  ISAISTLRF---------------------LNLSNNIFGSTFPHQLAQLA--NLQVLDLY  441
              ++S +R                      L L +N+    FP   A     +L  ++L 
Sbjct  409  CQSVSRIRMGENYLNGSIPDGFFSLPKLSQLELQDNLLAGVFPDTGAAAISPDLGQINLS  468

Query  442  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            NN L G LP  +   + L+ L L  N FSG IPPE GR   L  +  SGN  SG I
Sbjct  469  NNRLLGPLPPSIGNFSGLQKLLLNQNQFSGGIPPEIGRLQQLSKVDFSGNQFSGPI  524



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 110/166 (66%), Gaps = 2/166 (1%)
 Frame = +1

Query  121  DSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  294
            D   SL SW N ST  C W  V+CD     V        NLSG +     +LP+L  L++
Sbjct  37   DPTGSLASWSNASTGPCAWSGVSCDGRSGAVVGVDLSGRNLSGAVPRAFSRLPYLARLNL  96

Query  295  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  474
            AAN LSGP+PP +S +  L +LNLS+N+   +FP  LA+L  L+VLDLYNNN TG LP+E
Sbjct  97   AANSLSGPIPPSLSRLGLLTYLNLSSNLLNGSFPPPLARLRALRVLDLYNNNFTGSLPLE  156

Query  475  VYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            V  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP
Sbjct  157  VVGMAQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIP  202


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIS-TLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   + +LP L  + +  N LSG  P  +SA    L  ++LSNN    + P  +  
Sbjct  414  LNGSIPEGLFELPNLTQVELQDNLLSGSFPAVVSAGGPNLGGISLSNNQLTGSLPASIGS  473

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + LQ L L  N  TG +P E+ ++  L    L GN F G +P E G+   L YL VS N
Sbjct  474  FSGLQKLLLDQNAFTGAIPPEIGRLQQLSKADLSGNSFDGGVPSEIGKCRLLTYLDVSQN  533

Query  592  GLSGVIP  612
             LSG IP
Sbjct  534  KLSGDIP  540


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L+G +PP +  + +L  L+LSNN      P     L
Sbjct  246  LSGEIPPELGNLAKLDTLFLQVNGLTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVAL  305

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL + +L+ N L GD+P  V  +  L  L L  N F+G IP   GR    + L +S N 
Sbjct  306  KNLTLFNLFRNRLRGDIPQFVGDLPGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  365

Query  595  LSGVIP  612
            L+G +P
Sbjct  366  LTGTLP  371


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P +G+L  L +L ++ N LSG +P    A+  L   NL  N      P  +  L
Sbjct  270  LTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVALKNLTLFNLFRNRLRGDIPQFVGDL  329

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + +    + L L  N  +G +PPE      LE L   GN 
Sbjct  330  PGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPELCAGGKLETLIALGNS  389

Query  595  LSGVIP  612
            L G IP
Sbjct  390  LFGPIP  395


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P +L   
Sbjct  318  LRGDIPQFVGDLPGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPELCAG  377

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+ L    N+L G +P  + K  +L  + LG N+ +G IP      PNL  + +  N 
Sbjct  378  GKLETLIALGNSLFGPIPDSLGKCKALTRVRLGENFLNGSIPEGLFELPNLTQVELQDNL  437

Query  595  LSGVIP  612
            LSG  P
Sbjct  438  LSGSFP  443


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G +  ++G+   L  L ++ N+LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  510  SFDGGVPSEIGKCRLLTYLDVSQNKLSGDIPPAISGMRILNYLNLSRNQLDGEIPVTIAA  569

Query  412  LANLQVLDLYNNNLTGDLPV  471
            + +L  +D   NNL+G +PV
Sbjct  570  MQSLTAVDFSYNNLSGLVPV  589


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 57/126 (45%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +      L  L   ++  N+L G +P  +  +  L  L L  N F    P +L + 
Sbjct  294  LSGEIPATFVALKNLTLFNLFRNRLRGDIPQFVGDLPGLEVLQLWENNFTGGIPRRLGRN  353

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
               Q+LDL +N LTG LP E+     L  L   GN   G IP   G+   L  + +  N 
Sbjct  354  GRFQLLDLSSNRLTGTLPPELCAGGKLETLIALGNSLFGPIPDSLGKCKALTRVRLGENF  413

Query  595  LSGVIP  612
            L+G IP
Sbjct  414  LNGSIP  419



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = +1

Query  115  TADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  285
             +D   +L++WN S S  HC+W  V CD     VVSLDL+G NLSG LS  V +L  L+N
Sbjct  43   VSDPSDALSAWNNSASGGHCSWPGVACDPLRGFVVSLDLTGFNLSGTLSLAVVRLRHLLN  102

Query  286  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  465
            LS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  + +L NL VLD+YNNNLTG L
Sbjct  103  LSAASNSLSGPIPAELSRLSNLRHLNLSNNLFNGSFPSAIVRLKNLLVLDIYNNNLTGPL  162

Query  466  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            P EV ++ +LRHLHLGGN+FSG IPP +GR+  LEYLAVSGN L G IP
Sbjct  163  PAEVSELPNLRHLHLGGNFFSGVIPPVFGRWEFLEYLAVSGNELGGPIP  211


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SGV+ P  G+  FL  L+++ N+L GP+PPE+  ++ LR L L   N F    P ++  
Sbjct  182  FSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYLGYFNNFEGGIPPEIGG  241

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  LD+ N  LTG++P E+  + +L  L L  N  SGR+P E GR  +L+ + +S N
Sbjct  242  LPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNN  301

Query  592  GLSGVIP  612
             L+G IP
Sbjct  302  ALTGEIP  308


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  230  NFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGR  289

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  290  LRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWEN  349

Query  592  GLSGVIP  612
              +G IP
Sbjct  350  NFTGGIP  356


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G L  L  L +  N LSG +P E+  + +L+ ++LSNN      P   A L
Sbjct  255  LTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADL  314

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   G+   L+ + +S N 
Sbjct  315  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNK  374

Query  595  LSGVIP  612
            L+G +P
Sbjct  375  LTGTLP  380


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 66/128 (52%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G L  +V +LP L +L +  N  SG +PP       L +L +S N  G   P +L  
Sbjct  157  NLTGPLPAEVSELPNLRHLHLGGNFFSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGN  216

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L  L+ L L Y NN  G +P E+  +  L  L +     +G IPPE G   NL+ L +  
Sbjct  217  LTRLRQLYLGYFNNFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQV  276

Query  589  NGLSGVIP  612
            NGLSG +P
Sbjct  277  NGLSGRLP  284


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G L  L  L +  NQ SG +PPE+  +  L  L+ S N F      ++++ 
Sbjct  473  LSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRC  532

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G+LP E+  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  533  KLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQLEGSIPASIATMQSLTAVDFSYNN  592

Query  595  LSGVIP  612
            LSG++P
Sbjct  593  LSGLVP  598


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 6/125 (5%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +  +SPD+GQ+      S++ N+LSGP+PP I  ++ L+ L L+ N F    P ++ +L 
Sbjct  456  AAAISPDLGQI------SLSNNRLSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQ  509

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L  LD   N  +G +  E+ +   L  + L  N  SG +PPE      L YL +S N L
Sbjct  510  QLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQL  569

Query  598  SGVIP  612
             G IP
Sbjct  570  EGSIP  574


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 63/152 (41%), Gaps = 26/152 (17%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + PH L  
Sbjct  374  KLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLGRCESLGRIRMGENYLNGSIPHGLFS  433

Query  412  LANLQVLDLY--------------------------NNNLTGDLPVEVYKMTSLRHLHLG  513
            L  L  L+L                           NN L+G LP  +  +T L+ L L 
Sbjct  434  LPKLSQLELQDNLLTGGFPDTGAAAISPDLGQISLSNNRLSGPLPPSIGNLTGLQKLLLN  493

Query  514  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
             N FSGRIPPE GR   L  L  SGN  SG I
Sbjct  494  QNQFSGRIPPEMGRLQQLSKLDFSGNRFSGPI  525


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L  ++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  279  LSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDL  338

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP+      L+ L   GN 
Sbjct  339  PALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNKLTGTLPPDLCFGNKLQTLIALGNF  398

Query  595  LSGVIP  612
            L G IP
Sbjct  399  LFGPIP  404


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L Q 
Sbjct  303  LTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQS  362

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ++DL +N LTG LP ++     L+ L   GN+  G IP   GR  +L  + +  N 
Sbjct  363  GRLQIVDLSSNKLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLGRCESLGRIRMGENY  422

Query  595  LSGVIP  612
            L+G IP
Sbjct  423  LNGSIP  428



>ref|XP_010675918.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=940

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            ++E+ ALLSIK+A T D Q+ L+SWN +T HC+W  +TC SL   V       L L+G+L
Sbjct  51   LSEEKALLSIKSAITDDPQNYLSSWNTTTHHCSWPFITCSSLSSSVISLDISGLELTGIL  110

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SPD+G L  L NL+IA N  S P+PP +S ++ LR+LNLS N F +TFP   + L  L +
Sbjct  111  SPDIGSLTHLQNLNIAENSFSDPIPPSLSLLTQLRYLNLSYNDF-TTFPSTFSSLKKLTI  169

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  585
            LD+ +NN TG LP+ V +M+ LR+L LGGN+F G +PPEYG++ NLEYL+ S
Sbjct  170  LDILSNNFTGLLPLSVVEMSELRYLDLGGNHFYGEVPPEYGQWENLEYLSFS  221


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (54%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N SG +  ++G+L  L  LS   N+LSG +P E+ ++ +L+ ++  NN      P   + 
Sbjct  259  NFSGKIPTELGKLKKLEVLSFYENKLSGGLPFELGSMKSLKHMDFFNNTLSGVIPESYSL  318

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+   DL NN L G +P  +     L  L L  N F+G IPP+ G    L+++ +  N
Sbjct  319  LQNITHFDLGNNKLHGSIPDFIGDFPELEELDLSSNNFTGSIPPKLGTNGRLQFVRMDRN  378

Query  592  GLSGVIP  612
             L+G++P
Sbjct  379  NLTGILP  385


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG + P++G L  L  L  +    SG +P E+  +  L  L+   N      P +L  +
Sbjct  236  FSGGIPPELGNLTKLTTLYGSTCNFSGKIPTELGKLKKLEVLSFYENKLSGGLPFELGSM  295

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+ +D +NN L+G +P     + ++ H  LG N   G IP   G FP LE L +S N 
Sbjct  296  KSLKHMDFFNNTLSGVIPESYSLLQNITHFDLGNNKLHGSIPDFIGDFPELEELDLSSNN  355

Query  595  LSGVIP  612
             +G IP
Sbjct  356  FTGSIP  361


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 63/135 (47%), Gaps = 11/135 (8%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIA-----------ANQLSGPVPPEISAISTLRFLNLSNNIFGS  387
            G + P+ GQ   L  LS +            N  SG +PPE+  ++ L  L  S   F  
Sbjct  203  GEVPPEYGQWENLEYLSFSWPNYYLDYVDYNNIFSGGIPPELGNLTKLTTLYGSTCNFSG  262

Query  388  TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNL  567
              P +L +L  L+VL  Y N L+G LP E+  M SL+H+    N  SG IP  Y    N+
Sbjct  263  KIPTELGKLKKLEVLSFYENKLSGGLPFELGSMKSLKHMDFFNNTLSGVIPESYSLLQNI  322

Query  568  EYLAVSGNGLSGVIP  612
             +  +  N L G IP
Sbjct  323  THFDLGNNKLHGSIP  337


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 69/154 (45%), Gaps = 27/154 (18%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G+L   + +   L +L+I  N+L GP+P  + +  +L+ + +  N      P  L  
Sbjct  379  NLTGILPVSLCKGDRLQDLTIFNNRLVGPIPESLGSCKSLQIVEMGYNFLNGLIPKGLFG  438

Query  412  LANLQV---------------------------LDLYNNNLTGDLPVEVYKMTSLRHLHL  510
            L N+ +                           LDL NN LTG+LP  +   + LR+L L
Sbjct  439  LPNISLIQLNDNHLTGRGFDENTTHPFSVSLIWLDLSNNQLTGELPASIGNFSILRYLLL  498

Query  511  GGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             GN F+G IP E  +   L  L +S N  S  IP
Sbjct  499  DGNKFTGSIPSEISKCQALIQLDLSSNQFSDEIP  532


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 0/123 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G  P L  L +++N  +G +PP++     L+F+ +  N      P  L + 
Sbjct  332  LHGSIPDFIGDFPELEELDLSSNNFTGSIPPKLGTNGRLQFVRMDRNNLTGILPVSLCKG  391

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ L ++NN L G +P  +    SL+ + +G N+ +G IP      PN+  + ++ N 
Sbjct  392  DRLQDLTIFNNRLVGPIPESLGSCKSLQIVEMGYNFLNGLIPKGLFGLPNISLIQLNDNH  451

Query  595  LSG  603
            L+G
Sbjct  452  LTG  454


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSGV+      L  + +  +  N+L G +P  I     L  L+LS+N F  + P +L   
Sbjct  308  LSGVIPESYSLLQNITHFDLGNNKLHGSIPDFIGDFPELEELDLSSNNFTGSIPPKLGTN  367

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ + +  NNLTG LPV + K   L+ L +  N   G IP   G   +L+ + +  N 
Sbjct  368  GRLQFVRMDRNNLTGILPVSLCKGDRLQDLTIFNNRLVGPIPESLGSCKSLQIVEMGYNF  427

Query  595  LSGVIP  612
            L+G+IP
Sbjct  428  LNGLIP  433


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 7/119 (6%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L+ L ++ NQL+G +P  I   S LR+L L  N F  + P ++++   L  LDL +N  +
Sbjct  469  LIWLDLSNNQLTGELPASIGNFSILRYLLLDGNKFTGSIPSEISKCQALIQLDLSSNQFS  528

Query  457  GDLPVEVY------KMTSLRHLHLGGNYFSGRIPPEYGRF-PNLEYLAVSGNGLSGVIP  612
             ++P E+        +  +R L L  N  +G IP   G    +L  L +  N L+G IP
Sbjct  529  DEIPNEITGNKSICNLDEIRFLDLSNNTLTGEIPHCLGNTSASLVVLKLQLNKLNGTIP  587


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L  ++G +  L ++    N LSG +P   S +  +   +L NN    + P  +   
Sbjct  284  LSGGLPFELGSMKSLKHMDFFNNTLSGVIPESYSLLQNITHFDLGNNKLHGSIPDFIGDF  343

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+ LDL +NN TG +P ++     L+ + +  N  +G +P    +   L+ L +  N 
Sbjct  344  PELEELDLSSNNFTGSIPPKLGTNGRLQFVRMDRNNLTGILPVSLCKGDRLQDLTIFNNR  403

Query  595  LSGVIP  612
            L G IP
Sbjct  404  LVGPIP  409


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 67/156 (43%), Gaps = 31/156 (20%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA------ISTLRFLNLSNNIFGSTFP  396
             +G +  ++ +   L+ L +++NQ S  +P EI+       +  +RFL+LSNN      P
Sbjct  503  FTGSIPSEISKCQALIQLDLSSNQFSDEIPNEITGNKSICNLDEIRFLDLSNNTLTGEIP  562

Query  397  H--------------QLAQL-----------ANLQVLDLYNNNLTGDLPVEVYKMTSLRH  501
            H              QL +L            +L  LDL +N L G +P  + K  SL  
Sbjct  563  HCLGNTSASLVVLKLQLNKLNGTIPANFSNCDSLTFLDLGDNQLEGVVPKSLSKCRSLNV  622

Query  502  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            L+L  N   G  P      P L+ L++  NG  G I
Sbjct  623  LNLENNKLMGIFPSWLESLPQLQVLSLRFNGFYGHI  658


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 47/109 (43%), Gaps = 4/109 (4%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  +      L  L +  NQL G VP  +S   +L  LNL NN     FP  L  L
Sbjct  582  LNGTIPANFSNCDSLTFLDLGDNQLEGVVPKSLSKCRSLNVLNLENNKLMGIFPSWLESL  641

Query  415  ANLQVLDLYNNNLTGDL----PVEVYKMTSLRHLHLGGNYFSGRIPPEY  549
              LQVL L  N   G +    P        L+ L +  N F G++P  Y
Sbjct  642  PQLQVLSLRFNGFYGHITSSSPKVKRSFPRLQILDISNNNFGGKLPGRY  690


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +1

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               + VLD+ NNN  G +P  + ++ SLRHL+L  N  +G IPP  G+   L+ L +S N
Sbjct  736  FTTMSVLDMSNNNFVGQIPDAIGRLHSLRHLNLSHNLLTGNIPPSIGKLSLLDGLDLSLN  795

Query  592  GLSGVIP  612
             L+G IP
Sbjct  796  RLTGRIP  802



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 119/193 (62%), Gaps = 27/193 (14%)
 Frame = +1

Query  34   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  210
            R SA A AG+   V E  ALL +KAA +     S   W+ +  HC +W  V CD+     
Sbjct  15   RPSAAADAGEVTAV-EHRALLDVKAA-SGSPSGSFAGWDATADHCRSWAGVACDAAGR--  70

Query  211  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  390
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  391  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  570
            FP  L+ L NL+VLD+YNNNLTG LPV+V  + +LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  109  FPSALSSLKNLRVLDIYNNNLTGVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIE  168

Query  571  YLAVSGNGLSGVI  609
            YLA+SGN L G I
Sbjct  169  YLAISGNELGGPI  181


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P + ++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLGQNQFSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKC  500

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  NNL+G++PVE+ +M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  501  KLLTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNN  560

Query  595  LSGVIP  612
            LSG++P
Sbjct  561  LSGLVP  566


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L G + PE+  + +L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGNLQNLDTLFLQVNGLFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADL  285

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  286  KNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  345

Query  595  LSGVIP  612
            L+G +P
Sbjct  346  LTGSLP  351


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+GVL  DV  LP L +L +  N  SG +PPE      + +L +S N  G     +L  
Sbjct  128  NLTGVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIEYLAISGNELGGPITPELGN  187

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L +L+ L + Y N+  G LP  +  +TSL  L       SG IPPE G   NL+ L +  
Sbjct  188  LTSLRELYIGYFNSYQGSLPAAIGNLTSLVRLDAANCGLSGEIPPEMGNLQNLDTLFLQV  247

Query  589  NGLSGVI  609
            NGL G I
Sbjct  248  NGLFGEI  254


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  310  PQLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNF  369

Query  595  LSGVIP  612
            L G IP
Sbjct  370  LFGSIP  375


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLA  417
            G L   +G L  LV L  A   LSG +PPE+  +  L  L L  N +FG   P +L +L 
Sbjct  204  GSLPAAIGNLTSLVRLDAANCGLSGEIPPEMGNLQNLDTLFLQVNGLFGEITP-ELGKLR  262

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN L G++P     + +L  L+L  N   G IP   G  P LE L +  N  
Sbjct  263  SLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNF  322

Query  598  SGVIP  612
            +G IP
Sbjct  323  TGEIP  327


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F    P +L   
Sbjct  274  LAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNFTGEIPRRLGTN  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP ++     L+ L   GN+  G IP   GR  +L  + +  N 
Sbjct  334  GRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNFLFGSIPESLGRCKSLSRIRLGENY  393

Query  595  LSGVIP  612
            L+G IP
Sbjct  394  LTGSIP  399


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 56/112 (50%), Gaps = 1/112 (1%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            LV + +  N L+G  P + S+  TL  ++LSNN      P  +     LQ L L  N  +
Sbjct  408  LVQVELQDNLLNGSFPEKASS-PTLGQISLSNNRLSGALPSSIGNFPGLQKLLLGQNQFS  466

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +P E+ K+  L  +   GN FS  IP E  +   L ++ +S N LSG IP
Sbjct  467  GCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKCKLLTFIDLSRNNLSGEIP  518


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 69/128 (54%), Gaps = 3/128 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  408
            N +G +   +G    L  L +++N+L+G +PP++ +   L+  + L N +FGS  P  L 
Sbjct  321  NFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNFLFGS-IPESLG  379

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +  +L  + L  N LTG +P+ ++ + +L  + L  N  +G   PE    P L  +++S 
Sbjct  380  RCKSLSRIRLGENYLTGSIPIGLFSLRNLVQVELQDNLLNGSF-PEKASSPTLGQISLSN  438

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  439  NRLSGALP  446



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 4/169 (2%)
 Frame = +1

Query  118  ADSQSSLTSW----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVN  285
            +D   +L SW    N STSHC+W  VTC S   VV LD+SG NLSG L  ++ +L  L+ 
Sbjct  32   SDPTGALASWGNGTNTSTSHCSWAGVTCSSRGTVVGLDVSGFNLSGALPAELSRLRGLLR  91

Query  286  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  465
            L++ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  L
Sbjct  92   LAVGANAFSGPIPGSLGRLQFLTYLNLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPL  151

Query  466  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            P+EV +M  LRHLHLGGN+FSG IPPEYGR+  ++YLAVSGN LSG IP
Sbjct  152  PMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGRIP  200


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  244  LSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  303

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  304  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  363

Query  595  LSGVIP  612
            L+G +P
Sbjct  364  LTGTLP  369


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ + 
Sbjct  461  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKC  520

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  521  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  580

Query  595  LSGVIP  612
            LSG++P
Sbjct  581  LSGLVP  586


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SGV +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ QL
Sbjct  443  VSGVAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQL  496

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L   DL +N   G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  497  QQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  556

