BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS144B06

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU19497.1|  hypothetical protein MIMGU_mgv1a002250mg                105   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_003536498.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    104   4e-22   Glycine max [soybeans]
gb|KHN02770.1|  DEAD-box ATP-dependent RNA helicase 7                   104   4e-22   Glycine soja [wild soybean]
ref|XP_003556075.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    103   8e-22   Glycine max [soybeans]
gb|KHN15708.1|  DEAD-box ATP-dependent RNA helicase 7                   103   9e-22   Glycine soja [wild soybean]
ref|XP_008670328.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   3e-21   Zea mays [maize]
tpg|DAA40575.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    102   3e-21   
ref|XP_006357902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    101   4e-21   Solanum tuberosum [potatoes]
gb|EYU25021.1|  hypothetical protein MIMGU_mgv1a027128mg                101   5e-21   Erythranthe guttata [common monkey flower]
gb|EPS64456.1|  hypothetical protein M569_10323                         101   5e-21   Genlisea aurea
ref|XP_004240751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    101   6e-21   Solanum lycopersicum
ref|XP_009587639.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   7e-21   Nicotiana tomentosiformis
ref|XP_009767597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   8e-21   Nicotiana sylvestris
gb|EAZ09787.1|  hypothetical protein OsI_32075                        99.8    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_004957391.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.8    2e-20   Setaria italica
ref|XP_006660856.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.8    2e-20   Oryza brachyantha
ref|XP_003578458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.4    2e-20   Brachypodium distachyon [annual false brome]
ref|XP_002460541.1|  hypothetical protein SORBIDRAFT_02g030210        99.4    2e-20   Sorghum bicolor [broomcorn]
gb|KDO65345.1|  hypothetical protein CISIN_1g005470mg                 99.0    2e-20   Citrus sinensis [apfelsine]
ref|XP_011076505.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    100   3e-20   
ref|XP_002866477.1|  hypothetical protein ARALYDRAFT_496396           99.4    3e-20   Arabidopsis lyrata subsp. lyrata
gb|KDO65346.1|  hypothetical protein CISIN_1g005470mg                 98.6    3e-20   Citrus sinensis [apfelsine]
gb|KDO65344.1|  hypothetical protein CISIN_1g005470mg                 98.6    4e-20   Citrus sinensis [apfelsine]
ref|XP_011101144.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  99.0    4e-20   Sesamum indicum [beniseed]
gb|ACF80743.1|  unknown                                               97.8    4e-20   Zea mays [maize]
ref|XP_006421777.1|  hypothetical protein CICLE_v10004459mg           98.6    5e-20   Citrus clementina [clementine]
gb|KDO65342.1|  hypothetical protein CISIN_1g005470mg                 98.6    5e-20   Citrus sinensis [apfelsine]
ref|XP_002269873.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...  98.6    5e-20   Vitis vinifera
ref|XP_010275981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  98.6    6e-20   Nelumbo nucifera [Indian lotus]
gb|KJB39373.1|  hypothetical protein B456_007G009400                  97.4    7e-20   Gossypium raimondii
gb|KJB39371.1|  hypothetical protein B456_007G009400                  97.4    7e-20   Gossypium raimondii
ref|XP_008652955.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.8    8e-20   Zea mays [maize]
ref|XP_008652953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.4    1e-19   Zea mays [maize]
ref|XP_008652954.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.4    1e-19   
gb|KJB39369.1|  hypothetical protein B456_007G009400                  97.4    1e-19   Gossypium raimondii
gb|KJB39370.1|  hypothetical protein B456_007G009400                  97.4    1e-19   Gossypium raimondii
gb|KHG06829.1|  DEAD-box ATP-dependent RNA helicase 7                 97.4    1e-19   Gossypium arboreum [tree cotton]
gb|KHG06828.1|  DEAD-box ATP-dependent RNA helicase 7                 97.4    1e-19   Gossypium arboreum [tree cotton]
ref|XP_010940916.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.1    2e-19   Elaeis guineensis
ref|XP_004506292.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.1    2e-19   Cicer arietinum [garbanzo]
ref|XP_006394423.1|  hypothetical protein EUTSA_v10003756mg           97.1    2e-19   Eutrema salsugineum [saltwater cress]
emb|CDP05280.1|  unnamed protein product                              96.7    2e-19   Coffea canephora [robusta coffee]
ref|XP_004496645.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  96.7    2e-19   
ref|XP_002318863.2|  DEAD box RNA helicase family protein             96.7    2e-19   
ref|XP_004496646.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  96.3    2e-19   Cicer arietinum [garbanzo]
ref|XP_011030003.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  96.7    2e-19   Populus euphratica
ref|NP_001063702.1|  Os09g0520700                                     96.3    3e-19   
gb|EAZ45398.1|  hypothetical protein OsJ_30047                        96.3    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004308148.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  96.3    3e-19   Fragaria vesca subsp. vesca
ref|XP_001764376.1|  predicted protein                                96.3    3e-19   
sp|Q41382.1|RH7_SPIOL  RecName: Full=DEAD-box ATP-dependent RNA h...  95.9    4e-19   Spinacia oleracea
ref|XP_002510890.1|  dead box ATP-dependent RNA helicase, putative    95.5    6e-19   Ricinus communis
ref|XP_007143335.1|  hypothetical protein PHAVU_007G063700g           95.1    7e-19   Phaseolus vulgaris [French bean]
ref|XP_007038495.1|  DEAD-box ATP-dependent RNA helicase 7            95.9    7e-19   
ref|XP_010109082.1|  DEAD-box ATP-dependent RNA helicase 7            95.1    7e-19   Morus notabilis
ref|XP_009407947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  95.1    7e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009628542.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.7    9e-19   
ref|XP_009628541.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.7    1e-18   Nicotiana tomentosiformis
gb|KDP22369.1|  hypothetical protein JCGZ_26200                       94.7    1e-18   Jatropha curcas
ref|XP_009349718.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.4    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_009343503.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.4    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_008812489.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.4    1e-18   Phoenix dactylifera
ref|NP_201025.1|  DEAD/DEAH box RNA helicase PRH75                    94.0    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009781160.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.0    1e-18   Nicotiana sylvestris
gb|KFK27951.1|  hypothetical protein AALP_AA8G452500                  94.0    2e-18   Arabis alpina [alpine rockcress]
emb|CAA68194.1|  RNA helicase                                         94.0    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234340.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.0    2e-18   Prunus mume [ume]
ref|XP_008376504.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  94.0    2e-18   Malus domestica [apple tree]
ref|XP_007220217.1|  hypothetical protein PRUPE_ppa002304mg           94.0    2e-18   Prunus persica
ref|XP_006348047.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  93.6    2e-18   Solanum tuberosum [potatoes]
ref|XP_003592391.1|  DEAD-box ATP-dependent RNA helicase              93.6    2e-18   Medicago truncatula
ref|XP_004234150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  93.6    2e-18   Solanum lycopersicum
ref|XP_008467258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  93.6    2e-18   Cucumis melo [Oriental melon]
ref|XP_009398738.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  93.6    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009130201.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.8    4e-18   Brassica rapa
ref|XP_006858006.1|  hypothetical protein AMTR_s00069p00191130        92.8    4e-18   Amborella trichopoda
ref|XP_010934579.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.8    4e-18   Elaeis guineensis
gb|AAF40306.1|AF156667_1  RNA helicase                                92.8    5e-18   Vigna radiata [mung bean]
ref|XP_010458375.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.8    5e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010483921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.4    6e-18   Camelina sativa [gold-of-pleasure]
gb|KJB52899.1|  hypothetical protein B456_008G282800                  92.4    6e-18   Gossypium raimondii
gb|EMT03655.1|  DEAD-box ATP-dependent RNA helicase 7                 92.4    6e-18   
ref|XP_010444062.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.4    6e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010034995.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.4    6e-18   Eucalyptus grandis [rose gum]
gb|KJB52898.1|  hypothetical protein B456_008G282800                  92.4    6e-18   Gossypium raimondii
ref|XP_002322430.2|  DEAD box RNA helicase family protein             92.4    7e-18   Populus trichocarpa [western balsam poplar]
gb|KEH26427.1|  DEAD-box ATP-dependent RNA helicase                   92.0    7e-18   Medicago truncatula