Query  595  LSGVIP  612
            L G IP
Sbjct  557  LDGEIP  562


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 65/125 (52%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  221  SGGLPPELGNLTELIRLDAANCGLSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLK  280

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  281  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  340

Query  598  SGVIP  612
            +G +P
Sbjct  341  TGGVP  345


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SGV+ P++GQL  L    +++N   G VPPEI     L +L+LS N      P  ++ 
Sbjct  484  SFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  543

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  544  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPGT-GQFSYFNATSFIGN  602

Query  592  -GLSG  603
             GL G
Sbjct  603  PGLCG  607


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  292  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  351

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP   G   +L  + +  N 
Sbjct  352  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECRSLSRVRLGENY  411

Query  595  LSGVIP  612
            L+G IP
Sbjct  412  LNGSIP  417



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 123/182 (68%), Gaps = 5/182 (3%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  249
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  426
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG 
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGK  205

Query  607  IP  612
            IP
Sbjct  206  IP  207


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP-EISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   + +LP L  + +  N +SG  P    +    L  ++LSNN      P  +  
Sbjct  419  LNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGS  478

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + +Q L L  N  TG++P E+ ++  L    L GN F G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRN  538

Query  592  GLSGVIP  612
             LSG IP
Sbjct  539  NLSGEIP  545


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  + +  N
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  592  GLSGVIP  612
             +SG  P
Sbjct  442  LISGGFP  448


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  592  GLSGVIP  612
             L G IP
Sbjct  322  KLRGDIP  328


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP+      LE L   GN 
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNS  394

Query  595  LSGVIP  612
            L G IP
Sbjct  395  LFGAIP  400


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  412  LANLQVLDLYNNNLTGDLPV  471
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 117/171 (68%), Gaps = 6/171 (4%)
 Frame = +1

Query  118  ADSQSSLTSWNISTS-HCTWRRVTCd----sllhvvsldlsglNLSGVLSPDVGQLPFLV  282
            +D   +L SW+ ++S HC W  VTC         VV LD+SGLNLSG L P + +L  L 
Sbjct  34   SDPTGALASWDAASSDHCAWVGVTCAPRGSGGGVVVGLDVSGLNLSGALPPALSRLRGLQ  93

Query  283  NLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-G  459
             LS+AAN   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  
Sbjct  94   RLSVAANGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSA  153

Query  460  DLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             LP+EV  M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP
Sbjct  154  TLPLEVTHMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGKIP  204


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  248  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSEL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGTLP  373


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG +PPEI  +  L   +LS+N F    P ++ + 
Sbjct  465  LTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEVGKC  524

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  525  RLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  584

Query  595  LSGVIP  612
            LSG++P
Sbjct  585  LSGLVP  590


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 58/114 (51%), Gaps = 0/114 (0%)
 Frame = +1

Query  271  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  450
            P L  +S++ NQL+G +P  +   S ++ L L  N F    P ++ +L  L   DL +N 
Sbjct  453  PNLGEISLSNNQLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNK  512

Query  451  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              G +P EV K   L +L +  N  SG+IPP       L YL +S N L G IP
Sbjct  513  FEGGVPPEVGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIP  566


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  225  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLR  284

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  285  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNF  344

Query  598  SGVIP  612
            +G +P
Sbjct  345  TGGVP  349


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  296  LTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNFTGGVPRRLGRN  355

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP   G+  +L  + +  N 
Sbjct  356  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIPDSLGQCKSLSRVRLGENY  415

Query  595  LSGVIP  612
            L+G IP
Sbjct  416  LNGSIP  421


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  272  LTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDL  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  332  PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGAIP  397



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 123/182 (68%), Gaps = 5/182 (3%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  249
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  426
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG 
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGK  205

Query  607  IP  612
            IP
Sbjct  206  IP  207


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP-EISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   + +LP L  + +  N +SG  P    +    L  ++LSNN      P  +  
Sbjct  419  LNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGS  478

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + +Q L L  N  TG++P E+ ++  L    L GN F G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRN  538

Query  592  GLSGVIP  612
             LSG IP
Sbjct  539  NLSGEIP  545


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  + +  N
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  592  GLSGVIP  612
             +SG  P
Sbjct  442  LISGGFP  448


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 64/128 (50%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L 
Sbjct  201  ELSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELG  260

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
             LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  
Sbjct  261  NLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFR  320

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  321  NKLRGDIP  328


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP+      LE L   GN 
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNS  394

Query  595  LSGVIP  612
            L G IP
Sbjct  395  LFGAIP  400


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  412  LANLQVLDLYNNNLTGDLPV  471
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 123/182 (68%), Gaps = 5/182 (3%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  249
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  426
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG 
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNELSGK  205

Query  607  IP  612
            IP
Sbjct  206  IP  207


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP-EISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   + +LP L  + +  N +SG  P    +    L  ++LSNN      P  +  
Sbjct  419  LNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGS  478

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + +Q L L  N  TG++P E+ ++  L    L GN F G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRN  538

Query  592  GLSGVIP  612
             LSG IP
Sbjct  539  NLSGEIP  545


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  + +  N
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441

Query  592  GLSGVIP  612
             +SG  P
Sbjct  442  LISGGFP  448


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 64/128 (50%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L 
Sbjct  201  ELSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELG  260

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
             LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  
Sbjct  261  NLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFR  320

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  321  NKLRGDIP  328


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP+      LE L   GN 
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNS  394

Query  595  LSGVIP  612
            L G IP
Sbjct  395  LFGAIP  400


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  412  LANLQVLDLYNNNLTGDLPV  471
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 116/165 (70%), Gaps = 5/165 (3%)
 Frame = +1

Query  133  SLTSWNISTS-HCTWRRVTCd---sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  300
            +L SW +++S HC W  VTC    S   VV LD+SGLNLSG L P + +L  L  LS+AA
Sbjct  46   ALASWGVASSDHCAWAGVTCAPRGSGGVVVGLDVSGLNLSGALPPALSRLRGLQRLSVAA  105

Query  301  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLPVEV  477
            N   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP+EV
Sbjct  106  NGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSATLPLEV  165

Query  478  YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP
Sbjct  166  THMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGKIP  210


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  254  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSEL  313

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  314  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRSLGRNGRLQLLDLSSNK  373

Query  595  LSGVIP  612
            L+G +P
Sbjct  374  LTGTLP  379


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG +PPEI  +  L   +LS+N F    P ++ + 
Sbjct  471  LTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEIGKC  530

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  531  RLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  590

Query  595  LSGVIP  612
            LSG++P
Sbjct  591  LSGLVP  596


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 0/114 (0%)
 Frame = +1

Query  271  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  450
            P L  +S++ NQL+G +P  +   S ++ L L  N F    P ++ +L  L   DL +N 
Sbjct  459  PNLGEISLSNNQLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNK  518

Query  451  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              G +P E+ K   L +L +  N  SG+IPP       L YL +S N L G IP
Sbjct  519  FEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIP  572


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  231  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLK  290

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  291  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  350

Query  598  SGVIP  612
            +G +P
Sbjct  351  TGGVP  355


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P  L + 
Sbjct  302  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRSLGRN  361

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP   G+  +L  + +  N 
Sbjct  362  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIPDSLGQCKSLSRVRLGENY  421

Query  595  LSGVIP  612
            L+G IP
Sbjct  422  LNGSIP  427


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  278  LTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDL  337

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  338  PSLEVLQLWENNFTGGVPRSLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  397

Query  595  LSGVIP  612
            L G IP
Sbjct  398  LFGAIP  403



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 126/169 (75%), Gaps = 3/169 (2%)
 Frame = +1

Query  115  TADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  285
             +D  +SL++WN S    HC+W  V CD     VVSLDL+G NLSG L P VG+L  L+N
Sbjct  41   VSDPSASLSAWNSSAGVGHCSWPGVGCDPIQGSVVSLDLTGFNLSGSLFPAVGRLRHLLN  100

Query  286  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  465
            LS A+N LSGP+P EIS +++LR LNLSNN+   +FP  LA+L NL VLDLYNNNLTG L
Sbjct  101  LSAASNSLSGPIPAEISRLASLRHLNLSNNLLNGSFPSALARLKNLLVLDLYNNNLTGPL  160

Query  466  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            PVEV ++ +LRHLHLGGN+F+G IPPE+GR+  LEYLAVSGN L G IP
Sbjct  161  PVEVAQLPNLRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGPIP  209


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  180  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGS  239

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  LD+ N  L G++P E++K+ +L  L L  N  +G IPPE GR  +L+ + +S N
Sbjct  240  LPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNN  299

Query  592  GLSGVIP  612
             L+G IP
Sbjct  300  ALTGEIP  306


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++ +L  L  L +  N L+G +PPE+  + +L+ ++LSNN      P   A L
Sbjct  253  LNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADL  312

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  + ++ +L  L L  N F+G IP + GR   L+ L +S N 
Sbjct  313  ENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNK  372

Query  595  LSGVIP  612
            L+G +P
Sbjct  373  LTGTLP  378


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  228  SFEGGIPPEIGSLPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGR  287

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  288  LRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWEN  347

Query  592  GLSGVIP  612
              +G IP
Sbjct  348  NFTGGIP  354


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 65/125 (52%), Gaps = 6/125 (5%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +  +SPD+G+    +NLS   N+LSG +PP I   S ++ L L+ N F    P ++ +L 
Sbjct  454  AAAISPDLGE----INLS--NNRLSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQ  507

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L  +D   N  +G +  E+ +   L  + L  N  SG IPPE  R   L YL +S N L
Sbjct  508  ELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQL  567

Query  598  SGVIP  612
             G IP
Sbjct  568  EGGIP  572


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P +G    +  L +  NQ S  +PPEI  +  L  ++ S N F      ++++ 
Sbjct  471  LSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRC  530

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+ +M  L +L+L  N   G IPP      +L  +  S N 
Sbjct  531  KLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQLEGGIPPSIATMQSLTAVDFSYNK  590

Query  595  LSGVIP  612
            LSG +P
Sbjct  591  LSGHVP  596


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  277  LAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGEL  336

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG +P ++ +   L+ L L  N  +G +P        LE +   GN 
Sbjct  337  PALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNKLTGTLPTGLCSENTLETVIALGNF  396

Query  595  LSGVIP  612
            L G IP
Sbjct  397  LFGPIP  402


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +      L  L  L++  N+L G +P  I  +  L  L L  N F    P QL + 
Sbjct  301  LTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRS  360

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP  +    +L  +   GN+  G IP   GR  +L  + +  N 
Sbjct  361  GRLQLLDLSSNKLTGTLPTGLCSENTLETVIALGNFLFGPIPETLGRCKSLSRIRMGENY  420

Query  595  LSGVIP  612
            L+G IP
Sbjct  421  LNGSIP  426



>ref|XP_010685023.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 124/194 (64%), Gaps = 12/194 (6%)
 Frame = +1

Query  61   KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC---------dsllhvvs  213
            KPL   EQ  LLSIK++ T D Q++L+SWN +T+HCTW  VTC          +   V+S
Sbjct  21   KPLQ-DEQKVLLSIKSSITDDPQNTLSSWNTTTNHCTWPFVTCSHHHHSPTNTTTSTVIS  79

Query  214  ldlsglNLSGVLS-PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  390
            LD+S LNL+G+LS  ++  L  L  LS+A N  SG +PP +S +S LR+LNLS+NIF  T
Sbjct  80   LDISSLNLTGILSLSNISLLTNLQKLSVADNYFSGQIPPSLSLLSNLRYLNLSDNIFNGT  139

Query  391  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  570
            FP  L+    L +LD+YNN LTG LP+ V  MT LRHL LG NYF G++P  YG+  NL+
Sbjct  140  FP-SLSSFKRLTILDVYNNYLTGSLPLSVINMTKLRHLDLGSNYFYGKLPSGYGQLKNLK  198

Query  571  YLAVSGNGLSGVIP  612
               V  N L G IP
Sbjct  199  NFYVDQNNLVGEIP  212


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 58/124 (47%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G L    GQL  L N  +  N L G +PPE+  +  L  L L +N F    P +L  L  
Sbjct  185  GKLPSGYGQLKNLKNFYVDQNNLVGEIPPELGKLEKLDSLFLWSNYFSGDIPSELGSLKT  244

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L  +DL NN L+G++P     +  L  L+L  N   G IP   G  P L  L +  N  +
Sbjct  245  LISMDLSNNTLSGEIPRSFSLLKKLNFLNLFQNKLQGVIPEFIGDLPELGILQLRENNFT  304

Query  601  GVIP  612
            G IP
Sbjct  305  GNIP  308


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 51/112 (46%), Gaps = 4/112 (4%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +   L  L ++ NQL G VP  +S    L FLNL NN+    FP  L  L
Sbjct  390  LTGTIPTSFTKCDSLKYLDLSYNQLEGVVPKSLSQCQNLSFLNLENNMLKDKFPSWLESL  449

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMT----SLRHLHLGGNYFSGRIPPEYGRF  558
              LQVL L  N+  G L     K+      ++   L  N F G +P  Y ++
Sbjct  450  PQLQVLSLSYNSFHGLLLTSSSKVKHPFPKIQIFDLSNNKFCGELPTSYIKY  501


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 15/141 (11%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGS--------  387
            L GV+   +G LP L  L +  N  +G +P  +     L+ ++LS N + GS        
Sbjct  279  LQGVIPEFIGDLPELGILQLRENNFTGNIPKNLGINGKLQVIDLSYNRLTGSLGSKELAG  338

Query  388  -----TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM-TSLRHLHLGGNYFSGRIPPEY  549
                 T    +     + +LD+ NN LTG++P  +    T L  L+L  N  +G IP  +
Sbjct  339  SRLNGTIKASICSSTEIAILDISNNFLTGEIPDCLGDTSTQLIALNLQANMLTGTIPTSF  398

Query  550  GRFPNLEYLAVSGNGLSGVIP  612
             +  +L+YL +S N L GV+P
Sbjct  399  TKCDSLKYLDLSYNQLEGVVP  419


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 59/126 (47%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   +     +  L I+ N L+G +P  +   ST L  LNL  N+   T P    +
Sbjct  341  LNGTIKASICSSTEIAILDISNNFLTGEIPDCLGDTSTQLIALNLQANMLTGTIPTSFTK  400

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              +L+ LDL  N L G +P  + +  +L  L+L  N    + P      P L+ L++S N
Sbjct  401  CDSLKYLDLSYNQLEGVVPKSLSQCQNLSFLNLENNMLKDKFPSWLESLPQLQVLSLSYN  460

Query  592  GLSGVI  609
               G++
Sbjct  461  SFHGLL  466


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 0/91 (0%)
 Frame = +1

Query  340  ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  519
            I+++   ++SNN F    P  + QL  L+ L+L +N+LTG +P  + K++ L  L L  N
Sbjct  555  ITSMVIFDVSNNNFKGEIPDSIGQLLALRGLNLSHNHLTGRIPPSIGKLSLLDFLDLSSN  614

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              +GRIP E      LE   VS N L G IP
Sbjct  615  RLTGRIPQELVSITFLEIFNVSKNLLEGSIP  645



>ref|XP_008440463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis melo]
Length=973

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  LS
Sbjct  39   ESQALLSLKSSISDDPHSSLSSWNPAAVATHCSWLGVTCDSHRHVVALDLSSLDLTATLS  98

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
            P +  L FL N+S   N+ SG +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  99   PHIASLRFLTNVSFGLNKFSGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  158

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            D+YNNNLTG+ P  V +M +LR+LHLGGN+F+GRIPPE GR   LE+LA+ GN L G IP
Sbjct  159  DVYNNNLTGEFPRVVTEMPNLRYLHLGGNFFTGRIPPEVGRLQFLEFLAIHGNDLEGPIP  218


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 67/126 (53%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L  ++G L  +  L I+ N L G +P   +    LR L+L +N      P  +A L
Sbjct  286  LSGPLM-ELGGLKSIEALDISCNMLVGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADL  344

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L   GN 
Sbjct  345  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEVCHGNKLEVLIAMGNS  404

Query  595  LSGVIP  612
            LSG+IP
Sbjct  405  LSGLIP  410


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  310  VGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADLPKLEILQLWNNNFTGSIPRNLGKNG  369

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L+ LDL  N+LTG +P EV     L  L   GN  SG IP   G   +L+ + + GN L
Sbjct  370  MLRTLDLAFNHLTGTIPPEVCHGNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNAL  429

Query  598  SGVIP  612
            +G IP
Sbjct  430  NGSIP  434


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP +  + +  N LSG +P   S  + L  ++LSNN+   + P  +  L
Sbjct  429  LNGSIPKRLLGLPNITQIDLHDNFLSGELPITNSVSANLLQISLSNNMLSGSLPPTIGSL  488

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N  +G +P  + ++  L  ++   N FSG I  E     +L +L +SGN 
Sbjct  489  VAVQKLLLDRNKFSGQIPSSIGRLQQLSRINFSQNKFSGSIVAEISECKHLIFLDLSGNE  548

Query  595  LSGVIP  612
            LSG IP
Sbjct  549  LSGEIP  554


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 7/124 (6%)
 Frame = +1

Query  262  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  455  GELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSSIGRLQQ  514

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L  ++   N  +G +  E+ +   L  L L GN  SG IP        L Y+ +S N L 
Sbjct  515  LSRINFSQNKFSGSIVAEISECKHLIFLDLSGNELSGEIPNHITNMKLLNYMNLSRNHLV  574

Query  601  GVIP  612
            G IP
Sbjct  575  GPIP  578


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L+G + P+V     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  380  HLTGTIPPEVCHGNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNALNGSIPKRLLG  439

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  440  LPNITQIDLHDNFLSGELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  499

Query  592  GLSGVIP  612
              SG IP
Sbjct  500  KFSGQIP  506


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (49%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG++   +G    L  + +  N L+G +P  +  +  +  ++L +N      P   +  
Sbjct  405  LSGLIPESLGNCISLKRILLWGNALNGSIPKRLLGLPNITQIDLHDNFLSGELPITNSVS  464

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ANL  + L NN L+G LP  +  + +++ L L  N FSG+IP   GR   L  +  S N 
Sbjct  465  ANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSSIGRLQQLSRINFSQNK  524

Query  595  LSGVI  609
             SG I
Sbjct  525  FSGSI  529


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 61/127 (48%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             LSG +   +  LP L  L +  N  +G +P  +     LR L+L+ N    T P ++  
Sbjct  332  KLSGEIPGFMADLPKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEVCH  391

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L+VL    N+L+G +P  +    SL+ + L GN  +G IP      PN+  + +  N
Sbjct  392  GNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNALNGSIPKRLLGLPNITQIDLHDN  451

Query  592  GLSGVIP  612
             LSG +P
Sbjct  452  FLSGELP  458



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 113/167 (68%), Gaps = 2/167 (1%)
 Frame = +1

Query  118  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  291
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG +   + +L  L  L 
Sbjct  45   SDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLD  104

Query  292  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  471
            +AAN L GP+P  +S + +L  LNLSNN+   TFP  LA+L  L+VLDLYNNNLTG LP+
Sbjct  105  LAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPL  164

Query  472  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             V  +  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN LSG IP
Sbjct  165  AVVGLPVLRHLHLGGNFFSGEIPPEYGRWRRLQYLAVSGNELSGRIP  211


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 68/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G   P + +L  L  L +  N L+GP+P  +  +  LR L+L  N F    P +  + 
Sbjct  134  LNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGNFFSGEIPPEYGRW  193

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG-GNYFSGRIPPEYGRFPNLEYLAVSGN  591
              LQ L +  N L+G +P E+  +T+LR L++G  N +S  +PPE G   +L  L  +  
Sbjct  194  RRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPPELGNMTDLVRLDAANC  253

Query  592  GLSGVIP  612
            GLSG IP
Sbjct  254  GLSGEIP  260


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  255  LSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAAL  314

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V  + SL  L L  N F+G IP   GR   L+ + +S N 
Sbjct  315  RNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  374

Query  595  LSGVIP  612
            L+G +P
Sbjct  375  LTGTLP  380


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L   +G+   L  L +  N  +G VPPEI  +  L   +LS N      P ++ +
Sbjct  471  QLTGALPASIGKFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGK  530

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  531  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLGGEIPATIAAMQSLTAVDFSYN  590

Query  592  GLSGVIP  612
             LSG++P
Sbjct  591  NLSGLVP  597


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  279  LAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDL  338

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P  + +   L+ + L  N  +G +PPE      LE L   GN 
Sbjct  339  PSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNF  398

Query  595  LSGVIP  612
            L G IP
Sbjct  399  LFGSIP  404


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 64/133 (48%), Gaps = 13/133 (10%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP-------PEISAISTLRFLNLSNNIFGSTF  393
            L+G +   + +LP L  + +  N LSG  P       P + AI+      LSNN      
Sbjct  423  LNGSIPDGLFELPNLTQVELQDNLLSGGFPAVSGTGAPNLGAIT------LSNNQLTGAL  476

Query  394  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  573
            P  + + + LQ L L  N  TG +P E+ ++  L    L GN   G +PPE G+   L Y
Sbjct  477  PASIGKFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGKCRLLTY  536

Query  574  LAVSGNGLSGVIP  612
            L +S N LSG IP
Sbjct  537  LDLSRNNLSGEIP  549


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +L +L 
Sbjct  235  LPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLS  294

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             LDL NN LTG++P     + +L  L+L  N   G IP   G  P+LE L +  N  +G 
Sbjct  295  SLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGG  354

Query  607  IP  612
            IP
Sbjct  355  IP  356


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P +L  
Sbjct  326  KLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCA  385