ref|XP_008364874.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.0    7e-18   
gb|AAK62631.1|  AT5g62190/mmi9_10                                     92.0    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011041667.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  92.0    8e-18   Populus euphratica
emb|CDX87236.1|  BnaC09g05510D                                        91.3    1e-17   
emb|CDY16789.1|  BnaA09g05930D                                        91.3    1e-17   Brassica napus [oilseed rape]
ref|XP_009112011.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  91.3    1e-17   Brassica rapa
ref|XP_010693660.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  91.3    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009345013.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  91.3    2e-17   
ref|XP_006279587.1|  hypothetical protein CARUB_v10026032mg           90.1    3e-17   Capsella rubella
ref|XP_004172086.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  90.1    3e-17   
ref|XP_004143712.1|  PREDICTED: uncharacterized protein LOC101209696  90.1    6e-17   
ref|XP_010555319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.4    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_009346936.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  87.0    5e-16   
ref|XP_002975210.1|  hypothetical protein SELMODRAFT_150370           86.3    6e-16   
ref|XP_002977618.1|  hypothetical protein SELMODRAFT_107027           86.3    7e-16   
gb|KJB39372.1|  hypothetical protein B456_007G009400                  85.5    1e-15   Gossypium raimondii
ref|XP_010059508.1|  PREDICTED: nucleolar RNA helicase 2-like         84.3    3e-15   
ref|XP_005854803.1|  dead deah box rna                                82.4    1e-14   Nannochloropsis gaditana CCMP526
ref|XP_010068038.1|  PREDICTED: acetyl-coenzyme A synthetase, chl...  79.3    4e-14   
gb|ETK72184.1|  hypothetical protein L915_20663                       77.8    5e-14   Phytophthora parasitica
ref|XP_005645158.1|  DEAD-domain-containing protein                   79.3    1e-13   Coccomyxa subellipsoidea C-169
gb|EMS52016.1|  DEAD-box ATP-dependent RNA helicase 7                 79.3    2e-13   Triticum urartu
gb|EWM21167.1|  dead deah box rna                                     79.3    2e-13   Nannochloropsis gaditana
gb|ETP29814.1|  hypothetical protein F442_21078                       78.6    3e-13   Phytophthora parasitica P10297
ref|XP_008914911.1|  hypothetical protein PPTG_18629                  78.6    3e-13   Phytophthora parasitica INRA-310
gb|ETI31844.1|  hypothetical protein F443_21248                       78.6    3e-13   Phytophthora parasitica P1569
ref|XP_002904811.1|  DEAD/DEAH box RNA helicase, putative             77.4    7e-13   Phytophthora infestans T30-4
ref|XP_010938270.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.9    2e-12   Elaeis guineensis
ref|XP_011399479.1|  DEAD-box ATP-dependent RNA helicase 7            75.5    3e-12   Auxenochlorella protothecoides
ref|XP_005849733.1|  hypothetical protein CHLNCDRAFT_20835            74.3    5e-12   Chlorella variabilis
ref|XP_003058076.1|  predicted protein                                73.9    9e-12   Micromonas pusilla CCMP1545
emb|CEP17128.1|  hypothetical protein                                 73.6    1e-11   Parasitella parasitica
ref|XP_001417262.1|  predicted protein                                73.2    1e-11   Ostreococcus lucimarinus CCE9901
emb|CDS09503.1|  hypothetical protein LRAMOSA10863                    72.0    4e-11   Lichtheimia ramosa
dbj|GAN03042.1|  nucleolar RNA helicase 2-like isoform X2             71.2    7e-11   Mucor ambiguus
gb|EPB89647.1|  hypothetical protein HMPREF1544_03579                 71.2    7e-11   Mucor circinelloides f. circinelloides 1006PhL
emb|CDH59679.1|  nucleolar rna helicase 2-like                        70.9    8e-11   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002507890.1|  predicted protein                                70.9    9e-11   Micromonas commoda
emb|CEG79803.1|  hypothetical protein RMATCC62417_14224               70.1    1e-10   Rhizopus microsporus
ref|XP_009837773.1|  hypothetical protein H257_12310                  70.5    1e-10   Aphanomyces astaci
gb|EIE87311.1|  hypothetical protein RO3G_12022                       70.1    1e-10   Rhizopus delemar RA 99-880
emb|CEI86541.1|  hypothetical protein RMCBS344292_00980               69.7    2e-10   Rhizopus microsporus
ref|XP_004300425.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.6    2e-10   Fragaria vesca subsp. vesca
emb|CBK20101.2|  unnamed protein product                              69.3    2e-10   Blastocystis hominis
emb|CEG65973.1|  hypothetical protein RMATCC62417_02639               69.3    3e-10   Rhizopus microsporus
ref|XP_007512398.1|  predicted protein                                69.3    3e-10   Bathycoccus prasinos
ref|XP_003078811.1|  putative RNA helicase (ISS)                      68.9    3e-10   Ostreococcus tauri
ref|XP_008364905.1|  PREDICTED: uncharacterized protein LOC103428569  65.9    4e-10   
ref|XP_009496395.1|  hypothetical protein H696_04240                  68.2    6e-10   Fonticula alba
ref|XP_008873274.1|  hypothetical protein H310_09087                  68.2    7e-10   Aphanomyces invadans
ref|XP_007054740.1|  PREDICTED: nucleolar RNA helicase 2-like         67.8    8e-10   
gb|EMP40574.1|  Nucleolar RNA helicase 2                              67.8    1e-09   Chelonia mydas [green seaturtle]
ref|XP_006630629.1|  PREDICTED: nucleolar RNA helicase 2-like         67.4    1e-09   Lepisosteus oculatus
ref|XP_005297367.1|  PREDICTED: nucleolar RNA helicase 2              67.0    1e-09   
ref|XP_010887236.1|  PREDICTED: nucleolar RNA helicase 2-like         66.6    2e-09   Esox lucius
emb|CCA17723.1|  DEAD/DEAH box RNA helicase putative                  66.6    2e-09   Albugo laibachii Nc14
ref|XP_006273547.1|  PREDICTED: nucleolar RNA helicase 2-like         66.6    2e-09   Alligator mississippiensis
ref|XP_010789411.1|  PREDICTED: nucleolar RNA helicase 2-like         64.7    3e-09   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_002502509.1|  DEAD/DEAH box RNA helicase                       66.2    3e-09   Micromonas commoda
ref|XP_009520796.1|  hypothetical protein PHYSODRAFT_326516           66.2    3e-09   Phytophthora sojae
ref|NP_001120807.1|  nucleolar RNA helicase 2                         65.9    3e-09   
emb|CDQ75565.1|  unnamed protein product                              65.9    3e-09   Oncorhynchus mykiss
ref|XP_006125341.1|  PREDICTED: nucleolar RNA helicase 2              65.9    4e-09   
emb|CEI94647.1|  hypothetical protein RMCBS344292_08852               65.5    4e-09   Rhizopus microsporus
gb|ACH85363.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21             65.5    4e-09   Salmo salar
ref|XP_003056927.1|  DEAD/DEAH box RNA helicase                       65.5    4e-09   Micromonas pusilla CCMP1545
ref|XP_002112077.1|  hypothetical protein TRIADDRAFT_55752            65.5    4e-09   Trichoplax adhaerens
ref|XP_005838835.1|  hypothetical protein GUITHDRAFT_102470           65.1    5e-09   Guillardia theta CCMP2712
ref|XP_006820781.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  65.1    6e-09   Saccoglossus kowalevskii
ref|XP_002738237.2|  PREDICTED: nucleolar RNA helicase 2-like iso...  65.1    6e-09   Saccoglossus kowalevskii
ref|XP_009309382.1|  putative nucleolar RNA helicase II               64.7    8e-09   Trypanosoma grayi
ref|XP_001702450.1|  RNA helicase                                     64.7    8e-09   Chlamydomonas reinhardtii
ref|XP_005815128.1|  PREDICTED: nucleolar RNA helicase 2-like         64.7    8e-09   Xiphophorus maculatus
ref|XP_007549868.1|  PREDICTED: nucleolar RNA helicase 2-like         64.7    8e-09   Poecilia formosa
ref|XP_005733301.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   Pundamilia nyererei
ref|XP_005467227.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   
ref|XP_008290699.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   Stegastes partitus
ref|XP_005915179.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   Haplochromis burtoni
ref|XP_004539930.1|  PREDICTED: nucleolar RNA helicase 2-like         64.3    1e-08   
ref|XP_006406182.1|  hypothetical protein EUTSA_v10020290mg           64.3    1e-08   Eutrema salsugineum [saltwater cress]
emb|CDY46329.1|  BnaC01g31630D                                        63.9    1e-08   Brassica napus [oilseed rape]
ref|XP_002883355.1|  hypothetical protein ARALYDRAFT_479746           63.9    1e-08   
ref|NP_188872.2|  putative mitochondrial RNA helicase 2               63.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KCW88483.1|  hypothetical protein EUGRSUZ_A00875                   63.5    1e-08   Eucalyptus grandis [rose gum]
ref|XP_006023203.1|  PREDICTED: nucleolar RNA helicase 2-like         63.9    1e-08   
ref|XP_006297190.1|  hypothetical protein CARUB_v10013195mg           63.9    1e-08   Capsella rubella
ref|XP_006780037.1|  PREDICTED: nucleolar RNA helicase 2-like         63.9    2e-08   Neolamprologus brichardi [lyretail cichlid]
emb|CDY10634.1|  BnaA05g17280D                                        63.5    2e-08   Brassica napus [oilseed rape]
ref|XP_009145390.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.5    2e-08   Brassica rapa
ref|XP_007253243.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  63.2    2e-08   
ref|XP_007253242.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  63.2    2e-08   
ref|XP_010753600.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  63.2    3e-08   