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L+ L    N L G +P  + K  +L  + LG NY +G IP      PNL  + +  N
Sbjct  386  GGKLETLIALGNFLFGSIPEPLGKCEALSRIRLGENYLNGSIPDGLFELPNLTQVELQDN  445

Query  592  GLSGVIP  612
             LSG  P
Sbjct  446  LLSGGFP  452


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 74/158 (47%), Gaps = 9/158 (6%)
 Frame = +1

Query  142  SWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA-NQLSGP  318
            S  I   +  WRR+          L +SG  LSG + P++G L  L  L I   N  S  
Sbjct  183  SGEIPPEYGRWRRLQ--------YLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSG  234

Query  319  VPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLR  498
            +PPE+  ++ L  L+ +N       P +L  LANL  L L  N L G +P E+ ++ SL 
Sbjct  235  LPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLS  294

Query  499  HLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             L L  N  +G IP  +    NL  L +  N L G IP
Sbjct  295  SLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIP  332



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 114/168 (68%), Gaps = 8/168 (5%)
 Frame = +1

Query  133  SLTSWN-ISTSHCTWRRVTCd------sllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  291
            +L SWN  S  HC W  VTC           VV LD+SGLNLSG L   + +L  L  LS
Sbjct  41   ALRSWNATSPDHCAWAGVTCAPPGGGRGGGIVVGLDVSGLNLSGALPQALSRLHGLQRLS  100

Query  292  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLP  468
            +AAN L GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP
Sbjct  101  VAANALYGPIPPSLARLQQLVHLNLSNNAFNGSFPPALARLRGLRVLDLYNNNLTSATLP  160

Query  469  VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            +EV +M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN LSG IP
Sbjct  161  LEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIP  208


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 66/126 (52%), Gaps = 1/126 (1%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            S  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  L 
Sbjct  156  SATLPLEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIPPELGNLT  215

Query  418  NLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             L+ L + Y N+ TG LP E+  +T L  L       SG IPPE GR  NL+ L +  NG
Sbjct  216  TLRELYIGYYNSYTGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNG  275

Query  595  LSGVIP  612
            L+G IP
Sbjct  276  LTGSIP  281


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  252  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  M SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNK  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ + 
Sbjct  469  LTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKC  528

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  529  RLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  588

Query  595  LSGVIP  612
            LSG++P
Sbjct  589  LSGLVP  594


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            GV +P++G++      S++ NQL+G +P  + + S ++ L L  N F    P ++ +L  
Sbjct  453  GVAAPNLGEI------SLSNNQLTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQ  506

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L   DL +N   G +P E+ K   L +L +  N  SG+IPP       L YL +S N L 
Sbjct  507  LSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLD  566

Query  601  GVIP  612
            G IP
Sbjct  567  GEIP  570


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  229  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLK  288

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNF  348

Query  598  SGVIP  612
            +G +P
Sbjct  349  TGGVP  353


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNFTGGVPRRLGRN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIPDSLGQCKSLSRVRLGENY  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  276  LTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDM  335

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  336  PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  395

Query  595  LSGVIP  612
            L G IP
Sbjct  396  LFGAIP  401


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 2/125 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ 
Sbjct  492  SFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISG  551

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFTYFNATSFVGN  610

Query  592  -GLSG  603
             GL G
Sbjct  611  PGLCG  615



>ref|XP_004160944.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1-like [Cucumis sativus]
Length=984

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            D+YNNNLTGD P  V +M +LR+LHLGGN+F+GRIPPE GR   LE+LA+ GN L G IP
Sbjct  161  DVYNNNLTGDFPRVVTEMPNLRYLHLGGNFFTGRIPPEVGRLQFLEFLAIHGNDLEGPIP  220


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 65/126 (52%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L    N 
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNS  406

Query  595  LSGVIP  612
            LSG+IP
Sbjct  407  LSGLIP  412


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 0/115 (0%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            LP +  + +  N LSG +P   S    L  ++LSNN+   + P  +  L  +Q L L  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              +G +P  + ++  L  ++   N FSG I PE     +L +L +SGN LSG IP
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIP  556


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 62/125 (50%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  312  VGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNG  371

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L+ LDL  N+LTG +P E+     L  L    N  SG IP   G   +L+ + + GN L
Sbjct  372  MLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNAL  431

Query  598  SGVIP  612
            +G IP
Sbjct  432  NGSIP  436


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 7/124 (6%)
 Frame = +1

Query  262  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  457  GELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQ  516

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L  ++   N  +G +  E+ +   L  L L GN  SG IP        L Y+ +S N L 
Sbjct  517  LSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIPNHITNMKLLNYMNLSRNHLV  576

Query  601  GVIP  612
            G IP
Sbjct  577  GPIP  580


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  592  GLSGVIP  612
              SG IP
Sbjct  502  KFSGQIP  508


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +   +  LP L  L +  N  +G +P  +     LR L+L+ N    T P ++   
Sbjct  335  LSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHG  394

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL   +N+L+G +P  +    SL+ + L GN  +G IP      PN+  + +  N 
Sbjct  395  NKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLGLPNITQIDLHDNF  454

Query  595  LSGVIP  612
            LSG +P
Sbjct  455  LSGELP  460


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG++   +G    L  + +  N L+G +P  +  +  +  ++L +N      P   +  
Sbjct  407  LSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLGLPNITQIDLHDNFLSGELPIINSVS  466

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +  + +++ L L  N FSG+IP   GR   L  +  S N 
Sbjct  467  VNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQLSRINFSQNK  526

Query  595  LSGVI  609
             SG I
Sbjct  527  FSGSI  531



>ref|XP_004143533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48656.1| Receptor-like protein kinase 3 [Cucumis sativus]
Length=984

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            D+YNNNLTGD P  V +M +LR+LHLGGN+F+GRIPPE GR   LE+LA+ GN L G IP
Sbjct  161  DVYNNNLTGDFPRVVTEMPNLRYLHLGGNFFTGRIPPEVGRLQFLEFLAIHGNDLEGPIP  220


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 65/126 (52%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L    N 
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNS  406

Query  595  LSGVIP  612
            LSG+IP
Sbjct  407  LSGLIP  412


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 0/115 (0%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            LP +  + +  N LSG +P   S    L  ++LSNN+   + P  +  L  +Q L L  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              +G +P  + ++  L  ++   N FSG I PE     +L +L +SGN LSG IP
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIP  556


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 62/125 (50%), Gaps = 7/125 (6%)
 Frame = +1

Query  259  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  312  VGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNG  371

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L+ LDL  N+LTG +P E+     L  L    N  SG IP   G   +L+ + + GN L
Sbjct  372  MLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNAL  431

Query  598  SGVIP  612
            +G IP
Sbjct  432  NGSIP  436


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 7/124 (6%)
 Frame = +1

Query  262  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  457  GELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQ  516

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L  ++   N  +G +  E+ +   L  L L GN  SG IP        L Y+ +S N L 
Sbjct  517  LSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIPNHITNMKLLNYMNLSRNHLV  576

Query  601  GVIP  612
            G IP
Sbjct  577  GPIP  580


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  592  GLSGVIP  612
              SG IP
Sbjct  502  KFSGQIP  508


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +   +  LP L  L +  N  +G +P  +     LR L+L+ N    T P ++   
Sbjct  335  LSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHG  394

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL   +N+L+G +P  +    SL+ + L GN  +G IP      PN+  + +  N 
Sbjct  395  NKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLGLPNITQIDLHDNF  454

Query  595  LSGVIP  612
            LSG +P
Sbjct  455  LSGELP  460


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 60/125 (48%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG++   +G    L  + +  N L+G +P  +  +  +  ++L +N      P   +  
Sbjct  407  LSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLGLPNITQIDLHDNFLSGELPIINSVS  466

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  + L NN L+G LP  +  + +++ L L  N FSG+IP   GR   L  +  S N 
Sbjct  467  VNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQLSRINFSQNK  526

Query  595  LSGVI  609
             SG I
Sbjct  527  FSGSI  531



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 117/194 (60%), Gaps = 27/194 (14%)
 Frame = +1

Query  34   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  210
            R SA A  G+     E  AL+ +KAA   +   SL  W+ +  HC +W  V CD+     
Sbjct  15   RPSATAATGEGT-AAEHRALVELKAAI-GNPTGSLAGWDAAADHCRSWAGVACDAAGR--  70

Query  211  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  390
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  391  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  570
            FP  L++L NL+ LDLYNNNLT  LPV V  +  LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  109  FPSDLSRLKNLRALDLYNNNLTDVLPVVVADLPVLRHLHLGGNFFSGAIPPEYGRWEHIE  168

Query  571  YLAVSGNGLSGVIP  612
            YLA+SGN LSG IP
Sbjct  169  YLAISGNELSGPIP  182


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P ++++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKC  500

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +  +DL  NNL+G++PVE+ +M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  501  RLVTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNN  560

Query  595  LSGVIP  612
            LSG++P
Sbjct  561  LSGLVP  566


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N LSG + PE+  +  L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADL  285

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  286  KNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  345

Query  595  LSGVIP  612
            L+G +P
Sbjct  346  LTGSLP  351


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDL  309

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  310  PELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLETLIALGNF  369

Query  595  LSGVIP  612
            L G IP
Sbjct  370  LFGSIP  375


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F    P +L   
Sbjct  274  LTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFTGEIPRRLGTN  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP   GR  +L  + +  N 
Sbjct  334  GRLQLLDLSSNKLTGSLPPDLCSGDKLETLIALGNFLFGSIPESLGRCKSLTRIRLGENY  393

Query  595  LSGVIP  612
            L+G IP
Sbjct  394  LTGSIP  399


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 59/124 (48%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G L    G L  LV L  A   LSG +PPE+  +  L  L L  N        +L +L  
Sbjct  204  GGLPAAFGNLTSLVRLDAANCGLSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWG  263

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N  +
Sbjct  264  LKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFT  323

Query  601  GVIP  612
            G IP
Sbjct  324  GEIP  327


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 62/126 (49%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  L  L  + +  N L+G  P + S+  TL  ++LSNN      P  +   
Sbjct  394  LTGSIPSGLFSLRKLAQVELQDNLLNGSFPAKASS-PTLGQISLSNNRLSGALPSSIGNF  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ L L  N  +G +P E+ ++  L  +   GN FS  IPPE  +   + ++ +S N 
Sbjct  453  PGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKCRLVTFIDLSRNN  512

Query  595  LSGVIP  612
            LSG IP
Sbjct  513  LSGEIP  518



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 107/166 (64%), Gaps = 25/166 (15%)
 Frame = +1

Query  121  DSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  297
            D Q S L SW++STS C W  VTCD                         L  +++L ++
Sbjct  42   DQQHSPLASWDLSTSFCLWTGVTCD-----------------------ASLRHVISLDLS  78

Query  298  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVE  474
               LSG +P  ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV 
Sbjct  79   GLNLSGTLPSSMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVS  138

Query  475  VYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            +  +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP
Sbjct  139  ITNLTELRHLHLGGNYFAGRIPPAYGSWPTLEYLAVSGNELAGKIP  184


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  228  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  287

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  288  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGENGRLVILDLSSNK  347

Query  595  LSGVIP  612
            L+G +P
Sbjct  348  LTGTLP  353


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  155  FAGRIPPAYGSWPTLEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPPEIGN  214

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L  LD  N  L G++P E+ ++  L  L L  N FSG +PPE G   +L+ + +S N
Sbjct  215  LSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  274

Query  592  GLSGVIP  612
              +G IP
Sbjct  275  MFTGEIP  281


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G L P++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  204  FDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  263

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  264  SSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENN  323

Query  595  LSGVIP  612
             +G IP
Sbjct  324  FTGSIP  329


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SG +P EI  +  L  L+ S+N+F    P ++++ 
Sbjct  446  LSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRC  505

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+GD+P E+  M  L +L++  N+  G IP       +L  +  S N 
Sbjct  506  KLLTYVDLSRNELSGDIPNEITSMRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNN  565

Query  595  LSGVIP  612
            LSG++P
Sbjct  566  LSGLVP  571


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (54%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  428  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  481

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LD  +N  +G +P E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  482  QQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIPNEITSMRILNYLNVSRNH  541

Query  595  LSGVIP  612
            L G IP
Sbjct  542  LVGSIP  547


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  179  LAGKIPPEIGNLTTLRELYIGYFNAFDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGR  238

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP + +  NL  L +  N
Sbjct  239  LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRN  298

Query  592  GLSGVIP  612
             L G IP
Sbjct  299  KLYGAIP  305


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 2/117 (2%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  441
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  407  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  442  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             N  +G +P E+ ++  L  L    N FSG IPPE  R   L Y+ +S N LSG IP
Sbjct  467  GNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIP  523


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 62/129 (48%), Gaps = 2/129 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     LV L    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  347  KLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNVLFG  406

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  585
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  407  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  586  GNGLSGVIP  612
            GN  SG IP
Sbjct  467  GNKFSGAIP  475



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = +1

Query  133  SLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  306
            +L SW  N + S C W  VTC++   V+ +DLSG NLSG +   + +LP L  L +AAN 
Sbjct  48   ALASWTANATASPCAWSGVTCNARGAVIGVDLSGRNLSGPVPAALSRLPHLARLDLAANA  107

Query  307  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  486
             SGP+P  ++ +  L  LNLSNN+   TFP  LA+L  L+V+DLYNNNLTG LP+ V  +
Sbjct  108  FSGPIPTPLARLRYLTHLNLSNNVLNGTFPPPLARLRALRVVDLYNNNLTGPLPLGVAAL  167

Query  487  TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             +LRHLHLGGN+FSG IPPEYG +  L+YLAVSGN LSG IP
Sbjct  168  PALRHLHLGGNFFSGEIPPEYGTWGRLQYLAVSGNELSGRIP  209


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAAL  312

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V  + SL  L L  N F+G IP   GR   L+ + +S N 
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  372

Query  595  LSGVIP  612
            L+G +P
Sbjct  373  LTGTLP  378


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  470  LTGALPASIGNFSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKC  529

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  530  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNN  589

Query  595  LSGVIP  612
            LSG++P
Sbjct  590  LSGLVP  595


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   + +LP LV + +  N LSG  P    +A S L  + LSNN      P  +  
Sbjct  421  LNGSIPEGLFELPNLVQVELQDNLLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGN  480

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + LQ L L  N   G +P E+ ++  L    L GN   G +PPE G+   L YL +S N
Sbjct  481  FSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKCRLLTYLDLSRN  540

Query  592  GLSGVIP  612
             LSG IP
Sbjct  541  NLSGEIP  547


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP+      LE L   GN 
Sbjct  337  PSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPDLCAGGKLETLIALGNF  396

Query  595  LSGVIP  612
            L G IP
Sbjct  397  LFGSIP  402


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 66/125 (53%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG + P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +L 
Sbjct  230  SGGIPPELGNMTELVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLR  289

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P     + +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  290  SLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNF  349

Query  598  SGVIP  612
            +G IP
Sbjct  350  TGGIP  354


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 58/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  324  KLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPDLCA  383

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L+ L    N L G +P  + K  +L  + LG NY +G IP      PNL  + +  N
Sbjct  384  GGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFELPNLVQVELQDN  443

Query  592  GLSGVIP  612
             LSG  P
Sbjct  444  LLSGGFP  450


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L 
Sbjct  203  ELSGRIPPELGNLTSLRELYIGYYNSYSGGIPPELGNMTELVRLDAANCGLSGEIPPELG  262

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
             LANL  L L  N L G +P E+ ++ SL  L L  N  +G IP  +    NL  L +  
Sbjct  263  NLANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAALKNLTLLNLFR  322

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  323  NKLRGSIP  330


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  517  SLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAA  576

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L  +D   NNL+G +P
Sbjct  577  MQSLTAVDFSYNNLSGLVP  595



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   155 bits (393),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 104/165 (63%), Gaps = 24/165 (15%)
 Frame = +1

Query  121  DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  300
            D  S L SWN+STS C W  VTCD                         L  + +L ++ 
Sbjct  42   DQHSPLASWNLSTSFCLWTGVTCD-----------------------ASLRHVTSLYLSG  78

Query  301  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEV  477
              LSG +   ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +
Sbjct  79   LNLSGTLSSSMASLSELRLLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSL  138

Query  478  YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L+G IP
Sbjct  139  TNLTELRHLHLGGNYFAGRIPPAYGSWPALEYLAVSGNELAGKIP  183


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  227  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  286

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  287  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGGNGRLVILDLSSNK  346

Query  595  LSGVIP  612
            L+G +P
Sbjct  347  LTGTLP  352


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P L  L+++ N+L+G +PPEI  ++ LR L +   N F    P ++  
Sbjct  154  FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTALRELYIGYFNAFDGGLPPEIGN  213

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L++L  LD  N  L G++P E+ ++  L  L L  N FSG +PPE G   +L+ + +S N
Sbjct  214  LSDLLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  273

Query  592  GLSGVIP  612
              +G IP
Sbjct  274  MFTGEIP  280


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G L P++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  203  FDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  262

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N 
Sbjct  263  SSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENN  322

Query  595  LSGVIP  612
             +G IP
Sbjct  323  FTGSIP  328


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+ SGP+P EI  +  L  L+ S+N+F      ++++ 
Sbjct  445  LSGPLPPAIGNFSGVQKLLLDGNKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAPEISRC  504

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L++  N+  G IP       +L  +  S N 
Sbjct  505  KLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNHLVGSIPATISSMQSLTSVDFSYNN  564

Query  595  LSGVIP  612
            LSG++P
Sbjct  565  LSGLVP  570


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  178  LAGKIPPEIGNLTALRELYIGYFNAFDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGR  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP + +  NL  L +  N
Sbjct  238  LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRN  297

Query  592  GLSGVIP  612
             L G IP
Sbjct  298  KLYGAIP  304


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG +S ++GQ+      S++ NQLSGP+PP I   S ++ L L  N F    P ++ +L
Sbjct  427  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGPIPSEIGRL  480

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LD  +N  +G +  E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  481  QQLSKLDFSHNLFSGGIAPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNH  540

Query  595  LSGVIP  612
            L G IP
Sbjct  541  LVGSIP  546


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (50%), Gaps = 2/117 (2%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  441
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  406  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  442  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             N  +G +P E+ ++  L  L    N FSG I PE  R   L Y+ +S N LSG IP
Sbjct  466  GNKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAPEISRCKLLTYVDLSRNELSGEIP  522


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 2/129 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     LV +    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  346  KLTGTLPPNMCFGNRLVTVITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNGLFG  405

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  585
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  406  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  586  GNGLSGVIP  612
            GN  SG IP
Sbjct  466  GNKFSGPIP  474



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 114/168 (68%), Gaps = 3/168 (2%)
 Frame = +1

Query  118  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-SPDVGQLPFLVNL  288
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG + +  + +L  L  L
Sbjct  42   SDPAGALASWTNATSTGPCAWSGVTCNARGAVIGLDLSGRNLSGAVPAAALSRLAHLARL  101

Query  289  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  468
             +AAN LSGP+P  +S + +L  LNLSNN+   TFP   A+L  L+VLDLYNNNLTG LP
Sbjct  102  DLAANALSGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPFARLRALRVLDLYNNNLTGPLP  161

Query  469  VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            + V  +  LRHLHLGGN+FSG IPPEYG++  L+YLAVSGN LSG IP
Sbjct  162  LVVVALPMLRHLHLGGNFFSGEIPPEYGQWRRLQYLAVSGNELSGKIP  209


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P+ GQ   L  L+++ N+LSG +PPE+  +++LR L +   N + S  P +   
Sbjct  180  FSGEIPPEYGQWRRLQYLAVSGNELSGKIPPELGGLTSLRELYIGYYNSYSSGIPPEFGN  239

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            + +L  LD  N  L+G++P E+  + +L  L L  N  +G IPPE GR  +L  L +S N
Sbjct  240  MTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNN  299

Query  592  GLSGVIP  612
            GL+G IP
Sbjct  300  GLTGEIP  306


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAAL  312

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   GR   L+ + +S N 
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  372

Query  595  LSGVIP  612
            L+G +P
Sbjct  373  LTGTLP  378


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  470  LTGALPASIGNFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKC  529

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  530  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNN  589

Query  595  LSGVIP  612
            LSG++P
Sbjct  590  LSGLVP  595


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VL L+ NN TG +P  + +   L+ + L  N  +G +PPE      LE L   GN 
Sbjct  337  PNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNF  396

Query  595  LSGVIP  612
            L G IP
Sbjct  397  LFGSIP  402


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 63/133 (47%), Gaps = 13/133 (10%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP-------PEISAISTLRFLNLSNNIFGSTF  393
            L+G +   + +LP L  + +  N LSG  P       P + AI+      LSNN      
Sbjct  421  LNGSIPEGLFELPNLTQVELQDNLLSGGFPAVAGTGAPNLGAIT------LSNNQLTGAL  474

Query  394  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  573
            P  +   + LQ L L  N  TG +P E+ ++  L    L GN   G +PPE G+   L Y
Sbjct  475  PASIGNFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKCRLLTY  534

Query  574  LAVSGNGLSGVIP  612
            L +S N LSG IP
Sbjct  535  LDLSRNNLSGEIP  547


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            + P+ G +  LV L  A   LSG +PPE+  +  L  L L  N      P +L +L +L 
Sbjct  233  IPPEFGNMTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLS  292

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             LDL NN LTG++P     + +L  L+L  N   G IP   G  PNLE L +  N  +G 
Sbjct  293  SLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDLPNLEVLQLWENNFTGG  352

Query  607  IP  612
            IP
Sbjct  353  IP  354


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P +L  
Sbjct  324  KLRGSIPELVGDLPNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCA  383

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L+ L    N L G +P  + K  +L  + LG NY +G IP      PNL  + +  N
Sbjct  384  GGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFELPNLTQVELQDN  443

Query  592  GLSGVIP  612
             LSG  P
Sbjct  444  LLSGGFP  450



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 119/182 (65%), Gaps = 25/182 (14%)
 Frame = +1

Query  73   VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  249
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  426
              DV +   + +L +++  LSG +  +IS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63   --DVSR-RHVTSLDLSSLNLSGTLSRDISNLSGLRHLNLSNNVFNGSFPDEISSGLANLR  119

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L+G 
Sbjct  120  VLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNELTGK  179

Query  607  IP  612
            IP
Sbjct  180  IP  181


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  225  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDL  284

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  285  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  344

Query  595  LSGVIP  612
            L+G +P
Sbjct  345  LTGTLP  350


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  205  LPPEIGNLSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  264

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N  +G 
Sbjct  265  SMDLSNNMFTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGS  324

Query  607  IP  612
            IP
Sbjct  325  IP  326


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  441  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  500

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  501  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNN  560

Query  595  LSGVIP  612
            LSG++P
Sbjct  561  LSGLVP  566


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  152  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  211

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  212  LSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  271

Query  592  GLSGVIP  612
              +G IP
Sbjct  272  MFTGEIP  278


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  249  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGEL  308

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  309  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  368

Query  595  LSGVIP  612
            L G IP
Sbjct  369  LFGSIP  374


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +  LP L  + +  N L+G +P   S    L  L+LSNN      P  +   
Sbjct  393  LNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNF  452

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  453  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  512

Query  595  LSGVIP  612
            LSG IP
Sbjct  513  LSGEIP  518


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  344  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFG  403

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  404  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  463

Query  592  GLSGVIP  612
               G IP
Sbjct  464  KFEGPIP  470


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 64/126 (51%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  423  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  476

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  477  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNH  536

Query  595  LSGVIP  612
            L G IP
Sbjct  537  LIGSIP  542


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 59/126 (47%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  273  FTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  332

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  333  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENF  392

Query  595  LSGVIP  612
            L+G IP
Sbjct  393  LNGSIP  398


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 57/125 (46%), Gaps = 0/125 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P   +  
Sbjct  369  LFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVS  428

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  L L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N 
Sbjct  429  VNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNL  488

Query  595  LSGVI  609
             SG I
Sbjct  489  FSGRI  493



>ref|XP_001754727.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ80697.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=1017

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 120/180 (67%), Gaps = 3/180 (2%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            E+ AL+++KA    D +S L  W +  ++S C W  V C++   VV L LSG+NLSG +S
Sbjct  34   ERLALIALKATID-DPESHLADWEVNGTSSPCLWTGVDCNNSSSVVGLYLSGMNLSGTIS  92

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             ++G L  LVNLS+  N  +  +P +I  ++ L++LN+S N FG   P   +QL  LQVL
Sbjct  93   SELGNLKNLVNLSLDRNNFTEDLPADIVTLTQLKYLNVSTNSFGGALPSNFSQLQLLQVL  152

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            D +NN  +G LP +++K+++L H+ LGGNYF G IPPEYG+FPNL+Y  ++GN L+G IP
Sbjct  153  DCFNNFFSGPLPPDLWKISTLEHVSLGGNYFEGSIPPEYGKFPNLKYFGLNGNSLTGPIP  212


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NLS  +   +G LP +++  I+ N  +GP+PP+I  +  L  L++S N    + P +++ 
Sbjct  471  NLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNNLSGSIPAEMSN  530

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L +LD+ +N+LTG +PV++  +  L +L+L  N  SG IP +    P L     S N
Sbjct  531  CKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLADLPTLSIFDFSYN  590

Query  592  GLSGVIP  612
             LSG IP
Sbjct  591  NLSGPIP  597


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 58/109 (53%), Gaps = 0/109 (0%)
 Frame = +1

Query  286  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  465
            + I  NQ++GP+P EI     L +L+ S N   S+ P  +  L ++    + +N+ TG +
Sbjct  441  VEIQDNQVNGPIPSEIINAPLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPI  500

Query  466  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            P ++  M +L  L + GN  SG IP E      L  L VS N L+GVIP
Sbjct  501  PPQICDMPNLNKLDMSGNNLSGSIPAEMSNCKKLGLLDVSHNSLTGVIP  549


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G +  ++   P L  L  + N LS  +P  I  + ++    +S+N F    P Q+  +
Sbjct  448  VNGPIPSEIINAPLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDM  507

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL  LD+  NNL+G +P E+     L  L +  N  +G IP +    P+L YL +S N 
Sbjct  508  PNLNKLDMSGNNLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNE  567

Query  595  LSGVIP  612
            LSG IP
Sbjct  568  LSGAIP  573


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   +G L  L +L ++ N+L+G +P  +  +  L  ++L NN    T P  LA L
Sbjct  280  LEGPIPASLGNLVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLADL  339

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VL L+ N LTG +P  + +  +L  L L  N+ +G IPP+      L+++ +  N 
Sbjct  340  PNLEVLYLWKNQLTGPIPENLGQNMNLTLLDLSSNHLNGSIPPDLCAGQKLQWVILLENQ  399

Query  595  LSGVIP  612
            L+G IP
Sbjct  400  LTGSIP  405


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 59/127 (46%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N S  +    G L  LV L +A+  L G +P E+  +  L  L L  N      P  L  
Sbjct  231  NFSSSIPATFGNLTNLVRLDMASCGLVGAIPHELGNLGQLDTLFLMLNSLEGPIPASLGN  290

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL+ LDL  N LTG LP  +  +  L  + L  N+  G +P      PNLE L +  N
Sbjct  291  LVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLADLPNLEVLYLWKN  350

Query  592  GLSGVIP  612
             L+G IP
Sbjct  351  QLTGPIP  357


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +   +G    L  L +  N L+G +P  +  +  L  + + +N      P ++   
Sbjct  400  LTGSIPESLGHCQSLTKLRLGINSLNGSIPQGLLGLPLLAMVEIQDNQVNGPIPSEIINA  459

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LD   NNL+  +P  +  + S+    +  N+F+G IPP+    PNL  L +SGN 
Sbjct  460  PLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNN  519

Query  595  LSGVIP  612
            LSG IP
Sbjct  520  LSGSIP  525


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 61/151 (40%), Gaps = 24/151 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L G +   +  LP L  L +  NQL+GP+P  +     L  L+LS+N    + P  L  
Sbjct  327  HLEGTVPDFLADLPNLEVLYLWKNQLTGPIPENLGQNMNLTLLDLSSNHLNGSIPPDLCA  386

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG------------------------GN  519
               LQ + L  N LTG +P  +    SL  L LG                         N
Sbjct  387  GQKLQWVILLENQLTGSIPESLGHCQSLTKLRLGINSLNGSIPQGLLGLPLLAMVEIQDN  446

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              +G IP E    P L YL  S N LS  IP
Sbjct  447  QVNGPIPSEIINAPLLSYLDFSKNNLSSSIP  477


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NLSG +  ++     L  L ++ N L+G +P ++  I  L +LNLS+N      P +LA 
Sbjct  519  NLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLAD  578

Query  412  LANLQVLDLYNNNLTGDLPV-EVYKMTSLR  498
            L  L + D   NNL+G +P+ + Y  T+  
Sbjct  579  LPTLSIFDFSYNNLSGPIPLFDSYNATAFE  608



>ref|XP_006853709.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
 gb|ERN15176.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
Length=918

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 127/184 (69%), Gaps = 3/184 (2%)
 Frame = +1

Query  67   LGVTEQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLS  240
            + V     L ++K A   D +SSL +W+   S+++C+W  + CD   +V  LD+S + LS
Sbjct  19   ISVDNSGPLWAVKFAIN-DPESSLETWSKGNSSNYCSWIGIQCDDSGYVSVLDISDMGLS  77

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G +SP++G L  L  LS+A N+ SG +P EI+ IS L  LNLSNN+F  TFP  L+ L N
Sbjct  78   GQISPEIGNLQRLTTLSLAVNEFSGQIPAEIARISGLNLLNLSNNLFNGTFPVSLSGLKN  137

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L+VLDLYNNNLTG LP  V +++ ++HLHLGGNYF+G IPPEYG+   +EYLA+SGN LS
Sbjct  138  LEVLDLYNNNLTGPLPKGVAEISGIKHLHLGGNYFNGEIPPEYGKLKEIEYLALSGNELS  197

Query  601  GVIP  612
            G IP
Sbjct  198  GNIP  201


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 75/126 (60%), Gaps = 2/126 (2%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G L  L  L +  N+L+G +PPE+  +  L+ L+LSNN      P   A+L
Sbjct  245  LSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNNKLSGEIPANFAEL  304

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL++L+L+ N+L G +P  V ++  L  L L  N FSG +  ++GR  NL+ L +S N 
Sbjct  305  KNLKLLNLFINSLKGTIPPFVAELPELEVLQLWDNEFSGELDGKFGR--NLKLLDLSSNK  362

Query  595  LSGVIP  612
            L+G IP
Sbjct  363  LAGKIP  368


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             +G + P+ G+L  +  L+++ N+LSG +P E+  ++ L  L L   N F    P +   
Sbjct  172  FNGEIPPEYGKLKEIEYLALSGNELSGNIPKELGNLTKLEQLYLGYFNWFSGGIPPEFGN  231

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  LD+ +  L+G++P E+  +T L  L L  N  +G+IPPE G    L+ L +S N
Sbjct  232  LRRLFRLDMASCGLSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNN  291

Query  592  GLSGVIP  612
             LSG IP
Sbjct  292  KLSGEIP  298


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 68/152 (45%), Gaps = 25/152 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G + P++     L  L +  N  SG VP  ++   +L+ + L +N+   + P+ L  
Sbjct  362  KLAGKIPPEICSGGLLQTLILLNNSFSGQVPGSLTTCQSLKRVRLGDNLLNGSLPYGLLS  421

Query  412  LANLQVLDLYNNNLTG-------------------------DLPVEVYKMTSLRHLHLGG  516
            L NL  L+L NN LTG                         ++P  +    SL+ L L G
Sbjct  422  LQNLTQLELKNNKLTGKFFSGNLSVSETLLELSLSNNQLNGEIPAIIGDFGSLQKLFLAG  481

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N FSG IPP+     +L  L +S N  SG IP
Sbjct  482  NQFSGEIPPKICSLNDLSVLDLSRNNFSGEIP  513


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L+ LS++ NQL+G +P  I    +L+ L L+ N F    P ++  L +L VLDL  NN +
Sbjct  450  LLELSLSNNQLNGEIPAIIGDFGSLQKLFLAGNQFSGEIPPKICSLNDLSVLDLSRNNFS  509

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY  549
            G++P ++  M SL +L+L  N+  G+IP  +
Sbjct  510  GEIPAKIAGMRSLTYLNLSKNHLVGQIPAAF  540



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 109/168 (65%), Gaps = 8/168 (5%)
 Frame = +1

Query  133  SLTSWNISTS--------HCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNL  288
            +L SW +  +        HC W  V+C +   V  L L GLNLSG L P + +L  L+ L
Sbjct  40   ALASWEVPAAASNGTGYAHCAWAGVSCGARGAVAGLALGGLNLSGALPPALSRLRGLLRL  99

Query  289  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  468
             + AN LSGPVP  +  +  L  LNLSNN F  + P  LA+L  L+VLDLYNNNLT  LP
Sbjct  100  DVGANALSGPVPAALGHLRFLTHLNLSNNAFNGSLPPALARLRGLRVLDLYNNNLTSPLP  159

Query  469  VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            +EV +M  LRHLHLGGN+FSG IPPEYGR+  L+YLA+SGN LSG IP
Sbjct  160  IEVAQMPMLRHLHLGGNFFSGEIPPEYGRWTRLQYLALSGNELSGKIP  207


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 69/128 (54%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+  L  +V Q+P L +L +  N  SG +PPE    + L++L LS N      P +L  
Sbjct  153  NLTSPLPIEVAQMPMLRHLHLGGNFFSGEIPPEYGRWTRLQYLALSGNELSGKIPPELGN  212

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L +L+ L + Y N  +G +P E+  +T L  L       SG+IPPE GR   L+ L +  
Sbjct  213  LTSLRELYIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPPELGRLQKLDTLFLQV  272

Query  589  NGLSGVIP  612
            NGL+G IP
Sbjct  273  NGLTGAIP  280


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+GVL   +G    +  L +  N  SG +P E+  +  L   +LS N      P ++ + 
Sbjct  468  LTGVLPASIGNFSGVQKLLLDRNSFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSISTMQSLTAVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P ++ ++ +L  L+LSNN      P   +QL
Sbjct  251  LSGKIPPELGRLQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P   G    L+ + +S N 
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVPRRLGGNNRLQLVDLSSNR  370

Query  595  LSGVIP  612
            L+G +P
Sbjct  371  LTGTLP  376


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 58/114 (51%), Gaps = 0/114 (0%)
 Frame = +1

Query  271  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  450
            P L  ++++ NQL+G +P  I   S ++ L L  N F    P ++ +L  L   DL  N 
Sbjct  456  PNLGEINLSNNQLTGVLPASIGNFSGVQKLLLDRNSFSGALPAEVGRLQQLSKADLSGNA  515

Query  451  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            + G +P EV K   L +L L  N  SG+IPP       L YL +S N L G IP
Sbjct  516  IEGGVPPEVGKCRLLTYLDLSRNNLSGKIPPAISGMRILNYLNLSRNHLDGEIP  569


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 50/104 (48%), Gaps = 0/104 (0%)
 Frame = +1

Query  301  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  480
            N L+G +PP  S +  +  LNL  N      P  +  L +L+VL L+ NN TG +P  + 
Sbjct  297  NALAGEIPPSFSQLKNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVPRRLG  356

Query  481  KMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
                L+ + L  N  +G +PP+      L  L   GN L G IP
Sbjct  357  GNNRLQLVDLSSNRLTGTLPPDLCAGGKLHTLIALGNSLFGAIP  400


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
             LSG + P++G L  L  L I   N  SG VPPE+  ++ L  L+ +N       P +L 
Sbjct  201  ELSGKIPPELGNLTSLRELYIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPPELG  260

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +L  L  L L  N LTG +P ++  + SL  L L  N  +G IPP + +  N+  L +  
Sbjct  261  RLQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQLKNMTLLNLFR  320

Query  589  NGLSGVIP  612
            N L G IP
Sbjct  321  NKLRGDIP  328


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SG L  +VG+L  L    ++ N + G VPPE+     L +L+LS N      P  ++ 
Sbjct  491  SFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGKCRLLTYLDLSRNNLSGKIPPAISG  550

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  551  MRILNYLNLSRNHLDGEIPPSISTMQSLTAVDFSYNNLSGLVP  593


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 62/130 (48%), Gaps = 7/130 (5%)
 Frame = +1

Query  235  LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  405
            L+G L PD+   G+L  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  371  LTGTLPPDLCAGGKLHTLIAL---GNSLFGAIPDSLGQCKSLSRIRLGENYLNGSIPEGL  427

Query  406  AQLANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  582
             +L  L  ++L +N LTGD P  V     +L  ++L  N  +G +P   G F  ++ L +
Sbjct  428  FELQKLTQVELQDNLLTGDFPAVVGAAAPNLGEINLSNNQLTGVLPASIGNFSGVQKLLL  487

Query  583  SGNGLSGVIP  612
              N  SG +P
Sbjct  488  DRNSFSGALP  497



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 109/181 (60%), Gaps = 3/181 (2%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            +   LLS+K AF     S LTSWN+S   S CTW  + CD+    +        N+SG L
Sbjct  37   QATILLSLKQAFEPPEDSCLTSWNVSNYNSLCTWTGIKCDAKNTSILSLDISNYNISGYL  96

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
             P +  +  LVNLS++ N LSG  P +I  +  L+FLN+SNN F  +   Q ++L  L V
Sbjct  97   LPAISDIHTLVNLSVSGNSLSGTFPVDIHKLVRLQFLNISNNQFNGSLNWQFSKLKKLVV  156

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LD YNN  +G LP+ V  ++ L+HL  GGNYFSG+IPP YG   NL+YL+++GN L G I
Sbjct  157  LDAYNNEFSGSLPLGVTDLSKLKHLDFGGNYFSGKIPPVYGSLENLDYLSLAGNNLVGYI  216

Query  610  P  612
            P
Sbjct  217  P  217


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G +  ++G L  LV L +++  L GP+PPE+  ++ L  L L  N    + P +LA L
Sbjct  237  FDGGIPAELGNLVNLVRLDLSSCGLKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANL  296

Query  415  ANLQVLDLYNNNLTGDLPVEVYK-MTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L+  DL NN LTG++PVE++  +  L  L+L  N F G IP      PNLE L +  N
Sbjct  297  TTLKSFDLSNNVLTGEIPVELFSGLKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQN  356

Query  592  GLSGVIP  612
              +G IP
Sbjct  357  NFTGSIP  363


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQ  411
            L G + P++G L  L  L +  NQLSG +PPE++ ++TL+  +LSNN+     P +L + 
Sbjct  261  LKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNNVLTGEIPVELFSG  320

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L +L+L+ N   G++P  + ++ +L  L L  N F+G IP   G+  NL+ + +S N
Sbjct  321  LKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQNNFTGSIPSMLGQNGNLKEIDLSTN  380

Query  592  GLSGVIP  612
             L+G++P
Sbjct  381  KLTGLVP  387


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G L     +LP  L  L++A N+LSG +P  I   S+L  L L+ N F    P  + +
Sbjct  454  LTGQLEQQRSKLPMKLGQLNLANNRLSGSLPASIGNFSSLNILLLNGNRFIGDIPSDIGR  513

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+  LD+  NN +G +P E+     L +L L  N  SG IP +  +   L YL +S N
Sbjct  514  LKNIFKLDMSRNNFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWN  573

Query  592  GLSGVIP  612
             L+  +P
Sbjct  574  HLNQSLP  580


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG + P  G L  L  LS+A N L G +P ++  ++ L  L+L   N+F    P +L  
Sbjct  188  FSGKIPPVYGSLENLDYLSLAGNNLVGYIPKQLGNLTNLNQLHLGYYNLFDGGIPAELGN  247

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  LDL +  L G +P E+  +  L  L L  N  SG IPPE      L+   +S N
Sbjct  248  LVNLVRLDLSSCGLKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNN  307

Query  592  GLSGVIP  612
             L+G IP
Sbjct  308  VLTGEIP  314


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G +  D+G+L  +  L ++ N  SG +P EIS    L +L+LS N      P Q+AQ+  
Sbjct  505  GDIPSDIGRLKNIFKLDMSRNNFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHI  564

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L++  N+L   LP E+  M SL       N FSG I PE G++      +  GN
Sbjct  565  LNYLNISWNHLNQSLPKEIGLMKSLTSADFSHNNFSGPI-PETGQYSVFNSTSFIGN  620


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N SG +  ++     L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  526  NFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWNHLNQSLPKEIGL  585

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L   D  +NN +G +P
Sbjct  586  MKSLTSADFSHNNFSGPIP  604


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (43%), Gaps = 25/152 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLS------------------------GPVPPEISA  339
            N +G +   +GQ   L  + ++ N+L+                        GP+P ++  
Sbjct  357  NFTGSIPSMLGQNGNLKEIDLSTNKLTGLVPKFLCSGRRLTILILLNNFLFGPLPKDLGK  416

Query  340  ISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM-TSLRHLHLGG  516
              TL  + +  N    + P+    L  L +++L NN LTG L  +  K+   L  L+L  
Sbjct  417  CDTLSRVRIGQNYLSGSIPNGFLYLPQLSLVELQNNYLTGQLEQQRSKLPMKLGQLNLAN  476

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N  SG +P   G F +L  L ++GN   G IP
Sbjct  477  NRLSGSLPASIGNFSSLNILLLNGNRFIGDIP  508



>gb|ABF99108.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=792

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = +1

Query  181  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  360
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  361  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  541  PEYGRFPNLEYLAVSGNGLSGVIP  612
            PEYGR+  ++YLAVSGN LSG IP
Sbjct  185  PEYGRWGRMQYLAVSGNELSGKIP  208


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  588

Query  595  LSGVIP  612
            LSG++P
Sbjct  589  LSGLVP  594


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  595  LSGVIP  612
            L G IP
Sbjct  565  LDGEIP  570


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 65/125 (52%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  598  SGVIP  612
            +G +P
Sbjct  349  TGGVP  353


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 2/124 (2%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ +
Sbjct  493  FSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGM  552

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN-  591
              L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN 
Sbjct  553  RILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGNP  611

Query  592  GLSG  603
            GL G
Sbjct  612  GLCG  615


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP   G   +L  + +  N 
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLSRVRLGENY  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425



>ref|XP_002985227.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
 gb|EFJ13721.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
Length=1023

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 113/183 (62%), Gaps = 3/183 (2%)
 Frame = +1

Query  70   GVTEQAALLSIKAAFTADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  243
            G  +++ALL++KAA   DS  SL  W     + C W  +TCD  L  V        NLSG
Sbjct  22   GFQDKSALLALKAAMI-DSSGSLDDWTETDDTPCLWTGITCDDRLSRVVALDLSNKNLSG  80

Query  244  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
            + S  +G+L  L+NL++  N  +G +P E++ +  L FLN+S+N F   FP + + L  L
Sbjct  81   IFSSSIGRLTELINLTLDVNNFTGNLPSELATLHDLHFLNVSHNTFTGDFPGRFSNLQLL  140