ref|XP_003079318.1|  ATP-dependent RNA helicase (ISS)                 63.2    3e-08   
ref|XP_010511255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.2    3e-08   Camelina sativa [gold-of-pleasure]
emb|CEF97957.1|  Helicase, C-terminal                                 63.2    3e-08   Ostreococcus tauri
ref|XP_010511251.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008611506.1|  hypothetical protein SDRG_07451                  62.8    3e-08   Saprolegnia diclina VS20
ref|XP_010488258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010488257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    3e-08   Camelina sativa [gold-of-pleasure]
gb|KDO19871.1|  hypothetical protein SPRG_14901                       62.8    3e-08   Saprolegnia parasitica CBS 223.65
ref|XP_006297246.1|  hypothetical protein CARUB_v10013251mg           62.8    3e-08   Capsella rubella
ref|XP_011406566.1|  PREDICTED: ATP-dependent RNA helicase DDX50-...  62.4    3e-08   
ref|XP_010488255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    3e-08   
ref|XP_010488254.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002955657.1|  hypothetical protein VOLCADRAFT_66087            62.8    4e-08   Volvox carteri f. nagariensis
ref|XP_003976441.1|  PREDICTED: nucleolar RNA helicase 2-like         62.8    4e-08   
gb|KFK39521.1|  hypothetical protein AALP_AA3G255300                  62.4    4e-08   Arabis alpina [alpine rockcress]
gb|KFH66922.1|  hypothetical protein MVEG_07447                       62.4    4e-08   Mortierella verticillata NRRL 6337
ref|XP_009108947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.4    5e-08   Brassica rapa
ref|NP_188870.1|  DEAD-box ATP-dependent RNA helicase                 62.0    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466510.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    6e-08   Camelina sativa [gold-of-pleasure]
gb|EPY22928.1|  nucleolar RNA helicase II                             62.0    6e-08   Strigomonas culicis
ref|XP_845112.1|  nucleolar RNA helicase II                           62.0    6e-08   Trypanosoma brucei brucei TREU927
ref|XP_011490446.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  61.6    7e-08   
ref|XP_004067286.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  61.6    8e-08   
ref|XP_010466515.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010466514.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010466512.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004334405.1|  DEAD/DEAH box helicase domain containing pro...  61.6    8e-08   Acanthamoeba castellanii str. Neff
ref|XP_002461445.1|  hypothetical protein SORBIDRAFT_02g002790        61.6    9e-08   Sorghum bicolor [broomcorn]
ref|XP_010511242.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002883354.1|  hypothetical protein ARALYDRAFT_479744           61.2    1e-07   
emb|CBJ26838.1|  DEAD box helicase                                    61.2    1e-07   Ectocarpus siliculosus
gb|EFB22545.1|  hypothetical protein PANDA_001614                     61.2    1e-07   Ailuropoda melanoleuca
ref|XP_002913778.1|  PREDICTED: nucleolar RNA helicase 2              61.2    1e-07   Ailuropoda melanoleuca
ref|XP_005708224.1|  ATP-dependent RNA helicase                       61.2    1e-07   Galdieria sulphuraria
emb|CDY37406.1|  BnaC05g30240D                                        60.8    1e-07   Brassica napus [oilseed rape]
emb|CDY37408.1|  BnaC05g30220D                                        60.8    2e-07   Brassica napus [oilseed rape]
ref|XP_005297366.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   Chrysemys picta bellii
ref|XP_009035969.1|  hypothetical protein AURANDRAFT_895              60.5    2e-07   Aureococcus anophagefferens
ref|XP_007054739.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   
ref|XP_006380943.1|  hypothetical protein POPTR_0006s02500g           60.5    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_009993187.1|  PREDICTED: nucleolar RNA helicase 2-like         60.5    2e-07   Chaetura pelagica
ref|XP_011040644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.1    2e-07   Populus euphratica
ref|XP_002130533.1|  PREDICTED: nucleolar RNA helicase 2              60.5    2e-07   Ciona intestinalis [sea vase]
ref|XP_009064553.1|  hypothetical protein LOTGIDRAFT_221850           60.5    2e-07   Lottia gigantea
ref|XP_011004482.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.1    2e-07   Populus euphratica
ref|XP_002308835.2|  hypothetical protein POPTR_0006s02500g           60.1    2e-07   
ref|XP_007514064.1|  predicted protein                                60.1    2e-07   Bathycoccus prasinos
ref|XP_010295282.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    3e-07   Phaethon lepturus
ref|XP_006676381.1|  hypothetical protein BATDEDRAFT_84954            60.1    3e-07   Batrachochytrium dendrobatidis JAM81
ref|XP_005235246.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    3e-07   Falco peregrinus [peregrine]
ref|XP_005433605.1|  PREDICTED: nucleolar RNA helicase 2-like         60.1    3e-07   
ref|XP_009990339.1|  PREDICTED: nucleolar RNA helicase 2-like         59.7    3e-07   Tauraco erythrolophus
gb|KFK39522.1|  hypothetical protein AALP_AA3G255500                  59.7    3e-07   Arabis alpina [alpine rockcress]
ref|XP_009674650.1|  PREDICTED: nucleolar RNA helicase 2-like         59.7    3e-07   Struthio camelus australis
ref|XP_009919521.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    3e-07   Haliaeetus albicilla
ref|XP_004344972.1|  nucleolar RNA helicase 2                         59.7    3e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_001762375.1|  predicted protein                                59.7    3e-07   
ref|XP_007902730.1|  PREDICTED: nucleolar RNA helicase 2-like         59.7    3e-07   Callorhinchus milii [Australian ghost shark]
gb|EDL92964.1|  rCG22008, isoform CRA_a                               58.9    3e-07   Rattus norvegicus [brown rat]
ref|WP_013170431.1|  DNA helicase                                     59.3    4e-07   Arcanobacterium haemolyticum
gb|KEH33609.1|  DEAD-box ATP-dependent RNA helicase-like protein      59.7    4e-07   Medicago truncatula
ref|XP_004251555.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    4e-07   Solanum lycopersicum
ref|XP_009865080.1|  PREDICTED: nucleolar RNA helicase 2-like         59.3    4e-07   Apaloderma vittatum
ref|XP_786504.3|  PREDICTED: nucleolar RNA helicase 2-like            59.7    4e-07   
ref|XP_006351994.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    4e-07   Solanum tuberosum [potatoes]
gb|KEH33610.1|  DEAD-box ATP-dependent RNA helicase-like protein      59.3    4e-07   Medicago truncatula
ref|XP_006351993.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    4e-07   Solanum tuberosum [potatoes]
ref|XP_006351991.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.7    4e-07   Solanum tuberosum [potatoes]
ref|XP_009499705.1|  PREDICTED: nucleolar RNA helicase 2-like         59.3    4e-07   Phalacrocorax carbo [common cormorant]
ref|XP_005009180.1|  PREDICTED: nucleolar RNA helicase 2              59.3    4e-07   
gb|EOB09008.1|  Nucleolar RNA helicase 2                              59.3    4e-07   Anas platyrhynchos [duck]
ref|XP_010323935.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...  59.3    4e-07   
gb|ESL06796.1|  nucleolar RNA helicase II                             59.3    5e-07   Trypanosoma rangeli SC58
gb|ESL05810.1|  nucleolar RNA helicase II                             59.3    5e-07   Trypanosoma rangeli SC58
ref|WP_037630327.1|  RNA helicase                                     55.8    5e-07   Streptomyces albidoflavus
ref|WP_037701325.1|  DEAD/DEAH box helicase                           58.9    5e-07   Streptomyces lavenduligriseus
emb|CCC48181.1|  putative nucleolar RNA helicase II, fragment         59.3    5e-07   Trypanosoma vivax Y486
ref|XP_011449590.1|  PREDICTED: nucleolar RNA helicase 2-like         59.3    5e-07   
ref|XP_007048884.1|  DEAD-box ATP-dependent RNA helicase 53 isofo...  59.3    5e-07   
ref|XP_008308798.1|  PREDICTED: nucleolar RNA helicase 2              59.3    5e-07   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008943828.1|  PREDICTED: nucleolar RNA helicase 2-like         58.9    5e-07   Merops nubicus
ref|XP_009487807.1|  PREDICTED: nucleolar RNA helicase 2-like         58.9    5e-07   Pelecanus crispus
sp|Q0D8N0.2|RH53_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  58.9    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EPY37911.1|  nucleolar RNA helicase II                             58.9    5e-07   Angomonas deanei
emb|CDP16079.1|  unnamed protein product                              58.9    5e-07   Coffea canephora [robusta coffee]
ref|XP_010158185.1|  PREDICTED: nucleolar RNA helicase 2-like         58.9    5e-07   Eurypyga helias
ref|XP_010164383.1|  PREDICTED: nucleolar RNA helicase 2-like         58.9    5e-07   
ref|XP_007048882.1|  DEAD-box ATP-dependent RNA helicase 53 isofo...  58.9    5e-07   
ref|XP_009591168.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.9    6e-07   Nicotiana tomentosiformis
gb|EPY43380.1|  nucleolar RNA helicase II                             58.9    6e-07   Angomonas deanei
ref|XP_009581978.1|  PREDICTED: nucleolar RNA helicase 2-like         58.9    6e-07   Fulmarus glacialis
gb|ELU03439.1|  hypothetical protein CAPTEDRAFT_52524                 58.9    6e-07   Capitella teleta
ref|XP_004386445.1|  PREDICTED: nucleolar RNA helicase 2              58.9    6e-07   Trichechus manatus latirostris
ref|XP_009892319.1|  PREDICTED: nucleolar RNA helicase 2-like         58.9    6e-07   Charadrius vociferus
ref|XP_010197456.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    6e-07   Colius striatus
gb|ERE87186.1|  nucleolar RNA helicase 2-like protein                 58.9    6e-07   Cricetulus griseus [Chinese hamsters]
emb|CCD17000.1|  unnamed protein product                              58.9    6e-07   Trypanosoma congolense IL3000
emb|CCC90744.1|  putative nucleolar RNA helicase II                   58.9    6e-07   Trypanosoma congolense IL3000
gb|EPY25966.1|  nucleolar RNA helicase II                             58.9    7e-07   Angomonas deanei
ref|XP_007146300.1|  hypothetical protein PHAVU_006G028900g           58.5    7e-07   Phaseolus vulgaris [French bean]
ref|XP_008924427.1|  PREDICTED: nucleolar RNA helicase 2-like         58.9    7e-07   
ref|XP_003409350.1|  PREDICTED: nucleolar RNA helicase 2              58.9    7e-07   
ref|XP_003871902.1|  putative nucleolar RNA helicase II               58.5    7e-07   
ref|XP_009635263.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    7e-07   
ref|XP_001687490.1|  putative nucleolar RNA helicase II               58.5    7e-07   
ref|XP_001519340.2|  PREDICTED: nucleolar RNA helicase 2              58.9    7e-07   
ref|XP_006889064.1|  PREDICTED: nucleolar RNA helicase 2              58.5    7e-07   
ref|XP_010703777.1|  nucleolar RNA helicase II, putative              58.5    7e-07   
ref|XP_009288813.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    8e-07   
ref|XP_009814524.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    8e-07   
ref|XP_007638831.1|  PREDICTED: nucleolar RNA helicase 2              58.5    8e-07   
gb|EGV93789.1|  Nucleolar RNA helicase 2                              58.5    8e-07   
emb|CBI31778.3|  unnamed protein product                              58.5    8e-07   
ref|XP_009324263.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    8e-07   
ref|XP_004992590.1|  DEAD box polypeptide 47 isoform 1                58.5    8e-07   
emb|CAD98303.1|  DEAD/DEAH box helicase, possible                     58.5    8e-07   
ref|XP_666695.1|  DEAD/DEAH box helicase                              58.5    8e-07   
ref|XP_001462984.2|  putative nucleolar RNA helicase II               58.5    8e-07   
ref|XP_010153144.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    8e-07   
ref|XP_005153742.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    8e-07   
ref|XP_003858201.1|  nucleolar RNA helicase II, putative              58.5    8e-07   
emb|CCW64428.1|  unnamed protein product                              58.5    9e-07   
ref|XP_807135.1|  nucleolar RNA helicase II                           58.5    9e-07   
ref|XP_010578315.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    9e-07   
ref|XP_006406184.1|  hypothetical protein EUTSA_v10020296mg           58.5    9e-07   
ref|XP_010011653.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    9e-07   
ref|XP_006658271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.2    9e-07   
gb|KHG04586.1|  DEAD-box ATP-dependent RNA helicase 53 -like protein  58.2    9e-07   
ref|XP_006972790.1|  PREDICTED: nucleolar RNA helicase 2              58.5    9e-07   
ref|XP_009949129.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    9e-07   
ref|XP_009703721.1|  PREDICTED: nucleolar RNA helicase 2-like         58.2    9e-07   
ref|XP_009905459.1|  PREDICTED: nucleolar RNA helicase 2-like         58.5    9e-07   
ref|XP_005990005.1|  PREDICTED: nucleolar RNA helicase 2              58.2    9e-07   
ref|XP_627813.1|  nucleolar protein GU2. eIF4A-1-family. RNA SFII...  58.2    1e-06   
ref|XP_004624414.1|  PREDICTED: nucleolar RNA helicase 2              58.5    1e-06   
gb|EPY83760.1|  hypothetical protein CB1_000533042                    58.5    1e-06   
ref|XP_007423216.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
ref|XP_010168437.1|  PREDICTED: nucleolar RNA helicase 2-like         58.2    1e-06   
ref|XP_009771005.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.2    1e-06   
ref|XP_008694185.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
ref|XP_010551734.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.2    1e-06   
ref|XP_010551735.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.2    1e-06   
ref|XP_010578254.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  58.2    1e-06   
gb|EDL92966.1|  rCG22008, isoform CRA_c                               58.2    1e-06   
ref|XP_009464338.1|  PREDICTED: nucleolar RNA helicase 2-like         58.2    1e-06   
ref|WP_009199012.1|  DNA helicase                                     58.2    1e-06   
ref|XP_009094282.1|  PREDICTED: nucleolar RNA helicase 2-like         58.2    1e-06   
ref|XP_005491116.1|  PREDICTED: nucleolar RNA helicase 2-like         58.2    1e-06   
ref|XP_005005365.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
ref|XP_010578253.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  58.2    1e-06   
ref|XP_004470594.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
ref|XP_805705.1|  nucleolar RNA helicase II                           58.2    1e-06   
ref|XP_004701442.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
ref|XP_009695874.1|  PREDICTED: nucleolar RNA helicase 2-like         58.2    1e-06   
ref|XP_008771332.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  58.2    1e-06   
gb|EPQ14283.1|  Nucleolar RNA helicase 2                              58.2    1e-06   
ref|XP_008830862.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
ref|XP_008756606.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  58.2    1e-06   
ref|XP_006835901.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
gb|AAH59237.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21             58.2    1e-06   
ref|XP_005429044.1|  PREDICTED: nucleolar RNA helicase 2-like         57.8    1e-06   
ref|XP_007938866.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
ref|XP_010297376.1|  PREDICTED: nucleolar RNA helicase 2-like         57.8    1e-06   
ref|XP_010551733.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.2    1e-06   
ref|NP_001032278.1|  nucleolar RNA helicase 2                         58.2    1e-06   
ref|XP_007505939.1|  PREDICTED: nucleolar RNA helicase 2              58.2    1e-06   
ref|XP_009324264.1|  PREDICTED: nucleolar RNA helicase 2-like         58.2    1e-06   
dbj|BAB26817.2|  unnamed protein product                              58.2    1e-06   
ref|XP_002284103.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.2    1e-06   
ref|NP_062426.2|  nucleolar RNA helicase 2                            58.2    1e-06   
gb|AAD43959.3|AF159131_1  nucleolar RNA helicase II/Gu                58.2    1e-06   
ref|XP_009593230.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    1e-06   
gb|AAF61690.1|AF220365_1  nucleolar RNA helicase II/Gu                58.2    1e-06   
emb|CAN60235.1|  hypothetical protein VITISV_028850                   57.8    1e-06   
dbj|BAE26522.1|  unnamed protein product                              58.2    1e-06   
gb|EKF27840.1|  nucleolar RNA helicase II, putative                   57.8    1e-06   
ref|XP_004888573.1|  PREDICTED: nucleolar RNA helicase 2              57.8    1e-06   
ref|XP_009962090.1|  PREDICTED: nucleolar RNA helicase 2-like         57.8    1e-06   
ref|XP_005907396.1|  PREDICTED: nucleolar RNA helicase 2              57.8    1e-06   
gb|KIY95427.1|  DEAD-box ATP-dependent RNA helicase 7                 56.6    1e-06   
gb|ELR47909.1|  Nucleolar RNA helicase 2                              57.8    1e-06   
ref|XP_009563565.1|  PREDICTED: nucleolar RNA helicase 2-like         57.8    1e-06   
ref|XP_006352957.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    1e-06   
gb|AAH30895.1|  Ddx21 protein                                         57.8    2e-06   
ref|XP_009787018.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    2e-06   
ref|XP_003755081.1|  PREDICTED: nucleolar RNA helicase 2              57.8    2e-06   
ref|XP_004617168.1|  PREDICTED: nucleolar RNA helicase 2              57.8    2e-06   
ref|XP_009082858.1|  PREDICTED: nucleolar RNA helicase 2-like         57.8    2e-06   
ref|XP_010221060.1|  PREDICTED: uncharacterized protein LOC104575417  57.8    2e-06   
emb|CCI10877.1|  unnamed protein product                              57.8    2e-06   
ref|XP_004769606.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   57.8    2e-06   
ref|XP_005390158.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   57.8    2e-06   
ref|XP_004769607.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   57.8    2e-06   
gb|EYU43163.1|  hypothetical protein MIMGU_mgv1a003141mg              57.4    2e-06   
ref|XP_001917975.1|  PREDICTED: nucleolar RNA helicase 2              57.8    2e-06   
gb|KDO64256.1|  hypothetical protein CISIN_1g007084mg                 57.4    2e-06   
ref|XP_005360167.1|  PREDICTED: nucleolar RNA helicase 2              57.8    2e-06   
ref|XP_005390157.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   57.8    2e-06   
ref|XP_010399212.1|  PREDICTED: nucleolar RNA helicase 2-like         57.8    2e-06   
ref|XP_007217634.1|  hypothetical protein PRUPE_ppa002643mg           57.4    2e-06   
ref|XP_008641092.1|  PREDICTED: nucleolar RNA helicase 2-like         57.4    2e-06   
gb|EYU43162.1|  hypothetical protein MIMGU_mgv1a003141mg              57.4    2e-06   
ref|XP_006181277.1|  PREDICTED: nucleolar RNA helicase 2              57.8    2e-06   
ref|XP_005326022.1|  PREDICTED: nucleolar RNA helicase 2              57.8    2e-06   
gb|ESS64587.1|  nucleolar RNA helicase II                             57.4    2e-06   