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
            +VLD YNNN +G LP+E+ ++ +LRHLHLGG+YF G IPP YG   +L YLA+ GN L G
Sbjct  141  EVLDAYNNNFSGPLPIELSRLPNLRHLHLGGSYFEGEIPPSYGNMTSLSYLALCGNCLVG  200

Query  604  VIP  612
             IP
Sbjct  201  PIP  203


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L GV+  ++G L  L +L +  N LSGP+PP++  +  L+ L+LSNN      P +L +L
Sbjct  247  LEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKL  306

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL++L L+ N L+G++P  V  + +L+ L L  N F+G +P   G   NL  L VS N 
Sbjct  307  QNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNP  366

Query  595  LSGVIP  612
            L+G +P
Sbjct  367  LTGPLP  372


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + +G + P++G+L  L  L IA+  L G +P E+  +S L  L L  N      P QL  
Sbjct  222  HFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGD  281

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL+ LDL NNNLTG +P+E+ K+ +L  L L  N  SG IP      PNL+ L +  N
Sbjct  282  LVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTN  341

Query  592  GLSGVIP  612
              +G +P
Sbjct  342  NFTGELP  348


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG + P +G L  L +L ++ N L+G +P E+  +  L  L+L  N      P  +A 
Sbjct  270  HLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVAD  329

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NLQ L L+ NN TG+LP  + +  +L  L +  N  +G +PP   +   LE L +  N
Sbjct  330  LPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNPLTGPLPPNLCKGGQLEVLVLIEN  389

Query  592  GLSGVIP  612
            G++G IP
Sbjct  390  GITGTIP  396


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L G + P++G L  L  L +   N  +G +PPE+  +  L+ L++++       P +L  
Sbjct  198  LVGPIPPELGYLVGLEELYLGYFNHFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGN  257

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L+NL  L L  N+L+G +P ++  + +L+ L L  N  +G IP E  +  NLE L++  N
Sbjct  258  LSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLN  317

Query  592  GLSGVIP  612
            GLSG IP
Sbjct  318  GLSGEIP  324


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 72/152 (47%), Gaps = 25/152 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-----------  378
            N SG L  ++ +LP L +L +  +   G +PP    +++L +L L  N            
Sbjct  149  NFSGPLPIELSRLPNLRHLHLGGSYFEGEIPPSYGNMTSLSYLALCGNCLVGPIPPELGY  208

Query  379  --------------FGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  516
                          F    P +L +L NLQ LD+ +  L G +P E+  +++L  L L  
Sbjct  209  LVGLEELYLGYFNHFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQI  268

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N+ SG IPP+ G   NL+ L +S N L+G IP
Sbjct  269  NHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIP  300


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G++ P +   P L  L ++ N+L G +P  ++ + +L+ L L +N F    P +L QL
Sbjct  439  LTGMI-PAIVDAPLLDFLDLSQNELQGSIPAGVARLPSLQKLFLHSNQFVGGIPVELGQL  497

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L  LDL++N L+G +P E+ + + L +L +  N  +G IP E G    LE L VS N 
Sbjct  498  SHLLHLDLHSNRLSGAIPAELAQCSKLNYLDVSDNRLTGPIPAELGSMEVLELLNVSRNR  557

Query  595  LSGVIP  612
            LSG IP
Sbjct  558  LSGGIP  563


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L G +   V +LP L  L + +NQ  G +P E+  +S L  L+L +N      P +LAQ
Sbjct  461  ELQGSIPAGVARLPSLQKLFLHSNQFVGGIPVELGQLSHLLHLDLHSNRLSGAIPAELAQ  520

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + L  LD+ +N LTG +P E+  M  L  L++  N  SG IPP+     +L     S N
Sbjct  521  CSKLNYLDVSDNRLTGPIPAELGSMEVLELLNVSRNRLSGGIPPQILGQESLTSADFSYN  580

Query  592  GLSGVIP  612
              SG +P
Sbjct  581  DFSGTVP  587


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = +1

Query  256  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  435
            ++GQL  L++L + +N+LSG +P E++  S L +L++S+N      P +L  +  L++L+
Sbjct  493  ELGQLSHLLHLDLHSNRLSGAIPAELAQCSKLNYLDVSDNRLTGPIPAELGSMEVLELLN  552

Query  436  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  N L+G +P ++    SL       N FSG +P + G F +L   +  GN
Sbjct  553  VSRNRLSGGIPPQILGQESLTSADFSYNDFSGTVPSD-GHFGSLNMSSFVGN  603


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G L   +G+   L  L +++N L+GP+PP +     L  L L  N    T P  L  
Sbjct  342  NFTGELPQRLGENMNLTELDVSSNPLTGPLPPNLCKGGQLEVLVLIENGITGTIPPALGH  401

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              +L  + L  N+LTG +P  +  +  L  L L  N  +G IP      P L++L +S N
Sbjct  402  CKSLIKVRLAGNHLTGPIPEGLLGLKMLEMLELLDNRLTGMIPAIVDA-PLLDFLDLSQN  460

Query  592  GLSGVIP  612
             L G IP
Sbjct  461  ELQGSIP  467



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 109/165 (66%), Gaps = 5/165 (3%)
 Frame = +1

Query  133  SLTSW-----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  297
            +L SW     N S +HC W  VTC     VV LD+ GLNLSG L P + +L  L+ L + 
Sbjct  43   ALASWAAPKKNESAAHCAWAGVTCGPRGTVVGLDVGGLNLSGALPPALSRLRGLLRLDVG  102

Query  298  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  477
            AN   GPVP  +  +  L  LNLSNN F  + P  LA L  L+VLDLYNNNLT  LP+EV
Sbjct  103  ANAFFGPVPAALGHLQFLTHLNLSNNAFNGSLPPALACLRALRVLDLYNNNLTSPLPLEV  162

Query  478  YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             +M  LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN LSG IP
Sbjct  163  AQMPLLRHLHLGGNFFSGQIPPEYGRWARLQYLAVSGNELSGTIP  207


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N LSG +P E+  + +L  L+LSNN+     P   ++L
Sbjct  251  LSGEIPPELGKLQKLDTLFLQVNGLSGSIPTELGYLKSLSSLDLSNNVLTGVIPASFSEL  310

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ + +S N 
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLVDLSSNK  370

Query  595  LSGVIP  612
            L+  +P
Sbjct  371  LTSTLP  376


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG +P EI  +  L   +LS+N      P ++ + 
Sbjct  468  LTGTLPASIGNFSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKC  527

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NNL+GD+P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGDIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  587

Query  595  LSGVIP  612
            LSG++P
Sbjct  588  LSGLVP  593


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 63/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS-AISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G +   + +L  L  + +  N L+G  P  +  A   L  +NLSNN    T P  +  
Sbjct  419  LNGSIPKGLFELQKLTQVELQDNLLTGNFPAVVGVAAPNLGEINLSNNQLTGTLPASIGN  478

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             + +Q L L  N+ +G +P E+ ++  L    L  N   G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKCRLLTYLDLSRN  538

Query  592  GLSGVIP  612
             LSG IP
Sbjct  539  NLSGDIP  545



>ref|XP_011045060.1| PREDICTED: receptor protein kinase CLAVATA1-like [Populus euphratica]
Length=972

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 121/186 (65%), Gaps = 5/186 (3%)
 Frame = +1

Query  70   GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  237
            G ++   LL +K +    + + L  W  S    T+HC +  V CD    VVSL+LS  +L
Sbjct  20   GYSDLEVLLKLKTSMCGHNGTGLQDWVASPASPTAHCYFSGVMCDEDSRVVSLNLSFRHL  79

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  414
             G++ P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGLIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A L+VLD+YNNN TG LP E+ K+ +L+H+HLGGN+FSG IP EY    +LEYL ++GN 
Sbjct  140  AQLEVLDVYNNNFTGALPTEIVKLKNLKHVHLGGNFFSGTIPEEYSEILSLEYLGLNGNA  199

Query  595  LSGVIP  612
            LSG +P
Sbjct  200  LSGKVP  205


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL G +   +GQL  L +L +  N L+G +PPE+S + +L+ L+LS N      P   + 
Sbjct  248  NLDGEIPSTLGQLTHLHSLFLQVNNLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSD  307

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L ++++++L+ N L G +P       +L  L + GN F+  +P   GR   L  L VS N
Sbjct  308  LKDIELVNLFQNKLHGPIPEFFGDFPNLEVLQVWGNNFTFELPQNLGRNGKLMILDVSIN  367

Query  592  GLSGVIP  612
             L+G++P
Sbjct  368  HLTGLVP  374


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 60/109 (55%), Gaps = 0/109 (0%)
 Frame = +1

Query  286  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  465
            LS++ N+++G +PP I  +  L+ L+L  N      P ++  +  L  +D+  NN+ G++
Sbjct  457  LSVSNNRITGKIPPAIGNLKNLQTLSLDTNRLSGEIPEEICGMKFLTKIDIRGNNIRGEI  516

Query  466  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            P  +++ TSL  +    N  SG +P    +  +L +L +S N L+G +P
Sbjct  517  PASIFQCTSLTSVDFSQNSLSGGVPKTIAKLKDLSFLDLSRNQLTGQLP  565


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++  + FL  + I  N + G +P  I   ++L  ++ S N      P  +A+L
Sbjct  488  LSGEIPEEICGMKFLTKIDIRGNNIRGEIPASIFQCTSLTSVDFSQNSLSGGVPKTIAKL  547

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
             +L  LDL  N LTG LPVE+  M SL  L+L  N   GRIP
Sbjct  548  KDLSFLDLSRNQLTGQLPVEIGYMRSLTSLNLSYNNLFGRIP  589


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P+ G L  L  L +A+  L G +P  +  ++ L  L L  N      P +L+ L 
Sbjct  226  EGSIPPEFGLLSNLELLDMASCNLDGEIPSTLGQLTHLHSLFLQVNNLTGHIPPELSGLI  285

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ LDL  NNLTG++P     +  +  ++L  N   G IP  +G FPNLE L V GN  
Sbjct  286  SLKSLDLSINNLTGEIPESFSDLKDIELVNLFQNKLHGPIPEFFGDFPNLEVLQVWGNNF  345

Query  598  SGVIP  612
            +  +P
Sbjct  346  TFELP  350


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 73/152 (48%), Gaps = 25/152 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G L  ++ +L  L ++ +  N  SG +P E S I +L +L L+ N      P  L++
Sbjct  151  NFTGALPTEIVKLKNLKHVHLGGNFFSGTIPEEYSEILSLEYLGLNGNALSGKVPSSLSR  210

Query  412  L-------------------------ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  516
            L                         +NL++LD+ + NL G++P  + ++T L  L L  
Sbjct  211  LKNLKSLCVGYFNRYEGSIPPEFGLLSNLELLDMASCNLDGEIPSTLGQLTHLHSLFLQV  270

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N  +G IPPE     +L+ L +S N L+G IP
Sbjct  271  NNLTGHIPPELSGLISLKSLDLSINNLTGEIP  302


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +  L  ++G+   L+ L ++ N L+G VP ++     L  L L NN F  + P ++ Q
Sbjct  344  NFTFELPQNLGRNGKLMILDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQ  403

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              +L  + + NN  +G +P  ++ +     + L  N+FSG +PPE      L  L+VS N
Sbjct  404  CKSLIKIRIMNNMFSGTIPAGMFNLPMATLVELSNNFFSGELPPEISG-DALGLLSVSNN  462

Query  592  GLSGVIP  612
             ++G IP
Sbjct  463  RITGKIP  469


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 61/127 (48%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G +      L  +  +++  N+L GP+P        L  L +  N F    P  L +
Sbjct  296  NLTGEIPESFSDLKDIELVNLFQNKLHGPIPEFFGDFPNLEVLQVWGNNFTFELPQNLGR  355

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L +LD+  N+LTG +P ++ K   L  L L  N+F G +P E G+  +L  + +  N
Sbjct  356  NGKLMILDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQCKSLIKIRIMNN  415

Query  592  GLSGVIP  612
              SG IP
Sbjct  416  MFSGTIP  422



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = +1

Query  181  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  360
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  361  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  541  PEYGRFPNLEYLAVSGNGLSGVIP  612
            PEYGR+  ++YLAVSGN LSG IP
Sbjct  185  PEYGRWGRMQYLAVSGNELSGKIP  208


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  588

Query  595  LSGVIP  612
            LSG++P
Sbjct  589  LSGLVP  594


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  595  LSGVIP  612
            L G IP
Sbjct  565  LDGEIP  570


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 65/125 (52%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  598  SGVIP  612
            +G +P
Sbjct  349  TGGVP  353


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPGT-GQFSYFNATSFVGN  610

Query  592  -GLSG  603
             GL G
Sbjct  611  PGLCG  615


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP   G   +L  + +  N 
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLSRVRLGENY  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = +1

Query  181  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  360
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  361  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  541  PEYGRFPNLEYLAVSGNGLSGVIP  612
            PEYGR+  ++YLAVSGN LSG IP
Sbjct  185  PEYGRWGRMQYLAVSGNELSGKIP  208


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  595  LSGVIP  612
            L+G +P
Sbjct  372  LTGTLP  377


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  588

Query  595  LSGVIP  612
            LSG++P
Sbjct  589  LSGLVP  594


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  595  LSGVIP  612
            L G IP
Sbjct  565  LDGEIP  570


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 65/125 (52%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N  
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNF  348

Query  598  SGVIP  612
            +G +P
Sbjct  349  TGGVP  353


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPGT-GQFSYFNATSFVGN  610

Query  592  -GLSG  603
             GL G
Sbjct  611  PGLCG  615


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP   G   +L  + +  N 
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLSRVRLGENY  419

Query  595  LSGVIP  612
            L+G IP
Sbjct  420  LNGSIP  425



>ref|XP_010266811.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
 ref|XP_010266812.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
Length=979

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 119/183 (65%), Gaps = 4/183 (2%)
 Frame = +1

Query  76   TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  246
            T+  ALL +K A      S L  WN+S+S   HC +  V+CD    VV+L++S + L G 
Sbjct  25   TDLDALLKLKTAMIGRRGSGLDDWNVSSSRNSHCLFSGVSCDENSRVVALNVSYVPLFGT  84

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  423
            +SP++G L  LVNL+++ N L+G +P EI+ +++L+ LN+SNN F    P  +A  L  +
Sbjct  85   VSPEIGLLNKLVNLTLSCNNLTGKLPEEIANLTSLKLLNISNNAFVGGVPEGIAGGLLEV  144

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
            ++ D+YNNN TG LP  + K+  L+HLHLGGN+FSG IP  Y    +LEYL ++GNGLSG
Sbjct  145  EIFDIYNNNFTGRLPTGLVKLKRLKHLHLGGNFFSGEIPSVYSEIQSLEYLGLNGNGLSG  204

Query  604  VIP  612
             IP
Sbjct  205  KIP  207


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 72/127 (57%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G +   +G+L  L  L +  N+LSG +P E+S + +L+ L+LSNN      P   ++
Sbjct  250  NLTGEIPASLGRLKLLHTLFLQLNKLSGLIPAELSGLVSLKSLDLSNNDLTGEIPESFSE  309

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L +++L+ N+L G +P  V ++  L  L + GN F+  +P   G    L+ + VS N
Sbjct  310  LKQLTLINLFRNHLRGRIPPFVAELPYLEVLQVWGNNFTFELPQNLGSNGMLKKIDVSIN  369

Query  592  GLSGVIP  612
             L+G IP
Sbjct  370  HLTGPIP  376


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G + P +  L  L  LS+  N  SG +PPEI  +  L  +N+S+N      P  L   
Sbjct  466  ITGKIPPAIANLTNLRTLSLDVNLFSGEIPPEIFGLKMLSKINISSNNITGEIPIALGHC  525

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  +D   NNL G +P E+ K+  L  L+L  N+ +G+IP E     +L  L +S N 
Sbjct  526  KSLSSVDFSRNNLFGRIPREIAKLEILSTLNLSRNHLTGQIPNEIRSMASLTILDLSYNK  585

Query  595  LSGVIP  612
            L+G +P
Sbjct  586  LAGSVP  591


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G +  + G L  L+ L + +  L+G +P  +  +  L  L L  N      P +L+ L 
Sbjct  228  EGGIPTEFGSLSSLLILDMGSCNLTGEIPASLGRLKLLHTLFLQLNKLSGLIPAELSGLV  287

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ LDL NN+LTG++P    ++  L  ++L  N+  GRIPP     P LE L V GN  
Sbjct  288  SLKSLDLSNNDLTGEIPESFSELKQLTLINLFRNHLRGRIPPFVAELPYLEVLQVWGNNF  347

Query  598  SGVIP  612
            +  +P
Sbjct  348  TFELP  352


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 63/109 (58%), Gaps = 0/109 (0%)
 Frame = +1

Query  286  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  465
            L+++ N+++G +PP I+ ++ LR L+L  N+F    P ++  L  L  +++ +NN+TG++
Sbjct  459  LTLSNNRITGKIPPAIANLTNLRTLSLDVNLFSGEIPPEIFGLKMLSKINISSNNITGEI  518

Query  466  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            P+ +    SL  +    N   GRIP E  +   L  L +S N L+G IP
Sbjct  519  PIALGHCKSLSSVDFSRNNLFGRIPREIAKLEILSTLNLSRNHLTGQIP  567


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G L   + +L  L +L +  N  SG +P   S I +L +L L+ N      P  L++
Sbjct  153  NFTGRLPTGLVKLKRLKHLHLGGNFFSGEIPSVYSEIQSLEYLGLNGNGLSGKIPATLSR  212

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L+NL+ L + Y +   G +P E   ++SL  L +G    +G IP   GR   L  L +  
Sbjct  213  LSNLRELYIGYYSTYEGGIPTEFGSLSSLLILDMGSCNLTGEIPASLGRLKLLHTLFLQL  272

Query  589  NGLSGVIP  612
            N LSG+IP
Sbjct  273  NKLSGLIP  280


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 61/127 (48%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +  L  ++G    L  + ++ N L+GP+PP + A   L  L L NN F    P +L  
Sbjct  346  NFTFELPQNLGSNGMLKKIDVSINHLTGPIPPRLCAGQRLETLILMNNYFLGPIPEELGD  405

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              +L  + L  N L G +P  ++ +  +  L L  N+F+G +P        L  L +S N
Sbjct  406  CKSLTRVRLMKNFLNGTIPSGLFNLPLVDMLELNDNFFTGELPDRISG-ETLGLLTLSNN  464

Query  592  GLSGVIP  612
             ++G IP
Sbjct  465  RITGKIP  471


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             LSG++  ++  L  L +L ++ N L+G +P   S +  L  +NL  N      P  +A+
Sbjct  274  KLSGLIPAELSGLVSLKSLDLSNNDLTGEIPESFSELKQLTLINLFRNHLRGRIPPFVAE  333

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VL ++ NN T +LP  +     L+ + +  N+ +G IPP       LE L +  N
Sbjct  334  LPYLEVLQVWGNNFTFELPQNLGSNGMLKKIDVSINHLTGPIPPRLCAGQRLETLILMNN  393

Query  592  GLSGVIP  612
               G IP
Sbjct  394  YFLGPIP  400



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 119/181 (66%), Gaps = 4/181 (2%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl-lhvvsldlsglNLSGVL  249
            + +  LS+K AF   + + L +WN S   S C+W  + CD +   VVSLD+S  N+SGV+
Sbjct  53   QASIFLSLKQAFYVPT-TCLDTWNESNFMSLCSWTGIQCDDMGSSVVSLDISNFNISGVI  111

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SP +G+L  L+NLSIA N  SG  PPE+  +++LRFLN+SNN F  +     + L  L+V
Sbjct  112  SPAIGELQSLLNLSIAGNSFSGLFPPELHKLTSLRFLNISNNQFNGSLSWNFSSLRELEV  171

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LD+YNNN  G LP+ V ++  L+HL LGGNY SG+IPP YG    L YL+++GN L G+I
Sbjct  172  LDVYNNNFFGSLPLGVTELPKLKHLDLGGNYISGKIPPSYGAMEELNYLSLAGNDLGGLI  231

Query  610  P  612
            P
Sbjct  232  P  232


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 66/128 (52%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N  G L   V +LP L +L +  N +SG +PP   A+  L +L+L+ N  G   P +L  
Sbjct  178  NFFGSLPLGVTELPKLKHLDLGGNYISGKIPPSYGAMEELNYLSLAGNDLGGLIPGELGN  237

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L NL+ L L Y N   G +P E  K+ +L HL L      G IPPE G    L+ L +  
Sbjct  238  LTNLKQLYLGYFNEFDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLDTLFLQT  297

Query  589  NGLSGVIP  612
            N LSG IP
Sbjct  298  NQLSGSIP  305


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G + P+ G+L  LV+L +++  L GP+PPE+  ++ L  L L  N    + PHQ   L
Sbjct  252  FDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLDTLFLQTNQLSGSIPHQFGNL  311

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L+ LDL NN LTG++PVE  ++  L  LHL  N   G IP      P LE L +  N 
Sbjct  312  SSLKSLDLSNNGLTGEIPVEFSELRELSLLHLFINKLHGEIPRFIAELPKLEVLKLWQNN  371

Query  595  LSGVIP  612
             +G IP
Sbjct  372  FTGTIP  377


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G  + D  ++P  L  L+++ N+LSG +P  I   S+L+ L L  N F    P +L +
Sbjct  468  LTGWFAEDPNKVPSKLGQLNLSNNRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGR  527