ref|XP_004583494.1|  PREDICTED: nucleolar RNA helicase 2              57.8    2e-06   
ref|XP_006212998.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_007167837.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
gb|KDO64254.1|  hypothetical protein CISIN_1g007084mg                 57.4    2e-06   
ref|XP_010984125.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_001232052.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_004326963.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_008229751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.4    2e-06   
ref|XP_007454639.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_010132216.1|  PREDICTED: nucleolar RNA helicase 2-like         57.4    2e-06   
ref|XP_002190981.2|  PREDICTED: nucleolar RNA helicase 2-like         57.4    2e-06   
ref|XP_006105393.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   57.4    2e-06   
ref|XP_007121104.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_005876873.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   57.4    2e-06   
ref|XP_421574.3|  PREDICTED: nucleolar RNA helicase 2-like            57.4    2e-06   
ref|XP_008143728.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|NP_001263383.1|  nucleolar RNA helicase 2                         57.4    2e-06   
ref|XP_006915628.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_005876874.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   57.4    2e-06   
ref|XP_010074102.1|  PREDICTED: nucleolar RNA helicase 2-like         57.4    2e-06   
ref|XP_006760985.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_011370452.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_005978742.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_005657444.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_004280850.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
gb|ETE62473.1|  Nucleolar RNA helicase 2                              57.4    2e-06   
gb|EKF99205.1|  nucleolar RNA helicase II, putative                   57.4    2e-06   
ref|XP_006105394.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   57.4    2e-06   
ref|NP_001076996.1|  nucleolar RNA helicase 2                         57.4    2e-06   
ref|XP_006273541.1|  PREDICTED: nucleolar RNA helicase 2-like iso...  57.4    2e-06   
ref|XP_005699183.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_010850502.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_006060385.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
gb|KDO64255.1|  hypothetical protein CISIN_1g007084mg                 57.0    2e-06   
gb|ERZ97705.1|  hypothetical protein GLOINDRAFT_340006                57.4    2e-06   
ref|XP_004427105.1|  PREDICTED: nucleolar RNA helicase 2              57.4    2e-06   
ref|XP_003530710.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    2e-06   
ref|XP_008924437.1|  PREDICTED: nucleolar RNA helicase 2-like         57.4    2e-06   
gb|KHM99686.1|  DEAD-box ATP-dependent RNA helicase 53                57.0    2e-06   
ref|XP_005070876.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1   57.4    2e-06   
ref|XP_008674301.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    2e-06   
ref|XP_009484668.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  57.0    2e-06   
ref|XP_005070877.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2   57.4    2e-06   
ref|XP_009635265.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    2e-06   
ref|XP_009388962.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    2e-06   
ref|XP_009806451.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    2e-06   
ref|XP_010293567.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    2e-06   
ref|WP_043660202.1|  RNA helicase                                     57.0    2e-06   
ref|WP_009054095.1|  DNA helicase                                     57.0    2e-06   
ref|XP_010073942.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    2e-06   
gb|EPS73227.1|  hypothetical protein M569_01530                       57.0    2e-06   
ref|XP_004657939.1|  PREDICTED: nucleolar RNA helicase 2              57.0    2e-06   
gb|EUD73152.1|  adenosinetriphosphatase                               57.0    2e-06   
ref|XP_005842380.1|  hypothetical protein GUITHDRAFT_57670            57.0    3e-06   
ref|XP_005433606.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    3e-06   
ref|WP_032506293.1|  RNA helicase                                     57.0    3e-06   
dbj|BAJ89481.1|  predicted protein                                    57.0    3e-06   
ref|XP_011085434.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    3e-06   
ref|XP_002954582.1|  hypothetical protein VOLCADRAFT_82854            56.6    3e-06   
ref|XP_009967651.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    3e-06   
ref|XP_005235247.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    3e-06   
ref|XP_009993186.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    3e-06   
gb|EGF66473.1|  DEAD/DEAH box helicase                                57.0    3e-06   
ref|XP_009575208.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    3e-06   
ref|XP_005530587.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    3e-06   
gb|KDO64251.1|  hypothetical protein CISIN_1g007084mg                 57.0    3e-06   
ref|XP_009955676.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...  57.0    3e-06   
ref|XP_004491264.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    3e-06   
ref|XP_009008064.1|  PREDICTED: nucleolar RNA helicase 2              57.0    3e-06   
ref|XP_006480317.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    3e-06   
ref|XP_006480316.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    3e-06   
ref|XP_006480315.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.0    3e-06   
ref|XP_006423935.1|  hypothetical protein CICLE_v10027858mg           57.0    3e-06   
ref|XP_006423936.1|  hypothetical protein CICLE_v10027858mg           57.0    3e-06   
ref|XP_006841548.1|  hypothetical protein AMTR_s00003p00168720        57.0    3e-06   
ref|XP_009094281.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    3e-06   
gb|ERE79135.1|  nucleolar RNA helicase 2-like protein                 56.6    3e-06   
ref|WP_030609626.1|  DEAD/DEAH box helicase                           56.6    3e-06   
ref|WP_009647275.1|  DNA helicase                                     56.6    3e-06   
ref|XP_010113956.1|  PREDICTED: nucleolar RNA helicase 2-like         57.0    3e-06   
ref|XP_003557638.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    3e-06   
ref|XP_010258650.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    3e-06   
ref|XP_008113403.1|  PREDICTED: nucleolar RNA helicase 2              57.0    3e-06   
ref|XP_010187643.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    3e-06   
ref|XP_006429692.1|  hypothetical protein CICLE_v10013510mg           56.6    3e-06   
ref|XP_005154050.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    3e-06   
gb|KJB75399.1|  hypothetical protein B456_012G039900                  56.6    3e-06   
ref|WP_040895679.1|  DNA helicase                                     56.6    3e-06   
ref|XP_005429045.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    3e-06   
ref|WP_043270905.1|  hypothetical protein                             56.6    3e-06   
ref|XP_005530565.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    3e-06   
ref|XP_008380050.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    3e-06   
ref|XP_007524245.1|  PREDICTED: nucleolar RNA helicase 2              56.6    3e-06   
ref|XP_008348328.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    3e-06   
ref|XP_010604184.1|  PREDICTED: nucleolar RNA helicase 2              56.6    3e-06   
ref|XP_010198067.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    3e-06   
ref|WP_019160005.1|  hypothetical protein                             56.6    3e-06   
ref|WP_034465517.1|  DNA helicase                                     56.6    3e-06   
ref|WP_016461421.1|  hypothetical protein                             56.6    3e-06   
emb|CCI44343.1|  unnamed protein product                              56.6    3e-06   
ref|XP_004303914.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    3e-06   
ref|XP_005048018.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    3e-06   
ref|XP_005713628.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-li...  56.6    4e-06   
ref|XP_001561829.1|  putative nucleolar RNA helicase II               56.6    4e-06   
ref|XP_010126598.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    4e-06   
ref|XP_008495910.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    4e-06   
ref|XP_005048019.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    4e-06   
ref|XP_009892318.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    4e-06   
ref|XP_005491115.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    4e-06   
ref|XP_010532528.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  56.6    4e-06   
gb|EGL44445.1|  DEAD/DEAH box helicase                                54.7    4e-06   
ref|XP_008495911.1|  PREDICTED: nucleolar RNA helicase 2-like         56.6    4e-06   
ref|XP_002718616.1|  PREDICTED: nucleolar RNA helicase 2              56.6    4e-06   
emb|CCA23433.1|  DEAD/DEAH box RNA helicase putative                  56.6    4e-06   
ref|XP_002610327.1|  hypothetical protein BRAFLDRAFT_144535           56.6    4e-06   
ref|WP_024331250.1|  DNA helicase                                     56.2    4e-06   



>gb|EYU19497.1| hypothetical protein MIMGU_mgv1a002250mg [Erythranthe guttata]
Length=695

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EDP A++NFRISKPL++ALKAKGIESLF IQAMTF  VLDG+D+VGRARTGQGKTLAF
Sbjct  116  EDPNAVSNFRISKPLKDALKAKGIESLFPIQAMTFNLVLDGSDLVGRARTGQGKTLAF  173



>ref|XP_003536498.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=697

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            +E+++DP AI+NFRIS+PLRE LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTL
Sbjct  111  EEKKDDPNAISNFRISEPLREKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTL  170

Query  619  AF  624
            AF
Sbjct  171  AF  172



>gb|KHN02770.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=701

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            +E+++DP AI+NFRIS+PLRE LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTL
Sbjct  111  EEKKDDPNAISNFRISEPLREKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTL  170

Query  619  AF  624
            AF
Sbjct  171  AF  172



>ref|XP_003556075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=693

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  442  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  621
            E++EDP A++NFRIS+PLR+ LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLA
Sbjct  107  EKKEDPNALSNFRISEPLRQKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTLA  166

Query  622  F  624
            F
Sbjct  167  F  167



>gb|KHN15708.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=694

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +1

Query  442  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  621
            E++EDP A++NFRIS+PLR+ LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLA
Sbjct  108  EKKEDPNALSNFRISEPLRQKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTLA  167

Query  622  F  624
            F
Sbjct  168  F  168



>ref|XP_008670328.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Zea mays]
 tpg|DAA40576.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=704

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  433  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  612
            G DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG+D+VGRARTGQGK
Sbjct  114  GSDEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGK  173

Query  613  TLAF  624
            TLAF
Sbjct  174  TLAF  177



>tpg|DAA40575.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=671

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +1

Query  433  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  612
            G DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG+D+VGRARTGQGK
Sbjct  114  GSDEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGK  173

Query  613  TLAF  624
            TLAF
Sbjct  174  TLAF  177



>ref|XP_006357902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=679

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 7/69 (10%)
 Frame = +1

Query  439  DEEE-------EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  597
            DEEE       EDP A++NFRISKPL+EAL +KGIE+LF IQAMTF+ +LDG D+VGRAR
Sbjct  96   DEEEVMVEKKVEDPNALSNFRISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRAR  155

Query  598  TGQGKTLAF  624
            TGQGKTLAF
Sbjct  156  TGQGKTLAF  164



>gb|EYU25021.1| hypothetical protein MIMGU_mgv1a027128mg [Erythranthe guttata]
Length=591

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  442  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  621
            EE+E P A++NFRISKPLREALK KGIESLF IQA TF+ +L G+D+VGRARTGQGKTLA
Sbjct  7    EEDETPNAVSNFRISKPLREALKEKGIESLFPIQATTFDTILHGSDLVGRARTGQGKTLA  66

Query  622  F  624
            F
Sbjct  67   F  67



>gb|EPS64456.1| hypothetical protein M569_10323 [Genlisea aurea]
Length=693

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP AI NFRISKPLREALKAKGIE+LF IQA TF  +LDG+D+VGRARTGQGKTLAF
Sbjct  100  DPNAIVNFRISKPLREALKAKGIEALFPIQAKTFTMILDGSDLVGRARTGQGKTLAF  156



>ref|XP_004240751.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Solanum lycopersicum]
Length=683

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
            E V  +++ EDP A++NFRISKPL+EAL +KGIE+LF IQAMTF+ +LDG D+VGRARTG
Sbjct  98   EQVMVEKKVEDPNALSNFRISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRARTG  157

Query  604  QGKTLAF  624
            QGKTLAF
Sbjct  158  QGKTLAF  164



>ref|XP_009587639.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
tomentosiformis]
Length=692

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP  ++NFRISKPLREAL AKGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  118  DPNVLSNFRISKPLREALNAKGIEALFPIQAMTFDDILDGSDLVGRARTGQGKTLAF  174



>ref|XP_009767597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=692

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP  ++NFRISKPLREAL AKGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  118  DPNVLSNFRISKPLREALNAKGIEALFPIQAMTFDDILDGSDLVGRARTGQGKTLAF  174



>gb|EAZ09787.1| hypothetical protein OsI_32075 [Oryza sativa Indica Group]
Length=685

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  436  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  615
            GDE+  DP A+ NFRIS+PLRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  96   GDEDPADPNALANFRISEPLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  155

Query  616  LAF  624
            LAF
Sbjct  156  LAF  158



>ref|XP_004957391.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Setaria 
italica]
Length=708

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            DE+  DP A+TNFRIS+PLR+ LK+KGI++LF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  113  DEDPADPNALTNFRISEPLRQRLKSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGKTL  172

Query  619  AF  624
            AF
Sbjct  173  AF  174



>ref|XP_006660856.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Oryza 
brachyantha]
 gb|ABG73436.1| DEAD/DEAH box helicase family protein [Oryza brachyantha]
Length=688

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  436  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  615
            GDE+  DP A+ NFRIS+PLRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  98   GDEDPADPNALANFRISEPLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  157

Query  616  LAF  624
            LAF
Sbjct  158  LAF  160



>ref|XP_003578458.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brachypodium 
distachyon]
Length=694

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  421  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  600
            + A GGDE+  DP A+ NFRIS+PL++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  105  LTASGGDEDPADPNALANFRISEPLKQKLKSKGINALFPIQATTFGLVLDGHDLVGRART  164

Query  601  GQGKTLAF  624
            GQGKTLAF
Sbjct  165  GQGKTLAF  172



>ref|XP_002460541.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
 gb|EER97062.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
Length=711

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  115  DEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGNDLVGRARTGQGKTL  174

Query  619  AF  624
            AF
Sbjct  175  AF  176



>gb|KDO65345.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=546

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163



>ref|XP_011076505.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Sesamum indicum]
Length=1167

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +1

Query  433  GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  612
            G   E++ P A+++FRIS PL+EALK KGIESLF IQAMTF AVLDG+D+VGRARTGQGK
Sbjct  548  GVKPEDDTPNAVSSFRISNPLKEALKEKGIESLFPIQAMTFNAVLDGSDLVGRARTGQGK  607

Query  613  TLAF  624
            TLAF
Sbjct  608  TLAF  611



>ref|XP_002866477.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42736.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
Length=669

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P A++NFRIS PLRE LKAKGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAVSNFRISAPLREKLKAKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  148

Query  619  AF  624
            AF
Sbjct  149  AF  150



>gb|KDO65346.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
 gb|KDO65347.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=574

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163



>gb|KDO65344.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=620

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163



>ref|XP_011101144.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Sesamum 
indicum]
Length=701

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A++NFRIS PLREALK+KGIESLF IQAMTF  +LDG+D+VGRARTGQGKTLAF
Sbjct  120  NPNALSNFRISVPLREALKSKGIESLFPIQAMTFGMILDGSDLVGRARTGQGKTLAF  176



>gb|ACF80743.1| unknown [Zea mays]
Length=506

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  619  AF  624
            AF
Sbjct  174  AF  175



>ref|XP_006421777.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 ref|XP_006490269.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Citrus 
sinensis]
 gb|ESR35017.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 gb|KDO65343.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=695

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163



>gb|KDO65342.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=652

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104  ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163



>ref|XP_002269873.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Vitis vinifera]
Length=711

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A++NFRIS+PLRE LK+KGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  117  NPNALSNFRISEPLREKLKSKGIEALFPIQAMTFDTILDGSDLVGRARTGQGKTLAF  173



>ref|XP_010275981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Nelumbo nucifera]
Length=745

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A++NFRISK LRE LK+KGIESLF IQAMTF+ ++DG+DMVGRARTGQGKTLAF
Sbjct  154  NPNAVSNFRISKALREQLKSKGIESLFPIQAMTFDTIVDGSDMVGRARTGQGKTLAF  210



>gb|KJB39373.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=544

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167



>gb|KJB39371.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=571

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167



>ref|XP_008652955.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X3 [Zea mays]
Length=634

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  619  AF  624
            AF
Sbjct  174  AF  175