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  LD+  NNLTG +P ++     L +L L  N  SG IP +  +   L YL +S N
Sbjct  528  LKNLLKLDMSRNNLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWN  587

Query  592  GLSGVIP  612
             L+  +P
Sbjct  588  HLNQSLP  594


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 69/176 (39%), Gaps = 49/176 (28%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G + P +GQ   L  L ++ N+L+G VP  +     LR L L NN      P  L  
Sbjct  371  NFTGTIPPKLGQNGKLTELDLSTNKLTGLVPRSLCLGRKLRILILLNNFLFGPLPDDLGD  430

Query  412  L-------------------------------------------------ANLQVLDLYN  444
                                                              + L  L+L N
Sbjct  431  CVTLLRVRLGQNYLSGSIPYGFLYLPELSLMELQNNYLTGWFAEDPNKVPSKLGQLNLSN  490

Query  445  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N L+G +P  +   +SL+ L LGGN F+G IP E GR  NL  L +S N L+G IP
Sbjct  491  NRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGRLKNLLKLDMSRNNLTGRIP  546


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +   +G    L  L +  NQ +G +P E+  +  L  L++S N      P  +   
Sbjct  493  LSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGRLKNLLKLDMSRNNLTGRIPPDIGNC  552

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  N L+G +PV++ ++  L +L++  N+ +  +P E G   +L     S N 
Sbjct  553  LLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGAIKSLTSADFSHND  612

Query  595  LSGVIP  612
             SG IP
Sbjct  613  FSGRIP  618


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 59/123 (48%), Gaps = 0/123 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +   + +LP L  L +  N  +G +PP++     L  L+LS N      P  L   
Sbjct  348  LHGEIPRFIAELPKLEVLKLWQNNFTGTIPPKLGQNGKLTELDLSTNKLTGLVPRSLCLG  407

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L++L L NN L G LP ++    +L  + LG NY SG IP  +   P L  + +  N 
Sbjct  408  RKLRILILLNNFLFGPLPDDLGDCVTLLRVRLGQNYLSGSIPYGFLYLPELSLMELQNNY  467

Query  595  LSG  603
            L+G
Sbjct  468  LTG  470


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G + PD+G    L  L ++ NQLSGP+P +IS I  L +LN+S N    + P ++  
Sbjct  540  NLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGA  599

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L   D  +N+ +G +P
Sbjct  600  IKSLTSADFSHNDFSGRIP  618


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 60/126 (48%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G +  +  +L  L  L +  N+L G +P  I+ +  L  L L  N F  T P +L Q 
Sbjct  324  LTGEIPVEFSELRELSLLHLFINKLHGEIPRFIAELPKLEVLKLWQNNFTGTIPPKLGQN  383

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  N LTG +P  +     LR L L  N+  G +P + G    L  + +  N 
Sbjct  384  GKLTELDLSTNKLTGLVPRSLCLGRKLRILILLNNFLFGPLPDDLGDCVTLLRVRLGQNY  443

Query  595  LSGVIP  612
            LSG IP
Sbjct  444  LSGSIP  449



>ref|XP_002307734.1| receptor protein kinase [Populus trichocarpa]
 gb|EEE94730.1| receptor protein kinase [Populus trichocarpa]
Length=973

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 121/186 (65%), Gaps = 5/186 (3%)
 Frame = +1

Query  70   GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  237
            G ++   LL +K +    + + L  W  S    T+HC +  VTCD    VVSL++S  +L
Sbjct  20   GYSDLEVLLKLKTSMYGHNGTGLQDWVASPASPTAHCYFSGVTCDEDSRVVSLNVSFRHL  79

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  414
             G + P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGSIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            A L+VLD+YNNN TG LP E+ K+ +L+H+HLGGN+FSG IP EY    +LEYL ++GN 
Sbjct  140  ALLEVLDVYNNNFTGALPTEIVKLKNLKHVHLGGNFFSGTIPEEYSEILSLEYLGLNGNA  199

Query  595  LSGVIP  612
            LSG +P
Sbjct  200  LSGKVP  205


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P+ G L  L  L +A+  L G +P  +S ++ L  L L  N      P +L+ L 
Sbjct  226  EGSIPPEFGSLSNLELLDMASCNLDGEIPSALSQLTHLHSLFLQVNNLTGHIPPELSGLI  285

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ LDL  NNLTG++P     + ++  ++L  N   G IP  +G FPNLE L V GN  
Sbjct  286  SLKSLDLSINNLTGEIPESFSDLKNIELINLFQNKLHGPIPEFFGDFPNLEVLQVWGNNF  345

Query  598  SGVIP  612
            +  +P
Sbjct  346  TFELP  350


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG +   +  LP    + ++ N  SG +PPEIS    L  L++SNN      P  +  L
Sbjct  417  FSGTIPAGIFNLPLATLVELSNNLFSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNL  475

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NLQ L L  N L+G++P E++ + SL  +++  N   G IP       +L  +  S N 
Sbjct  476  KNLQTLSLDTNRLSGEIPEEIWGLKSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNS  535

Query  595  LSGVIP  612
            LSG IP
Sbjct  536  LSGEIP  541


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            LSG +   + +L  L +L +   N+  G +PPE  ++S L  L++++       P  L+Q
Sbjct  200  LSGKVPSSLSRLKNLKSLCVGYFNRYEGSIPPEFGSLSNLELLDMASCNLDGEIPSALSQ  259

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L +L  L L  NNLTG +P E+  + SL+ L L  N  +G IP  +    N+E + +  N
Sbjct  260  LTHLHSLFLQVNNLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSDLKNIELINLFQN  319

Query  592  GLSGVIP  612
             L G IP
Sbjct  320  KLHGPIP  326


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++  L  L  ++I AN + G +P  IS  ++L  ++ S N      P ++A+L
Sbjct  488  LSGEIPEEIWGLKSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNSLSGEIPKKIAKL  547

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
             +L  LDL  N LTG LP E+  M SL  L+L  N   GRIP
Sbjct  548  NDLSFLDLSRNQLTGQLPGEIGYMRSLTSLNLSYNNLFGRIP  589


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             SG L P++     L  LS++ N+++G +PP I  +  L+ L+L  N      P ++  L
Sbjct  441  FSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNLKNLQTLSLDTNRLSGEIPEEIWGL  499

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  +++  NN+ G++P  +   TSL  +    N  SG IP +  +  +L +L +S N 
Sbjct  500  KSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNSLSGEIPKKIAKLNDLSFLDLSRNQ  559

Query  595  LSGVIP  612
            L+G +P
Sbjct  560  LTGQLP  565


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 68/151 (45%), Gaps = 24/151 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G + P++  L  L +L ++ N L+G +P   S +  +  +NL  N      P     
Sbjct  272  NLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSDLKNIELINLFQNKLHGPIPEFFGD  331

Query  412  LANLQVLDLYNNNLTGDLP-------------VEVYKMTSL--RHLHLGG---------N  519
              NL+VL ++ NN T +LP             V +  +T L  R L  GG         N
Sbjct  332  FPNLEVLQVWGNNFTFELPQNLGRNGKLMMLDVSINHLTGLVPRDLCKGGKLTTLILMNN  391

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            +F G +P E G+  +L  + +  N  SG IP
Sbjct  392  FFLGSLPDEIGQCKSLLKIRIMNNMFSGTIP  422


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +  L  ++G+   L+ L ++ N L+G VP ++     L  L L NN F  + P ++ Q
Sbjct  344  NFTFELPQNLGRNGKLMMLDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQ  403

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              +L  + + NN  +G +P  ++ +     + L  N FSG +PPE      L  L+VS N
Sbjct  404  CKSLLKIRIMNNMFSGTIPAGIFNLPLATLVELSNNLFSGELPPEISG-DALGLLSVSNN  462

Query  592  GLSGVIP  612
             ++G IP
Sbjct  463  RITGKIP  469



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+
Sbjct  56   NLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYLNLSNNAFNGSFPAALAR  115

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IPPEYGR+  ++YLAVSGN
Sbjct  116  LRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGN  175

Query  592  GLSGVIP  612
             LSG IP
Sbjct  176  ELSGKIP  182


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  226  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  285

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL +L+L+ N L GD+P  V  + SL  L L  N  +G +PPE      +  L   GN 
Sbjct  286  KNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRLTGTLPPELCAGGKMHTLIALGNF  345

Query  595  LSGVIP  612
            L G IP
Sbjct  346  LFGAIP  351


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  419  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  478

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  479  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  538

Query  595  LSGVIP  612
            LSG++P
Sbjct  539  LSGLVP  544


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 67/125 (54%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  203  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  262

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +S N L
Sbjct  263  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRL  322

Query  598  SGVIP  612
            +G +P
Sbjct  323  TGTLP  327


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  401  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  454

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  455  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  514

Query  595  LSGVIP  612
            L G IP
Sbjct  515  LDGEIP  520


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 2/125 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  442  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  501

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  502  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPGT-GQFSYFNATSFVGN  560

Query  592  -GLSG  603
             GL G
Sbjct  561  PGLCG  565



>ref|XP_001752668.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ82539.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=992

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 122/180 (68%), Gaps = 3/180 (2%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLSGVLS  252
            E  ALL++K++F AD Q+ L +W +  + + C W  +TC +   VV L+LS +NL+G L 
Sbjct  12   EGLALLAMKSSF-ADPQNHLENWKLNGTATPCLWTGITCSNASSVVGLNLSNMNLTGTLP  70

Query  253  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  432
             D+G+L  LVN+S+  N  +G +P EI  +  L+++N+SNN F   FP  +++L +L+VL
Sbjct  71   ADLGRLKNLVNISLDLNNFTGVLPAEIVTLLMLQYVNISNNRFNGAFPANVSRLQSLKVL  130

Query  433  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            D +NN+ +G LP +++ + +L HL LGGNYF G IP +YG FP L+YL ++GN L+G IP
Sbjct  131  DCFNNDFSGSLPDDLWIIATLEHLSLGGNYFEGSIPSQYGSFPALKYLGLNGNSLTGPIP  190


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NLS  L   +G LP L +  IA N  SGP+PP+I  + +L  L+LS N      P +++ 
Sbjct  449  NLSSKLPESIGNLPTLQSFLIANNHFSGPIPPQICDMQSLNKLDLSGNELTGLIPQEMSN  508

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  LD   N LTG++P ++  +  L  L+L  N  SG IPP+      L     S N
Sbjct  509  CKKLGSLDFSRNGLTGEIPPQIEYIPDLYLLNLSHNQLSGHIPPQLQMLQTLNVFDFSYN  568

Query  592  GLSGVIP  612
             LSG IP
Sbjct  569  NLSGPIP  575


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 59/115 (51%), Gaps = 0/115 (0%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  447
            LP +  + I  NQ+ GP+P EI     L +L+ SNN   S  P  +  L  LQ   + NN
Sbjct  413  LPNITMVEIQMNQIMGPIPSEIIDSPKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANN  472

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            + +G +P ++  M SL  L L GN  +G IP E      L  L  S NGL+G IP
Sbjct  473  HFSGPIPPQICDMQSLNKLDLSGNELTGLIPQEMSNCKKLGSLDFSRNGLTGEIP  527


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L GV+   +G L  LV+L ++ N LSG +PP +  +  L  L+L +N F    P  +  +
Sbjct  258  LVGVIPVQIGNLVNLVSLDLSYNNLSGIIPPALIYLQKLELLSLMSNNFEGEIPDFIGDM  317

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NLQVL L+ N LTG +P  + +  +L  L L  N+ +G IP +      L+++ +  N 
Sbjct  318  PNLQVLYLWANKLTGPIPEALGQNMNLTLLDLSSNFLNGTIPSDLCAGQKLQWVILKDNQ  377

Query  595  LSGVIP  612
            L+G IP
Sbjct  378  LTGPIP  383


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 61/127 (48%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N S  +    G L  LV L +    L+G +PPE+  +  L  + L  N      P Q+  
Sbjct  209  NYSSGIPATFGNLTSLVRLDMGRCGLTGTIPPELGNLGNLDSMFLQLNELVGVIPVQIGN  268

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  LDL  NNL+G +P  +  +  L  L L  N F G IP   G  PNL+ L +  N
Sbjct  269  LVNLVSLDLSYNNLSGIIPPALIYLQKLELLSLMSNNFEGEIPDFIGDMPNLQVLYLWAN  328

Query  592  GLSGVIP  612
             L+G IP
Sbjct  329  KLTGPIP  335


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 57/114 (50%), Gaps = 0/114 (0%)
 Frame = +1

Query  271  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  450
            P L  L  + N LS  +P  I  + TL+   ++NN F    P Q+  + +L  LDL  N 
Sbjct  438  PKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANNHFSGPIPPQICDMQSLNKLDLSGNE  497

Query  451  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            LTG +P E+     L  L    N  +G IPP+    P+L  L +S N LSG IP
Sbjct  498  LTGLIPQEMSNCKKLGSLDFSRNGLTGEIPPQIEYIPDLYLLNLSHNQLSGHIP  551


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N  G +   +G +P L  L + AN+L+GP+P  +     L  L+LS+N    T P  L  
Sbjct  305  NFEGEIPDFIGDMPNLQVLYLWANKLTGPIPEALGQNMNLTLLDLSSNFLNGTIPSDLCA  364

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               LQ + L +N LTG +P       SL  + L  N  +G IP      PN+  + +  N
Sbjct  365  GQKLQWVILKDNQLTGPIPENFGNCLSLEKIRLSNNLLNGSIPLGLLGLPNITMVEIQMN  424

Query  592  GLSGVIP  612
             + G IP
Sbjct  425  QIMGPIP  431


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 53/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  292  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  471
            +  NQL+GP+P       +L  + LSNN+   + P  L  L N+ ++++  N + G +P 
Sbjct  373  LKDNQLTGPIPENFGNCLSLEKIRLSNNLLNGSIPLGLLGLPNITMVEIQMNQIMGPIPS  432

Query  472  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            E+     L +L    N  S ++P   G  P L+   ++ N  SG IP
Sbjct  433  EIIDSPKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANNHFSGPIP  479


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 65/151 (43%), Gaps = 25/151 (17%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR------FLNLSNNI---FGS  387
              G +    G  P L  L +  N L+GP+PPE+  +  L+      F N S+ I   FG+
Sbjct  161  FEGSIPSQYGSFPALKYLGLNGNSLTGPIPPELGKLQALQELYMGYFNNYSSGIPATFGN  220

Query  388  ----------------TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  519
                            T P +L  L NL  + L  N L G +PV++  + +L  L L  N
Sbjct  221  LTSLVRLDMGRCGLTGTIPPELGNLGNLDSMFLQLNELVGVIPVQIGNLVNLVSLDLSYN  280

Query  520  YFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              SG IPP       LE L++  N   G IP
Sbjct  281  NLSGIIPPALIYLQKLELLSLMSNNFEGEIP  311



>ref|XP_008357152.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=837

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 115/175 (66%), Gaps = 1/175 (1%)
 Frame = +1

Query  91   LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  270
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  271  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNN  447
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N TG LPVE+  + +L+HL LGGN+ +G IP  Y    +LEYL V+GN LSG +P
Sbjct  153  NFTGTLPVELVSLKNLKHLQLGGNFITGEIPENYSEIQSLEYLGVNGNMLSGRVP  207


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+ +++LY NNL G +P  +     L  L +  N F+  +P   GR   L+ L V+G 
Sbjct  310  LKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGX  369

Query  592  GLSGVIP  612
             L+G+IP
Sbjct  370  HLTGLIP  376


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 72/134 (54%), Gaps = 9/134 (7%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  411
            LSG + P++  L  L++L ++ N+LSG +P   S +  +  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPELSALNRLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGP-IPKFIGD  333

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-------LE  570
              +L+VL ++ NN T +LP  + +   L+ L + G + +G IP ++ + P+       L 
Sbjct  334  FPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGXHLTGLIPRDFRKIPDSISRCSSLT  393

Query  571  YLAVSGNGLSGVIP  612
               +S N L G IP
Sbjct  394  SADLSQNNLVGEIP  407


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
            ++G +  +  ++  L  L +  N LSG VP  +S +  LR L +   N +    P +L  
Sbjct  178  ITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSRLKNLRELYVGYYNSYSGGIPPELGS  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L++LQ+LD+ + NL G +P  +  +  L  L L  N  SG IPPE      L  L +S N
Sbjct  238  LSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSIN  297

Query  592  GLSGVIP  612
             LSG IP
Sbjct  298  ELSGEIP  304


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG + P++G L  L  L + +  L GP+P  +S +  L  L L  N    + P +L+ L 
Sbjct  228  SGGIPPELGSLSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALN  287

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L  LDL  N L+G++P    ++ ++  ++L  N   G IP   G FP+LE L +  N  
Sbjct  288  RLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNF  347

Query  598  SGVIP  612
            +  +P
Sbjct  348  TFELP  352


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 61/127 (48%), Gaps = 8/127 (6%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSG-------PVPPEISAISTLRFLNLSNNIFGST  390
            N +  L  ++G+   L  L +    L+G        +P  IS  S+L   +LS N     
Sbjct  346  NFTFELPENLGRNGRLKELDVTGXHLTGLIPRDFRKIPDSISRCSSLTSADLSQNNLVGE  405

Query  391  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  570
             P  +A+L  L +L+   N LTG++P E+  MTSL  L L  N F GRIP   G+F    
Sbjct  406  IPKGIAKLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDNNFVGRIPTG-GQFLVFN  464

Query  571  YLAVSGN  591
              + SGN
Sbjct  465  DTSFSGN  471



>ref|XP_008364929.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=973

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 115/175 (66%), Gaps = 1/175 (1%)
 Frame = +1

Query  91   LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  270
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  271  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQVLDLYNN  447
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  448  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N TG LPVE+  + +L+HL LGGN+ +G IP  Y    +LEYL V+GN LSG +P
Sbjct  153  NFTGTLPVELVSLKNLKHLQLGGNFITGEIPENYSEIQSLEYLGVNGNMLSGRVP  207


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+ +++LY NNL G +P  +     L  L +  N F+  +P   GR   L+ L V+GN
Sbjct  310  LKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGN  369

Query  592  GLSGVIP  612
             L+G+IP
Sbjct  370  HLTGLIP  376


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 63/127 (50%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +LSG + P  G L  L  L +  N  SG +P EI  +  L  +N+S N  G   P  +++
Sbjct  465  HLSGKIPPAXGNLKSLQTLXLEMNGFSGEIPSEIFDLKLLSRINISANNJGRKIPDSISR  524

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
             ++L   DL  NNL G++P  + K+  L  L+   N  +G IP E     +L  L +S N
Sbjct  525  CSSLTSADLSQNNLVGEIPKGIAKLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDN  584

Query  592  GLSGVIP  612
               G IP
Sbjct  585  NFVGRIP  591


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 69/127 (54%), Gaps = 2/127 (2%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  411
            LSG + P++  L  L++L ++ N+LSG +P   S +  +  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPELSALNRLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGP-IPKFIGD  333

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              +L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP +     NL+   +  N
Sbjct  334  FPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGNHLTGLIPRDLCTGGNLKTAILMEN  393

Query  592  GLSGVIP  612
               G IP
Sbjct  394  HFFGPIP  400


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L+G++  D+     L    +  N   GP+P E+   ++L  + +  N    T P  +  
Sbjct  370  HLTGLIPRDLCTGGNLKTAILMENHFFGPIPEELGRCNSLTKIRMMKNSLSGTIPAGIFS  429

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL +++L +N L+G+LP E     ++  L L GN+ SG+IPP  G   +L+ L +  N
Sbjct  430  LPNLIMIELNDNFLSGELP-EQMSGGNIGILTLSGNHLSGKIPPAXGNLKSLQTLXLEMN  488

Query  592  GLSGVIP  612
            G SG IP
Sbjct  489  GFSGEIP  495


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
            ++G +  +  ++  L  L +  N LSG VP  +S +  LR L +   N +    P +L  
Sbjct  178  ITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSRLKNLRELYVGYYNSYSGGIPPELGS  237

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L++LQ+LD+ + NL G +P  +  +  L  L L  N  SG IPPE      L  L +S N
Sbjct  238  LSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSIN  297

Query  592  GLSGVIP  612
             LSG IP
Sbjct  298  ELSGEIP  304


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
            SG + P++G L  L  L + +  L GP+P  +S +  L  L L  N    + P +L+ L 
Sbjct  228  SGGIPPELGSLSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALN  287

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L  LDL  N L+G++P    ++ ++  ++L  N   G IP   G FP+LE L +  N  
Sbjct  288  RLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNF  347

Query  598  SGVIP  612
            +  +P
Sbjct  348  TFELP  352



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 112/184 (61%), Gaps = 5/184 (3%)
 Frame = +1

Query  73   VTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLS  240
            +  QA++L S+K  F A S  SL+SWN+S     C+W  + CD+L   V        NLS
Sbjct  26   LRRQASILASVKQGFEA-SDPSLSSWNVSNYKFLCSWAGIMCDNLSRSVISLDVSNYNLS  84

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G LSPD+ +L  LVNLS++ N  SG  P  I  +  L++LN+SNN FG +   + AQL  
Sbjct  85   GSLSPDITELRTLVNLSVSGNDFSGSFPAGIHKLPRLQYLNISNNGFGGSMDWEFAQLKE  144

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L +LD YNN+  G LP+ V ++  L+ L  GGNYFSG IPP YG    L YL+V+GN LS
Sbjct  145  LILLDAYNNDFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPPSYGNMSQLNYLSVAGNDLS  204