>ref|XP_008652953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Zea mays]
 tpg|DAA62342.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=707

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  619  AF  624
            AF
Sbjct  174  AF  175



>ref|XP_008652954.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Zea mays]
Length=641

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114  DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  619  AF  624
            AF
Sbjct  174  AF  175



>gb|KJB39369.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=697

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167



>gb|KJB39370.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=687

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167



>gb|KHG06829.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=695

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  106  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  165



>gb|KHG06828.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=722

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  106  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  165



>ref|XP_010940916.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=711

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  427  AVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  606
            A G +E   +P A++ FRISK LRE LK+KGIESLF IQAMTF+++LDG+D+VGRARTGQ
Sbjct  117  ARGENEGAANPNAVSKFRISKVLREKLKSKGIESLFPIQAMTFDSILDGSDLVGRARTGQ  176

Query  607  GKTLAF  624
            GKTLAF
Sbjct  177  GKTLAF  182



>ref|XP_004506292.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cicer 
arietinum]
Length=680

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +++DP A+TNFRIS+PL+  LK KGIE+LF IQAMTF  +LDG+D+VGRARTGQGKTLAF
Sbjct  100  KKDDPNAVTNFRISEPLKMKLKEKGIEALFPIQAMTFNTILDGSDLVGRARTGQGKTLAF  159



>ref|XP_006394423.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
 gb|ESQ31709.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
Length=679

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P A++ FRIS PLRE LK KGIE+LF IQAMTF+ VLDG D+VGRARTGQGKTL
Sbjct  102  DVEVDNPNAVSRFRISAPLREKLKQKGIEALFPIQAMTFDMVLDGADLVGRARTGQGKTL  161

Query  619  AF  624
            AF
Sbjct  162  AF  163



>emb|CDP05280.1| unnamed protein product [Coffea canephora]
Length=720

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 64/89 (72%), Gaps = 7/89 (8%)
 Frame = +1

Query  370  LVEPVNFkaekkkkakLMEAVGGDEE----EEDPYAITNFRISKPLREALKAKGIESLFK  537
            L EP+N   +K K   L E    DEE    EE P A+T FRIS+ LREALK KGIE LF 
Sbjct  97   LGEPMNLMKKKAK---LTEVDEDDEEKSVKEEHPNALTKFRISERLREALKVKGIEYLFP  153

Query  538  IQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  154  IQAMTFDTILDGSDLVGRARTGQGKTLAF  182



>ref|XP_004496645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Cicer arietinum]
Length=666

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +DP A++ FRIS+PLRE LK KGIESLF IQAMTF+ VL+G+D+VGRARTGQGKTLAF
Sbjct  44   DDPNAVSKFRISEPLREKLKEKGIESLFPIQAMTFDLVLNGSDLVGRARTGQGKTLAF  101



>ref|XP_002318863.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEE97083.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=687

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EDP A+T FRIS+PLREALK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAF
Sbjct  95   EDPNAVTRFRISEPLREALKKRGIEALFPIQARTFEDILNGCDLVGRARTGQGKTLAF  152



>ref|XP_004496646.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Cicer arietinum]
Length=631

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +DP A++ FRIS+PLRE LK KGIESLF IQAMTF+ VL+G+D+VGRARTGQGKTLAF
Sbjct  44   DDPNAVSKFRISEPLREKLKEKGIESLFPIQAMTFDLVLNGSDLVGRARTGQGKTLAF  101



>ref|XP_011030003.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=685

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EDP A+T FRIS+PLREALK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAF
Sbjct  95   EDPNAVTRFRISEPLREALKKRGIEALFPIQARTFEDILNGCDLVGRARTGQGKTLAF  152



>ref|NP_001063702.1| Os09g0520700 [Oryza sativa Japonica Group]
 sp|Q650T9.1|RH7_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Oryza sativa 
Japonica Group]
 dbj|BAD46678.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAF25616.1| Os09g0520700 [Oryza sativa Japonica Group]
Length=696

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  436  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  615
            GDE+  DP A+ NFRIS+ LRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  107  GDEDPADPNALANFRISESLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  166

Query  616  LAF  624
            LAF
Sbjct  167  LAF  169



>gb|EAZ45398.1| hypothetical protein OsJ_30047 [Oryza sativa Japonica Group]
Length=685

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +1

Query  436  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  615
            GDE+  DP A+ NFRIS+ LRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  96   GDEDPADPNALANFRISESLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  155

Query  616  LAF  624
            LAF
Sbjct  156  LAF  158



>ref|XP_004308148.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Fragaria vesca 
subsp. vesca]
Length=680

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +DP A+T FRIS PLR  LK KGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  105  DDPNAVTKFRISAPLRAKLKEKGIEALFSIQAMTFDTILDGSDLVGRARTGQGKTLAF  162



>ref|XP_001764376.1| predicted protein [Physcomitrella patens]
 gb|EDQ70930.1| predicted protein [Physcomitrella patens]
Length=689

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A++NF I K LR+ LKAKGIESLF IQA TFEAV DG DMVGRARTGQGKTLAF
Sbjct  108  DPMAVSNFNIGKALRDKLKAKGIESLFPIQAQTFEAVFDGNDMVGRARTGQGKTLAF  164



>sp|Q41382.1|RH7_SPIOL RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Spinacia 
oleracea]
 emb|CAA68193.1| RNA helicase [Spinacia oleracea]
Length=685

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E EDP +++NFRISKPL++ L +KGI++LF IQAMTF+ V+DG D+VGRARTGQGKTLAF
Sbjct  102  EAEDPNSLSNFRISKPLKDVLISKGIKALFPIQAMTFDNVIDGCDLVGRARTGQGKTLAF  161



>ref|XP_002510890.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF51492.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=690

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 5/90 (6%)
 Frame = +1

Query  370  LVEPVNFkaekkkkakLMEAVGGD-----EEEEDPYAITNFRISKPLREALKAKGIESLF  534
            LVEPVN K +KK K   +     D      EE+ P AI+ +RIS+ LRE LK+KGI+SLF
Sbjct  70   LVEPVNLKTKKKNKKAKIADENEDGEVETAEEDHPNAISKYRISESLREKLKSKGIQSLF  129

Query  535  KIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
             IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  130  PIQAMTFDDILDGSDLVGRARTGQGKTLAF  159



>ref|XP_007143335.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
 gb|ESW15329.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
Length=713

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A++ FRIS+PLR  LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  127  DPNAVSKFRISEPLRLKLKEKGIESLFPIQAMTFDLVLDGSDLVGRARTGQGKTLAF  183



>ref|XP_007038495.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
 gb|EOY22996.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
Length=1077

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP AI+ FRIS+ +RE LK+KGIESLF IQAMTF+ VLDGTD+VGRARTGQGKTLAF
Sbjct  481  DPNAISRFRISEAVREKLKSKGIESLFPIQAMTFDIVLDGTDLVGRARTGQGKTLAF  537



>ref|XP_010109082.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
 gb|EXC20882.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
Length=703

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 1/65 (2%)
 Frame = +1

Query  433  GGDEE-EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            GG+E+ EE P AI+ FRIS PL+  LK KGIESLF IQAMT + +LDG+D+VGRARTGQG
Sbjct  104  GGEEKSEEHPNAISKFRISAPLKAKLKEKGIESLFPIQAMTLDTILDGSDLVGRARTGQG  163

Query  610  KTLAF  624
            KTLAF
Sbjct  164  KTLAF  168



>ref|XP_009407947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=712

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D   +DP A++NFRISK LRE L +KGI++LF IQAMTF+ +LDG D+VGRARTGQGKTL
Sbjct  114  DNAADDPNALSNFRISKVLRETLNSKGIKALFPIQAMTFDLILDGFDLVGRARTGQGKTL  173

Query  619  AF  624
            AF
Sbjct  174  AF  175



>ref|XP_009628542.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Nicotiana tomentosiformis]
Length=655

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ V DG D+VGRARTGQGKTLAF
Sbjct  120  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTVFDGNDLVGRARTGQGKTLAF  175



>ref|XP_009628541.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Nicotiana tomentosiformis]
Length=691

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ V DG D+VGRARTGQGKTLAF
Sbjct  120  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTVFDGNDLVGRARTGQGKTLAF  175



>gb|KDP22369.1| hypothetical protein JCGZ_26200 [Jatropha curcas]
Length=709

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EDP A + FRIS PLRE LK++GIE+LF IQAMTF  +LDG D+VGRARTGQGKTLAF
Sbjct  120  EDPNATSKFRISLPLREKLKSRGIEALFPIQAMTFNDILDGCDLVGRARTGQGKTLAF  177



>ref|XP_009349718.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAF
Sbjct  105  KEDPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAF  163



>ref|XP_009343503.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAF
Sbjct  105  KEDPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAF  163



>ref|XP_008812489.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Phoenix 
dactylifera]
Length=718