Query  601  GVIP  612
            G IP
Sbjct  205  GFIP  208


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 70/127 (55%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +  G + P++G+L  L +L +A   L G +PPE+  +  L  L L  N    + P QL  
Sbjct  227  DFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQTNQLSGSIPAQLGN  286

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L++L+ LDL NN LTGD+PVE   +  L  L+L  N F G IP E    PNLE L +  N
Sbjct  287  LSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAELPNLEVLKLWQN  346

Query  592  GLSGVIP  612
              +G IP
Sbjct  347  NFTGAIP  353


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + +G L   V QLP L  L    N  SG +PP    +S L +L+++ N      P +L  
Sbjct  154  DFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPPSYGNMSQLNYLSVAGNDLSGFIPSELGN  213

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L NL  L L Y N+  G +P E+ K+T+L HL L      G IPPE G    L+ L +  
Sbjct  214  LTNLTQLFLGYYNDFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQT  273

Query  589  NGLSGVIP  612
            N LSG IP
Sbjct  274  NQLSGSIP  281


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 74/152 (49%), Gaps = 26/152 (17%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP------PEISAI------------------  342
            L G L  D+G+   LV + +  N LSG +P      PE++ +                  
Sbjct  396  LFGPLPDDLGECDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQ  455

Query  343  --STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  516
              S L  LNLS+N    + P  +   ++LQ+L L  N  TG++P ++ ++ ++  L +  
Sbjct  456  VPSKLSQLNLSSNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSR  515

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N FSG IPPE G    L YL +S N LSG IP
Sbjct  516  NNFSGSIPPEIGNCTLLTYLDLSQNQLSGPIP  547


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH++A+L
Sbjct  276  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAEL  335

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE--YGRFPNLEYLAVSG  588
             NL+VL L+ NN TG +P ++ +   L  L L  N  +G +P    +GR   L+ L +  
Sbjct  336  PNLEVLKLWQNNFTGAIPSKLGQNGKLVELDLSTNKLTGEVPKSLCFGR--KLKILILLN  393

Query  589  NGLSGVIP  612
            N L G +P
Sbjct  394  NFLFGPLP  401


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 61/112 (54%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L  L++++N+LSG  P  I   S+L+ L LS N F    P  + +L N+  LD+  NN +
Sbjct  460  LSQLNLSSNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSRNNFS  519

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +P E+   T L +L L  N  SG IPP+  +   L Y  VS N L+  +P
Sbjct  520  GSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLP  571


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N SG + P++G    L  L ++ NQLSGP+PP++  I  L + N+S N    + P +L  
Sbjct  517  NFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLPKELGS  576

Query  412  LANLQVLDLYNNNLTGDLP  468
            L +L   D  +N+ +G +P
Sbjct  577  LKSLTSADFSHNSFSGSVP  595


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +  D+G+L  ++ L ++ N  SG +PPEI   + L +L+LS N      P Q+ Q+
Sbjct  494  FTGEIPSDIGRLRNVLKLDMSRNNFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQI  553

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L   ++  N+L   LP E+  + SL       N FSG + P+ G++    + +  GN
Sbjct  554  HILNYFNVSWNHLNQSLPKELGSLKSLTSADFSHNSFSGSV-PQTGQYLFFNHTSFIGN  611


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 66/153 (43%), Gaps = 26/153 (17%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G +   +GQ   LV L ++ N+L+G VP  +     L+ L L NN      P  L +
Sbjct  347  NFTGAIPSKLGQNGKLVELDLSTNKLTGEVPKSLCFGRKLKILILLNNFLFGPLPDDLGE  406

Query  412  ------------------------LANLQVLDLYNNNLTGDLPVEVYKM--TSLRHLHLG  513
                                    L  L +++L NN LTG L ++      + L  L+L 
Sbjct  407  CDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQVPSKLSQLNLS  466

Query  514  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
             N  SG  P   G F +L+ L +SGN  +G IP
Sbjct  467  SNRLSGSPPASIGNFSSLQILLLSGNRFTGEIP  499



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 133/178 (75%), Gaps = 1/178 (1%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  258
            E  ALLS+K+  + +  ++L +W  +T HC+W  VTC S   VV+LDLSG NLSG L P 
Sbjct  28   EHRALLSLKSELS-NPGAALAAWEAATDHCSWPGVTCGSSGAVVALDLSGRNLSGPLPPA  86

Query  259  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  438
            VG+L  L+ LS+AAN LSGP+PPE++ +  LR LNLSNN+   +FP  LA+LA+L++LDL
Sbjct  87   VGRLRSLLRLSVAANFLSGPIPPELALLPDLRHLNLSNNLLNGSFPVALARLADLRLLDL  146

Query  439  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            YNNNLTG LP EV  MT LRHLHLGGN+FSG IPPEYG +  LEYLA+SGN LSG IP
Sbjct  147  YNNNLTGPLPQEVAAMTLLRHLHLGGNFFSGSIPPEYGHWQFLEYLAISGNELSGPIP  204


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G+L  L ++ ++ N L+G +PP  S +S L  LNL  N    T P  +  L
Sbjct  272  LSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDL  331

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL ++ NN TG +P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  332  PELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNKLTGSLPPDLCYGNKLETLIALGNF  391

Query  595  LSGVIP  612
            L G IP
Sbjct  392  LFGSIP  397


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 69/126 (55%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   + L
Sbjct  248  LSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGL  307

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP   G    L+ L +S N 
Sbjct  308  SNLTLLNLFRNKLFGTIPEFVGDLPELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNK  367

Query  595  LSGVIP  612
            L+G +P
Sbjct  368  LTGSLP  373


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G L P +G    L  L ++ N  SG +PPE+  +  L  L+ S N F      ++++ 
Sbjct  466  LVGPLPPSIGNFSGLQKLLLSQNSFSGSIPPEVRRLQQLSKLDFSGNRFSGPITPEISKC  525

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  +DL  N ++G++P ++  +  L +L+L  N+  G+IP       +L  +  S N 
Sbjct  526  KLLTFVDLSRNEISGNVPSDIAALRILNYLNLSRNHLEGQIPSAISTMQSLTAVDFSYNN  585

Query  595  LSGVIP  612
            LSG++P
Sbjct  586  LSGLVP  591


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P++G L  L+ L  A   LSG +P E+  +  L  L L  N      P +L +L 
Sbjct  225  DGGVPPEIGNLSALLRLDAANCGLSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLR  284

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +L+ +DL NN LTG +P     +++L  L+L  N   G IP   G  P LE L +  N  
Sbjct  285  SLKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDLPELEVLQMWENNF  344

Query  598  SGVIP  612
            +G IP
Sbjct  345  TGSIP  349


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 60/123 (49%), Gaps = 3/123 (2%)
 Frame = +1

Query  253  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  423
            PD G     P L  + ++ N+L GP+PP I   S L+ L LS N F  + P ++ +L  L
Sbjct  445  PDTGDSSISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLSQNSFSGSIPPEVRRLQQL  504

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
              LD   N  +G +  E+ K   L  + L  N  SG +P +      L YL +S N L G
Sbjct  505  SKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVPSDIAALRILNYLNLSRNHLEG  564

Query  604  VIP  612
             IP
Sbjct  565  QIP  567


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + SG + P+V +L  L  L  + N+ SGP+ PEIS    L F++LS N      P  +A 
Sbjct  489  SFSGSIPPEVRRLQQLSKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVPSDIAA  548

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  549  LRILNYLNLSRNHLEGQIPSAISTMQSLTAVDFSYNNLSGLV-PSTGQFSYFNATSFVGN  607


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 60/152 (39%), Gaps = 26/152 (17%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
             L+G L PD+     L  L    N L G +P  +    +L  + + +N    + PH L  
Sbjct  367  KLTGSLPPDLCYGNKLETLIALGNFLFGSIPESLGRCESLSRIRMGDNYLNGSIPHGLFS  426

Query  412  LANLQVLD--------------------------LYNNNLTGDLPVEVYKMTSLRHLHLG  513
            L NL  ++                          L NN L G LP  +   + L+ L L 
Sbjct  427  LPNLSQVEFQDNLLTGGFPDTGDSSISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLS  486

Query  514  GNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
             N FSG IPPE  R   L  L  SGN  SG I
Sbjct  487  QNSFSGSIPPEVRRLQQLSKLDFSGNRFSGPI  518



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 113/186 (61%), Gaps = 5/186 (3%)
 Frame = +1

Query  67   LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  234
            L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29   LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFICSWAGIHCDNMNISVVSLDISNYN  87

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88   LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +LD YNN+  G LP+ V ++  L+ L  GGNYFSG IPP YG    L YL+V+GN 
Sbjct  148  KELILLDAYNNDFNGSLPLGVTQIPKLKRLDFGGNYFSGNIPPSYGNMVQLNYLSVAGND  207

Query  595  LSGVIP  612
            LSG IP
Sbjct  208  LSGFIP  213


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L+ LDL NN LTGD+P E   +  L  L+L  N F G IP      P LE L +  N 
Sbjct  293  SSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAELPKLEVLKLWHNN  352

Query  595  LSGVIP  612
             +G IP
Sbjct  353  FTGAIP  358


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 63/128 (49%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            + +G L   V Q+P L  L    N  SG +PP    +  L +L+++ N      P +L  
Sbjct  159  DFNGSLPLGVTQIPKLKRLDFGGNYFSGNIPPSYGNMVQLNYLSVAGNDLSGFIPSELGN  218

Query  412  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            L NL+ L L Y N   G +P E+ K+ +L HL L      G IPPE G    L+ L +  
Sbjct  219  LTNLKQLFLGYYNEFEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQT  278

Query  589  NGLSGVIP  612
            N LSG IP
Sbjct  279  NQLSGSIP  286


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            L+G L  +  ++P  L  L++++N+LSGP+P  I   S+L+ L LS N F    P  + +
Sbjct  449  LTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGR  508

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+  LD   NN +G +P+EV    SL +L L  N  +G IP +  +   L Y  VS N
Sbjct  509  LVNVLKLDFSRNNFSGRIPLEVGNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWN  568

Query  592  GLSGVIP  612
             L+  +P
Sbjct  569  HLNQSLP  575


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G    L NL ++ NQ +G +P +I  +  +  L+ S N F    P ++   
Sbjct  474  LSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSRNNFSGRIPLEVGNC  533

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  LDL  N LTG +PV++ ++  L + ++  N+ +  +P E G   +L     S N 
Sbjct  534  LSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGSMKSLTSADFSHNS  593

Query  595  LSGVIP  612
             SG IP
Sbjct  594  FSGSIP  599


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G + P++G L  L  L +  NQLSG +P ++  +S+LR L+LSNN      P + + L
Sbjct  257  LEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEFSAL  316

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +L+L+ N   G++P  + ++  L  L L  N F+G IP + G+   L  L +S N 
Sbjct  317  RKLTLLNLFINKFHGEIPHAIAELPKLEVLKLWHNNFTGAIPSKLGQNGKLIDLDLSSNK  376

Query  595  LSGVIP  612
            L+GV+P
Sbjct  377  LTGVVP  382


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 70/128 (55%), Gaps = 4/128 (3%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAEL  340

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE--YGRFPNLEYLAVSG  588
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P    +GR   L+ L +  
Sbjct  341  PKLEVLKLWHNNFTGAIPSKLGQNGKLIDLDLSSNKLTGVVPKSLCFGR--RLKILILLN  398

Query  589  NGLSGVIP  612
            N L G +P
Sbjct  399  NFLFGALP  406


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 70/152 (46%), Gaps = 25/152 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G +   +GQ   L++L +++N+L+G VP  +     L+ L L NN      P  L +
Sbjct  352  NFTGAIPSKLGQNGKLIDLDLSSNKLTGVVPKSLCFGRRLKILILLNNFLFGALPDDLGK  411

Query  412  ------------------------LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGG  516
                                    L  L +++L NN LTG L  E  K+ S L  L+L  
Sbjct  412  CDTLVRVRMGQNYLTGSIPQGFLYLPELSLVELQNNYLTGQLLEEASKVPSKLSQLNLSS  471

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N  SG +P   G F +L+ L +SGN  +G IP
Sbjct  472  NRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIP  503


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N SG +  +VG    L  L ++ NQL+GP+P +I  I  L + N+S N    + P +L  
Sbjct  521  NFSGRIPLEVGNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGS  580

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L   D  +N+ +G +P
Sbjct  581  MKSLTSADFSHNSFSGSIP  599



>ref|XP_008808401.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Phoenix dactylifera]
Length=989

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 115/176 (65%), Gaps = 1/176 (1%)
 Frame = +1

Query  88   ALLSIKAAFTADSQSSLTSWNIST-SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  264
            AL+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++ 
Sbjct  31   ALMKLKEGLLGSAGNDLHDWDPSAPTHCSFSGVTCDADARVVALNVSHIRFHRPLPPEIS  90

Query  265  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  444
            +L  LVNL++A + L+G +PPEI+A+  LRFLN+SNN F   FP        L+VLD YN
Sbjct  91   RLDRLVNLTVACDSLAGRLPPEIAALPALRFLNISNNNFTGHFPDVDGGFLALEVLDAYN  150

Query  445  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            NN +G LP+ + K+  LR++HLGGN+FSG IP  YG   +LEYL ++GNGLSG +P
Sbjct  151  NNFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNGLSGRVP  206


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG + P +G    L  LS+ +N++SG +PP+I  +  L  LNLS N      P  LA+ 
Sbjct  465  ISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEIPSDLARC  524

Query  415  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            A  L+ +DL  N LTG++P  + K+ +L  L+L  N  SG IP +  R  +L  L +S N
Sbjct  525  AGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQRMLSLTTLDLSYN  584

Query  592  GLSGVIP  612
             LSG IP
Sbjct  585  NLSGEIP  591


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 1/110 (1%)
 Frame = +1

Query  286  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  465
            L +A N++SGP+PP I     L+ L+L +N      P Q+  L  L  L+L  NNLTG++
Sbjct  458  LLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEI  517

Query  466  PVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            P ++ +   +L  + L  N  +G IP    +  NL  L +S N LSG IP
Sbjct  518  PSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIP  567


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 68/127 (54%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NL+G +   +GQL  L +L +  N L+G +PPE+  +  L  L+LS N      P   A+
Sbjct  249  NLTGRIPASLGQLKLLDSLFLQWNHLAGSIPPELGGLDLLESLDLSINELTGELPESFAE  308

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L  L++L+L+ N+  G +P  +  + +L  L +  N F+  +P   GR   L  L V+ N
Sbjct  309  LKQLKLLNLFRNHFRGHIPPFIADLPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATN  368

Query  592  GLSGVIP  612
             L+G IP
Sbjct  369  RLTGTIP  375


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 66/129 (51%), Gaps = 7/129 (5%)
 Frame = +1

Query  235  LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  405
            L+G +  D+   G+L  LV   +  N   GP+P ++    +L  + L+ N    T P  L
Sbjct  370  LTGTIPSDLCASGRLELLV---LMENAFFGPIPEKLGDCKSLLHVRLAKNFLDGTIPAGL  426

Query  406  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  585
              L ++ +L+L +N L+G+LP  +     L  L L  N  SG IPP  G F  L+ L++ 
Sbjct  427  FDLPSVDMLELSDNYLSGELPARIAG-DKLGMLLLANNRISGPIPPAIGNFRGLQTLSLQ  485

Query  586  GNGLSGVIP  612
             N +SG IP
Sbjct  486  SNRISGEIP  494


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (51%), Gaps = 1/124 (1%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G +   +G    L+++ +A N L G +P  +  + ++  L LS+N      P ++A    
Sbjct  396  GPIPEKLGDCKSLLHVRLAKNFLDGTIPAGLFDLPSVDMLELSDNYLSGELPARIAG-DK  454

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L +L L NN ++G +P  +     L+ L L  N  SG IPP+ G    L  L +SGN L+
Sbjct  455  LGMLLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLT  514

Query  601  GVIP  612
            G IP
Sbjct  515  GEIP  518


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (53%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L+G + P++G L  L +L ++ N+L+G +P   + +  L+ LNL  N F    P  +A 
Sbjct  273  HLAGSIPPELGGLDLLESLDLSINELTGELPESFAELKQLKLLNLFRNHFRGHIPPFIAD  332

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL+VL ++ NN T +LP  + +   L  L +  N  +G IP +      LE L +  N
Sbjct  333  LPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATNRLTGTIPSDLCASGRLELLVLMEN  392

Query  592  GLSGVIP  612
               G IP
Sbjct  393  AFFGPIP  399


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P+ G L  LV L +A   L+G +P  +  +  L  L L  N    + P +L  L 
Sbjct  227  EGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQWNHLAGSIPPELGGLD  286

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
             L+ LDL  N LTG+LP    ++  L+ L+L  N+F G IPP     PNLE L V  N  
Sbjct  287  LLESLDLSINELTGELPESFAELKQLKLLNLFRNHFRGHIPPFIADLPNLEVLQVWENNF  346

Query  598  SGVIP  612
            +  +P
Sbjct  347  TFELP  351


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 68/152 (45%), Gaps = 25/152 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N SG L   + +LP L  + +  N  SG +P     I +L +L L+ N      P  L++
Sbjct  152  NFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNGLSGRVPVSLSR  211

Query  412  LANLQV-------------------------LDLYNNNLTGDLPVEVYKMTSLRHLHLGG  516
            L NL+                          LD+ N NLTG +P  + ++  L  L L  
Sbjct  212  LTNLREMYIGYYSMYEGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQW  271

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N+ +G IPPE G    LE L +S N L+G +P
Sbjct  272  NHLAGSIPPELGGLDLLESLDLSINELTGELP  303


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
            NL+G +  D+ +    L  + ++ N+L+G +P  I+ +  L  LNLS N      P  + 
Sbjct  512  NLTGEIPSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQ  571

Query  409  QLANLQVLDLYNNNLTGDLPVE  474
            ++ +L  LDL  NNL+G++PVE
Sbjct  572  RMLSLTTLDLSYNNLSGEIPVE  593



>ref|XP_009418700.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=993

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 119/183 (65%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   GVTEQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNLSGV  246
            G  +  AL+ +KAA  A   S+L +W+  S  +C++  V CD    VV+L+ +G+ L+G 
Sbjct  24   GDADLEALIKLKAALVAPGSSALGNWDPASADYCSFTGVACDENSRVVALNFTGVQLNGT  83

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH-QLAQLANL  423
            L P++G L  LVNL+++ + + GP+P E++A+ +LR LN+SNN F   FPH        L
Sbjct  84   LPPEIGILSGLVNLTVSCSGVVGPLPMELAALPSLRLLNVSNNNFSGAFPHVGPGGFPTL  143

Query  424  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSG  603
            +V+D YNNN +G LP+ +    SLR+LHLGGNYF+G IP EY    NLEYL ++GN L+G
Sbjct  144  EVIDAYNNNFSGRLPLGLAAAPSLRYLHLGGNYFNGTIPKEYSDIKNLEYLGLNGNALTG  203

Query  604  VIP  612
             +P
Sbjct  204  RVP  206


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G + P +G LP L NL++ +NQ+SG +PPEI  +  L  LNLS N      P  L + 
Sbjct  465  ITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRC  524

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L ++DL  NNLTG +PV +  +  L  L+L  N  SG IPPE  R  +L    +S N 
Sbjct  525  SSLVMIDLSRNNLTGAIPVRIPALQILNTLNLSRNQISGVIPPEMQRMRSLTIFDLSYNR  584

Query  595  LSGVIP  612
            L+GVIP
Sbjct  585  LAGVIP  590


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L +L ++ N+L+G VP   + +  L+ L+L  N      P  +A+L
Sbjct  274  LSGSIPPELGGLSMLESLDLSINELTGEVPESFAELKELKLLSLFRNHIRGAIPPFVAEL  333

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             NL+VL+L+ NN T  LP  + +   L  L +  N  +G IPP+      LE L +  NG
Sbjct  334  PNLEVLELWENNFTMQLPESLGRNGRLLKLDVASNRITGTIPPDLCASGRLETLVLMENG  393

Query  595  LSGVIP  612
              G IP
Sbjct  394  FFGPIP  399


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 62/109 (57%), Gaps = 0/109 (0%)
 Frame = +1

Query  286  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  465
            L+++ N ++G +PP I ++  L+ L L +N      P ++ QL  L  L+L  N+L+GD+
Sbjct  458  LALSNNLITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDI  517

Query  466  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            PV++ + +SL  + L  N  +G IP        L  L +S N +SGVIP
Sbjct  518  PVDLTRCSSLVMIDLSRNNLTGAIPVRIPALQILNTLNLSRNQISGVIP  566


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 1/126 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            ++G + PD+     L  L +  N   GP+P ++    +L  + L+ N    + P  L  L
Sbjct  370  ITGTIPPDLCASGRLETLVLMENGFFGPIPEKLGECKSLTRVRLAKNFLNGSIPAGLFDL  429

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +  +L+L  N L+GDLP  V     L  L L  N  +G IPP  G  P L+ LA+  N 
Sbjct  430  PSNDMLELSENFLSGDLP-PVIAGNKLGMLALSNNLITGSIPPAIGSLPALQNLALDSNQ  488

Query  595  LSGVIP  612
            +SG IP
Sbjct  489  ISGAIP  494


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 0/124 (0%)
 Frame = +1

Query  241  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  420
            G + P++G L  LV L +A   LSGP+P  + ++  L  L L  N    + P +L  L+ 
Sbjct  228  GGIPPELGMLSSLVRLDMAGCGLSGPIPASLGSLKHLDTLFLQINRLSGSIPPELGGLSM  287

Query  421  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLS  600
            L+ LDL  N LTG++P    ++  L+ L L  N+  G IPP     PNLE L +  N  +
Sbjct  288  LESLDLSINELTGEVPESFAELKELKLLSLFRNHIRGAIPPFVAELPNLEVLELWENNFT  347

Query  601  GVIP  612
              +P
Sbjct  348  MQLP  351



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 107/181 (59%), Gaps = 4/181 (2%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LD+YNNNL G LP+ V ++  L++L  GGNYF G IPP YG    L YL++ GN L G+I
Sbjct  155  LDVYNNNLNGTLPLGVTQLGKLKYLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLI  214

Query  610  P  612
            P
Sbjct  215  P  215


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNK  378

Query  595  LSGVIP  612
            L+G++P
Sbjct  379  LTGLVP  384


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            +++  LDL NN LTGD+P+E   +  L  L+L  N   G IP      P LE L +  N 
Sbjct  295  SSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNN  354

Query  595  LSGVIP  612
             +G IP
Sbjct  355  FTGAIP  360


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  592  GLSGVIP  612
             L+  +P
Sbjct  571  HLNQSLP  577


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P        L+ L +  N 
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINF  402

Query  595  LSGVIP  612
            L G +P
Sbjct  403  LFGPLP  408


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPSQIGQLKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQI  559

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L  L++  N+L   LP E+  M SL       N FSG I PE+G++      + SGN
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSI-PEFGQYSFFNSTSFSGN  617


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  592  GLSGVIP  612
             L+G IP
Sbjct  306  ALTGDIP  312


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354  NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVSG  588
               L  + L  N LTG +P     +  L  + L  NY SG++P +  + P  L  + ++ 
Sbjct  414  CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLAD  473

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  474  NRLSGPLP  481



>ref|XP_011004295.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Populus euphratica]
Length=893

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 107/181 (59%), Gaps = 4/181 (2%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  249
            + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  429
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  430  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
            LD+YNNNL G LP+ V ++  L++L  GGNYF G IPP YG    L YL++ GN L G+I
Sbjct  155  LDVYNNNLNGTLPLGVTQLGKLKYLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLI  214

Query  610  P  612
            P
Sbjct  215  P  215


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNK  378

Query  595  LSGVIP  612
            L+G++P
Sbjct  379  LTGLVP  384


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 67/126 (53%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            +++  LDL NN LTGD+P+E   +  L  L+L  N   G IP      P LE L +  N 
Sbjct  295  SSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNN  354

Query  595  LSGVIP  612
             +G IP
Sbjct  355  FTGAIP  360


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 70/127 (55%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  592  GLSGVIP  612
             L+  +P
Sbjct  571  HLNQSLP  577


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 68/126 (54%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P        L+ L +  N 
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINF  402

Query  595  LSGVIP  612
            L G +P
Sbjct  403  LFGPLP  408


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPSQIGQLKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQI  559

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              L  L++  N+L   LP E+  M SL       N FSG I PE+G++      + SGN
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSI-PEFGQYSFFNSTSFSGN  617


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 65/127 (51%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  592  GLSGVIP  612
             L+G IP
Sbjct  306  ALTGDIP  312


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 60/128 (47%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354  NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVSG  588
               L  + L  N LTG +P     +  L  + L  NY SG++P +  + P  L  + ++ 
Sbjct  414  CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLAD  473

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  474  NRLSGPLP  481



>gb|AAF73373.1|AF193835_1 LRK1 protein [Oryza sativa]
Length=970

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 116/182 (64%), Gaps = 5/182 (3%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  249
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  250  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  426
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLDLYNNNLTG LP+EV  +  LRHLHLGGN FSG IPPEYG   + +YLA+    LSG 
Sbjct  146  VLDLYNNNLTGALPLEVVSLRKLRHLHLGGNIFSGGIPPEYGHGGSFKYLALRQTSLSGY  205

Query  607  IP  612
             P
Sbjct  206  PP  207


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 56/118 (47%), Gaps = 0/118 (0%)
 Frame = +1

Query  259  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  438
            VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L     L+ L  
Sbjct  334  VGDLPSLEVLQLWENNFTGGMPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIA  393

Query  439  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              N+L G +P  + K TSL  + LG NY +G IP      PNL  + +  N +SG  P
Sbjct  394  LGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDNLISGGFP  451


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 64/129 (50%), Gaps = 2/129 (2%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            +L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP     
Sbjct  397  SLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGT  456

Query  412  LA-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
             A NL  + L NN LTG LP  +   + ++ L L  N F+G IPPE GR   L    +SG
Sbjct  457  GAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSG  516

Query  589  NGL-SGVIP  612
            N L +G +P
Sbjct  517  NSLPTGGVP  525


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (49%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST-FPHQLAQ  411
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N   +   P ++ +
Sbjct  471  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSLPTGGVPPEIGK  530

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
               L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N
Sbjct  531  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYN  590

Query  592  GLSGVIP  612
             LSG++P
Sbjct  591  NLSGLVP  597



>ref|XP_002510557.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF52744.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=985

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = +1

Query  70   GVTEQAALLSIKAAFTADSQSSLTSWNIS---TSHCTWRRVTCdsllhvvsldlsglN-L  237
            G ++   LL +K++  A + S L  W  S   ++HC++  VTCD    VVSL+L+  +  
Sbjct  25   GYSDAELLLKLKSSMIARNGSGLQDWEPSPSPSAHCSFSGVTCDKDSRVVSLNLTSRHGF  84

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  414
             G + P++G L  LVNLSIA+  L+G +P E++ +++LR  N+SNN F   FP ++   +
Sbjct  85   FGFIPPEIGLLNKLVNLSIASLNLTGRLPLELAQLTSLRIFNISNNAFIGNFPGEITLVM  144

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              LQ+LD+YNNN +G LP+E+ K+ +L+HLHLGGNYFSG IP  Y    +LEYL ++GN 
Sbjct  145  TQLQILDIYNNNFSGLLPLELIKLKNLKHLHLGGNYFSGTIPESYSAIESLEYLGLNGNS  204

Query  595  LSGVIP  612
            LSG +P
Sbjct  205  LSGKVP  210


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 75/127 (59%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            NLSG + P +GQL  L +L +  N+LSG +PPE+S + +L+ L+LS N      P   ++
Sbjct  253  NLSGEIPPSLGQLKNLNSLFLQMNRLSGHIPPELSDLISLQSLDLSINSLKGEIPASFSK  312

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L N+ ++ L+ NNL G++P  +    +L  LH+  N F+  +P   G    L+ L VS N
Sbjct  313  LKNITLIHLFQNNLGGEIPEFIGDFPNLEVLHVWENNFTLELPKNLGSSGKLKMLDVSYN  372

Query  592  GLSGVIP  612
             L+G+IP
Sbjct  373  HLTGLIP  379


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  417
             G + P+ G L  L  L +A + LSG +PP +  +  L  L L  N      P +L+ L 
Sbjct  231  EGGIPPEFGSLSSLEILDMAQSNLSGEIPPSLGQLKNLNSLFLQMNRLSGHIPPELSDLI  290

Query  418  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  597
            +LQ LDL  N+L G++P    K+ ++  +HL  N   G IP   G FPNLE L V  N  
Sbjct  291  SLQSLDLSINSLKGEIPASFSKLKNITLIHLFQNNLGGEIPEFIGDFPNLEVLHVWENNF  350

Query  598  SGVIP  612
            +  +P
Sbjct  351  TLELP  355


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 73/152 (48%), Gaps = 25/152 (16%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N SG+L  ++ +L  L +L +  N  SG +P   SAI +L +L L+ N      P  LA+
Sbjct  156  NFSGLLPLELIKLKNLKHLHLGGNYFSGTIPESYSAIESLEYLGLNGNSLSGKVPASLAK  215

Query  412  LANL-------------------------QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  516
            L NL                         ++LD+  +NL+G++P  + ++ +L  L L  
Sbjct  216  LKNLRKLYLGYFNSWEGGIPPEFGSLSSLEILDMAQSNLSGEIPPSLGQLKNLNSLFLQM  275

Query  517  NYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N  SG IPPE     +L+ L +S N L G IP
Sbjct  276  NRLSGHIPPELSDLISLQSLDLSINSLKGEIP  307


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +  ++  L +L  ++ +AN LSG +PP IS  ++L  ++ S N      P ++A L
Sbjct  493  LSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHCTSLTSVDFSRNNLHGQIPVEIANL  552

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  540
             +L +L++  N+LTG +P ++  MTSL  L L  N   GR+P
Sbjct  553  KDLSILNVSQNHLTGQIPGDIRIMTSLTTLDLSYNNLLGRVP  594


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (47%), Gaps = 25/150 (17%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG +   +  LP +  L +  N  SG +P E+S I+ L  L +SNN+   + P  L  L
Sbjct  422  LSGTIPSGIFNLPSMAILELNDNYFSGELPSEMSGIA-LGLLKISNNLISGSIPETLGNL  480

Query  415  ANLQVL-------------DLYN-----------NNLTGDLPVEVYKMTSLRHLHLGGNY  522
             NLQ++             +++N           NNL+GD+P  +   TSL  +    N 
Sbjct  481  RNLQIIKLEINRLSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHCTSLTSVDFSRNN  540

Query  523  FSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
              G+IP E     +L  L VS N L+G IP
Sbjct  541  LHGQIPVEIANLKDLSILNVSQNHLTGQIP  570


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            +SG +   +G L  L  + +  N+LSG +P EI  +  L  +N S N      P  ++  
Sbjct  469  ISGSIPETLGNLRNLQIIKLEINRLSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHC  528

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
             +L  +D   NNL G +PVE+  +  L  L++  N+ +G+IP +     +L  L +S N 
Sbjct  529  TSLTSVDFSRNNLHGQIPVEIANLKDLSILNVSQNHLTGQIPGDIRIMTSLTTLDLSYNN  588

Query  595  LSGVIP  612
            L G +P
Sbjct  589  LLGRVP  594


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 1/127 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +  L  ++G    L  L ++ N L+G +P ++     L+ L L  N F    P +L Q
Sbjct  349  NFTLELPKNLGSSGKLKMLDVSYNHLTGLIPKDLCKGGRLKELVLMKNFFLGPLPDELGQ  408

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
              +L  + + NN L+G +P  ++ + S+  L L  NYFSG +P E      L  L +S N
Sbjct  409  CKSLYKIRVANNMLSGTIPSGIFNLPSMAILELNDNYFSGELPSEMSGIA-LGLLKISNN  467

Query  592  GLSGVIP  612
             +SG IP
Sbjct  468  LISGSIP  474



>gb|KEH33614.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = +1

Query  67   LGVTEQAALL-SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl---sg  228
            L +  QA++L S+K  F   S +SL+SWN+S   S CTW  + CD  +  +S+     S 
Sbjct  25   LSLKNQASILVSMKQDFEPSSNTSLSSWNMSNYMSLCTWYGIQCDHTITNMSIVSLDISN  84

Query  229  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
            LN+SG  SP + +L  LVN+SI  N   G  P EI  +  L+ LN+SNN+F      +  
Sbjct  85   LNISGSFSPQITKLYNLVNVSIQGNSFYGEFPTEIHKLQRLKCLNISNNMFSGNLSWEFN  144

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
            +L  L+VLD+YNN   G LP  V +++SL+HL+ GGNYFSG+IP  YG    L +L+++G
Sbjct  145  KLKELEVLDIYNNGFNGSLPRGVTQVSSLKHLNFGGNYFSGKIPTSYGEMKQLNFLSLAG  204

Query  589  NGLSGVIP  612
            N LSG +P
Sbjct  205  NDLSGFLP  212


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 66/126 (52%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            LSG L   +G  P L  L ++ N+ SG +P +I  +  +  L++S+N F  T P ++ + 
Sbjct  474  LSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDISSNNFSGTIPSEIGKC  533

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L  LDL  N  +G +P+++ ++  L HL++  N+ +  IP E G    L     S N 
Sbjct  534  TLLTYLDLSQNQFSGPIPIQLAQIHILNHLNVSWNHLNQSIPKELGALKGLTSADFSHNN  593

Query  595  LSGVIP  612
             SG IP
Sbjct  594  FSGSIP  599


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 75/174 (43%), Gaps = 48/174 (28%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G + P++G L  L  L ++ N L+G +P E S +  L  LNL  N F S  P  +++L
Sbjct  280  LTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISEL  339

Query  415  ANLQVLDLYNNNLTG---------------------------------------------  459
              L+VL L+ NN TG                                             
Sbjct  340  PKLEVLKLWRNNFTGVIPSKLGQNGRLTEVDLSTNKLTGILPKSLCFGKRLKILILLNNF  399

Query  460  ---DLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
                LP ++ +  +L+ + +G NYF+G IP  +   PNL  L +  N LSGVIP
Sbjct  400  LFGSLPNDLGQCYTLQRVRIGQNYFTGSIPHGFLYLPNLSLLELQNNYLSGVIP  453


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 70/126 (56%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G +  ++GQL  L  L +  NQL+G +PPE+  +S L  L+LS N      P++ + L
Sbjct  256  LKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNL  315

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +L+L+ N    ++P  + ++  L  L L  N F+G IP + G+   L  + +S N 
Sbjct  316  RELSLLNLFINKFHSEIPDFISELPKLEVLKLWRNNFTGVIPSKLGQNGRLTEVDLSTNK  375

Query  595  LSGVIP  612
            L+G++P
Sbjct  376  LTGILP  381


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  411
             SG +    G++  L  LS+A N LSG +P E+  +++L  L L   N F    P +  +
Sbjct  183  FSGKIPTSYGEMKQLNFLSLAGNDLSGFLPSELGNLTSLENLYLGYFNQFDGGVPKEFGK  242

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L NL  LDL +  L G +P+E+ ++  L  L L  N  +G IPPE G    L  L +S N
Sbjct  243  LINLVHLDLASCFLKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNLSRLNALDLSLN  302

Query  592  GLSGVIP  612
             L+G IP
Sbjct  303  NLTGGIP  309


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
              G +  + G+L  LV+L +A+  L G +P E+  ++ L  L L  N      P +L  L
Sbjct  232  FDGGVPKEFGKLINLVHLDLASCFLKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNL  291

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            + L  LDL  NNLTG +P E   +  L  L+L  N F   IP      P LE L +  N 
Sbjct  292  SRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISELPKLEVLKLWRNN  351

Query  595  LSGVIP  612
             +GVIP
Sbjct  352  FTGVIP  357


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = +1

Query  277  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  456
            L   +++ N+LSG +P  I     L+ L LS N F    P  + +L  +  LD+ +NN +
Sbjct  464  LEQCNLSNNRLSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDISSNNFS  523

Query  457  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            G +P E+ K T L +L L  N FSG IP +  +   L +L VS N L+  IP
Sbjct  524  GTIPSEIGKCTLLTYLDLSQNQFSGPIPIQLAQIHILNHLNVSWNHLNQSIP  575


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 67/153 (44%), Gaps = 26/153 (17%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +GV+   +GQ   L  + ++ N+L+G +P  +     L+ L L NN    + P+ L Q
Sbjct  351  NFTGVIPSKLGQNGRLTEVDLSTNKLTGILPKSLCFGKRLKILILLNNFLFGSLPNDLGQ  410

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE---------------  546
               LQ + +  N  TG +P     + +L  L L  NY SG IP +               
Sbjct  411  CYTLQRVRIGQNYFTGSIPHGFLYLPNLSLLELQNNYLSGVIPQQTHKNKTSKLEQCNLS  470

Query  547  -----------YGRFPNLEYLAVSGNGLSGVIP  612
                        G FPNL+ L +SGN  SG IP
Sbjct  471  NNRLSGSLPTSIGNFPNLQTLQLSGNRFSGQIP  503



>ref|XP_009405747.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=984

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 112/182 (62%), Gaps = 6/182 (3%)
 Frame = +1

Query  79   EQAALLSIKAAFTADSQSSLTSWNISTSH---CTWRRVTCdsllhvvsldlsg-lNLSGV  246
            + + LLSIK +F   SQS L SWN S++H   C W  V CD   H+V        N SG 
Sbjct  35   QASILLSIKRSF-HHSQSLLPSWN-SSAHAALCAWDGVRCDDSNHLVLALDVANSNFSGS  92

Query  247  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  426
            LSP + +L  L +LS+A N LSGP P  IS +  LR+LN+SNN F  T     +  A L+
Sbjct  93   LSPAIAELKGLASLSVAGNSLSGPFPHAISELPRLRYLNISNNQFNGTLNWSFSDTAELE  152

Query  427  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGV  606
            VLD Y+N+ +G LPV + ++T LRHL LGGNYFSG IP  YG F  + YL+++GN L G 
Sbjct  153  VLDAYDNDFSGPLPVGLPRLTKLRHLDLGGNYFSGAIPFAYGGFSAITYLSLAGNDLGGF  212

Query  607  IP  612
            IP
Sbjct  213  IP  214


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L G + P++G L  L  L +  NQL+G +P ++  +S+LR+L++SNN      P + ++L
Sbjct  258  LEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKL  317

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
              L +L ++ N L  ++P  V ++ SL  L L  N F+G IP   GR   L  L +S N 
Sbjct  318  HQLTLLHVFMNRLHSEIPGFVAELPSLEVLKLWQNNFTGSIPAALGRNGRLRELDLSTNK  377

Query  595  LSGVIP  612
            L+G+IP
Sbjct  378  LTGLIP  383


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 65/127 (51%), Gaps = 0/127 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
               G +  ++G L  L++L +++  L G +PPE+  +  L  L L  N      P QL  
Sbjct  233  EFDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGN  292

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  591
            L++L+ LD+ NN LTG++P E  K+  L  LH+  N     IP      P+LE L +  N
Sbjct  293  LSSLRYLDISNNALTGEIPKEFSKLHQLTLLHVFMNRLHSEIPGFVAELPSLEVLKLWQN  352

Query  592  GLSGVIP  612
              +G IP
Sbjct  353  NFTGSIP  359


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  408
            +L G + P++G +  L  L +   N+  G VP EI  +  L  L+LS+       P +L 
Sbjct  208  DLGGFIPPELGNVTTLKQLYLGYYNEFDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELG  267

Query  409  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  588
             L NL  L L  N LTG +P ++  ++SLR+L +  N  +G IP E+ +   L  L V  
Sbjct  268  NLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKLHQLTLLHVFM  327

Query  589  NGLSGVIP  612
            N L   IP
Sbjct  328  NRLHSEIP  335


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +1

Query  268  LPFLVNLSIAANQLSGPVPPE-ISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  444
            LP L  L +  N L+G V  E     + L  LNLSNN      P  +   ++LQ+L L  
Sbjct  437  LPELSLLELQNNYLTGVVAEEPAQKPAKLGLLNLSNNRLTGPLPSSIGNFSSLQILLLGG  496

Query  445  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVIP  612
            N   G++P ++  +  +  + +  N FSGRIPPE G   +L YL +S N L+G IP
Sbjct  497  NEFAGEIPSQLGLLKQVLKVDMSRNNFSGRIPPEIGDCSSLTYLDLSHNQLAGPIP  552


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = +1

Query  235  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  414
            L+G L   +G    L  L +  N+ +G +P ++  +  +  +++S N F    P ++   
Sbjct  475  LTGPLPSSIGNFSSLQILLLGGNEFAGEIPSQLGLLKQVLKVDMSRNNFSGRIPPEIGDC  534

Query  415  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  594
            ++L  LDL +N L G +P  + ++  L +L+L  N  S RIP E     +L     S N 
Sbjct  535  SSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIPQEMASMKSLTSADFSHND  594

Query  595  LSGVIP  612
             SG IP
Sbjct  595  FSGKIP  600


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (49%), Gaps = 0/117 (0%)
 Frame = +1

Query  259  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  438
            V +LP L  L +  N  +G +P  +     LR L+LS N      P  L     L++L L
Sbjct  338  VAELPSLEVLKLWQNNFTGSIPAALGRNGRLRELDLSTNKLTGLIPPSLCFGKKLEILIL  397

Query  439  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGLSGVI  609
             NN L G LP ++    +L  + +G NY +G IP  +   P L  L +  N L+GV+
Sbjct  398  LNNFLFGPLPDDLGDCMTLSRVRMGQNYLTGSIPRGFLYLPELSLLELQNNYLTGVV  454


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N SG + P++G    L  L ++ NQL+GP+P  IS +  L +LNLS N      P ++A 
Sbjct  522  NFSGRIPPEIGDCSSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIPQEMAS  581

Query  412  LANLQVLDLYNNNLTGDLP  468
            + +L   D  +N+ +G +P
Sbjct  582  MKSLTSADFSHNDFSGKIP  600


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 58/128 (45%), Gaps = 1/128 (1%)
 Frame = +1

Query  232  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  411
            N +G +   +G+   L  L ++ N+L+G +PP +     L  L L NN      P  L  
Sbjct  353  NFTGSIPAALGRNGRLRELDLSTNKLTGLIPPSLCFGKKLEILILLNNFLFGPLPDDLGD  412

Query  412  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP-NLEYLAVSG  588
               L  + +  N LTG +P     +  L  L L  NY +G +  E  + P  L  L +S 
Sbjct  413  CMTLSRVRMGQNYLTGSIPRGFLYLPELSLLELQNNYLTGVVAEEPAQKPAKLGLLNLSN  472

Query  589  NGLSGVIP  612
            N L+G +P
Sbjct  473  NRLTGPLP  480



>ref|XP_007017845.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY15070.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=982

 Scor