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A++ FRISK LRE LK+KGIESLF IQAMTF  +LDG+D+VGRARTGQGKTLAF
Sbjct  134  NPNAVSKFRISKVLREKLKSKGIESLFPIQAMTFNLILDGSDLVGRARTGQGKTLAF  190



>ref|NP_201025.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 sp|Q39189.2|RH7_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Arabidopsis 
thaliana]
 dbj|BAA97183.1| RNA helicase [Arabidopsis thaliana]
 gb|AAL07216.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AAP40408.1| putative DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 gb|AED97579.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
Length=671

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P A++ FRIS PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  619  AF  624
            AF
Sbjct  149  AF  150



>ref|XP_009781160.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=682

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            P A++NFRIS PLREAL AKGI++LF IQAMTF+ + DG D+VGRARTGQGKTLAF
Sbjct  111  PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTIFDGNDLVGRARTGQGKTLAF  166



>gb|KFK27951.1| hypothetical protein AALP_AA8G452500 [Arabis alpina]
Length=683

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A++ FRIS PLRE LK KGIE+LF IQAMTF+ VLDG D+VGRARTGQGKTLAF
Sbjct  108  NPNAVSKFRISDPLREQLKKKGIEALFPIQAMTFDMVLDGADLVGRARTGQGKTLAF  164



>emb|CAA68194.1| RNA helicase [Arabidopsis thaliana]
Length=671

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P A++ FRIS PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  619  AF  624
            AF
Sbjct  149  AF  150



>ref|XP_008234340.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Prunus mume]
Length=690

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A++ FRIS+PL+  LK KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  109  DPNAVSRFRISEPLKAKLKEKGIESLFSIQAMTFDTILDGSDLVGRARTGQGKTLAF  165



>ref|XP_008376504.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Malus domestica]
Length=686

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAF
Sbjct  108  KEDPNAVSKFRISVPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAF  166



>ref|XP_007220217.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
 gb|EMJ21416.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
Length=690

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A++ FRIS+PL+  LK KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  109  DPNAVSRFRISEPLKAKLKEKGIESLFSIQAMTFDTILDGSDLVGRARTGQGKTLAF  165



>ref|XP_006348047.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=683

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            P A++NFRIS PLREAL  KGI +LF IQAMTF+ +LDG+D++GRARTGQGKTLAF
Sbjct  106  PNALSNFRISVPLREALITKGIHALFPIQAMTFDTILDGSDLIGRARTGQGKTLAF  161



>ref|XP_003592391.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES62642.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=641

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EDP  I+ F+IS+PLRE LK KGIESLF IQAMTF+ +L G D+VGRARTGQGKTLAF
Sbjct  40   EDPNGISKFKISEPLREKLKEKGIESLFPIQAMTFDIILQGCDLVGRARTGQGKTLAF  97



>ref|XP_004234150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
lycopersicum]
Length=682

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            P A++NFRIS PL+E L AKGI +LF IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  112  PNALSNFRISVPLKEVLNAKGINALFPIQAMTFDTILDGSDLVGRARTGQGKTLAF  167



>ref|XP_008467258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Cucumis melo]
Length=698

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            ++E E+P A+T FRIS+PL+  LK KGI SLF IQAMTF+ V DG+D+VGRARTGQGKTL
Sbjct  98   EKEAENPNAVTRFRISEPLKAKLKEKGISSLFPIQAMTFDTVYDGSDLVGRARTGQGKTL  157

Query  619  AF  624
            AF
Sbjct  158  AF  159



>ref|XP_009398738.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=716

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +DP A++NFRISK LRE L +KGI++LF IQAMTF+ +LDG D+VGRARTGQGKTLAF
Sbjct  122  DDPNALSNFRISKVLRETLNSKGIKALFPIQAMTFDLILDGFDLVGRARTGQGKTLAF  179



>ref|XP_009130201.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brassica rapa]
Length=667

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E+P A++ FRIS PLRE LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTLAF
Sbjct  99   ENPNAVSKFRISDPLREKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTLAF  156



>ref|XP_006858006.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
 gb|ERN19473.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
Length=722

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E +P A+ NF ISK LRE LK+KGIESLF IQAMTF+ +  GTD+VGRARTGQGKTLAF
Sbjct  132  EANPNAVVNFNISKVLREKLKSKGIESLFPIQAMTFDTIFGGTDLVGRARTGQGKTLAF  190



>ref|XP_010934579.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=720

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A++ FRIS+ LRE LK+KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAF
Sbjct  134  NPNAVSKFRISEVLREKLKSKGIESLFPIQAMTFDLILDGSDLVGRARTGQGKTLAF  190



>gb|AAF40306.1|AF156667_1 RNA helicase [Vigna radiata]
Length=713

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A++  RIS+PLR  LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  127  DPNAVSKLRISEPLRLKLKEKGIESLFPIQAMTFDLVLDGSDLVGRARTGQGKTLAF  183



>ref|XP_010458375.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010458382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Camelina sativa]
Length=679

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  95   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  154

Query  619  AF  624
            AF
Sbjct  155  AF  156



>ref|XP_010483921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=681

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  93   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  152

Query  619  AF  624
            AF
Sbjct  153  AF  154



>gb|KJB52899.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=705

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EDP  ++ FRIS+ +R+ LK+KGIESLF IQA+TF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  113  EDPNLVSRFRISEAVRKKLKSKGIESLFPIQALTFDVILDGTDLVGRARTGQGKTLAF  170



>gb|EMT03655.1| DEAD-box ATP-dependent RNA helicase 7 [Aegilops tauschii]
Length=687

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  421  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  600
            + A G +EE  DP A+ NFRIS+ L++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  95   LTASGEEEEPADPNALANFRISEKLKDKLKSKGINALFPIQATTFALVLDGNDLVGRART  154

Query  601  GQGKTLAF  624
            GQGKTLAF
Sbjct  155  GQGKTLAF  162



>ref|XP_010444062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=670

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  90   DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  149

Query  619  AF  624
            AF
Sbjct  150  AF  151



>ref|XP_010034995.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Eucalyptus 
grandis]
 gb|KCW46257.1| hypothetical protein EUGRSUZ_K00136 [Eucalyptus grandis]
Length=703

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +1

Query  436  GDEE---EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  606
            GD+E   EE+P A++NFRIS  LR  LK   IE+LF IQAMTF+ VLDGTD+VGRARTGQ
Sbjct  115  GDDEVAQEENPNAVSNFRISDSLRLKLKDNKIEALFPIQAMTFDIVLDGTDLVGRARTGQ  174

Query  607  GKTLAF  624
            GKTLAF
Sbjct  175  GKTLAF  180



>gb|KJB52898.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=704

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EDP  ++ FRIS+ +R+ LK+KGIESLF IQA+TF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  113  EDPNLVSRFRISEAVRKKLKSKGIESLFPIQALTFDVILDGTDLVGRARTGQGKTLAF  170



>ref|XP_002322430.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEF06557.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=680

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A+T FRIS+PLRE LK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAF
Sbjct  100  DPNAVTRFRISEPLREVLKKRGIEALFPIQARTFEDILNGGDLVGRARTGQGKTLAF  156



>gb|KEH26427.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=681

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +++DP A++NFRIS+PLR  LK   IE+LF IQAMTF  +LDG+D+VGRARTGQGKTLAF
Sbjct  97   KKDDPNAVSNFRISEPLRMKLKENKIEALFPIQAMTFNTILDGSDLVGRARTGQGKTLAF  156



>ref|XP_008364874.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Malus 
domestica]
Length=683

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAF
Sbjct  104  DPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAF  160



>gb|AAK62631.1| AT5g62190/mmi9_10 [Arabidopsis thaliana]
Length=671

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P A++ FRI  PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAVSKFRIPAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  619  AF  624
            AF
Sbjct  149  AF  150



>ref|XP_011041667.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=684

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A+T FRIS+PLRE LK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAF
Sbjct  98   DPNAVTRFRISEPLRETLKKRGIEALFPIQARTFEDILNGGDLVGRARTGQGKTLAF  154



>emb|CDX87236.1| BnaC09g05510D [Brassica napus]
Length=637

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  80   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  139

Query  619  AF  624
            AF
Sbjct  140  AF  141



>emb|CDY16789.1| BnaA09g05930D [Brassica napus]
Length=635

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  79   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  138

Query  619  AF  624
            AF
Sbjct  139  AF  140



>ref|XP_009112011.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
7-like [Brassica rapa]
Length=655

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  80   DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  139

Query  619  AF  624
            AF
Sbjct  140  AF  141



>ref|XP_010693660.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Beta vulgaris 
subsp. vulgaris]
Length=684

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P +++NFRISKPL++AL +KGI++LF IQAMTF+ V+DG D+V RARTGQGKTLAF
Sbjct  99   NPNSLSNFRISKPLKDALISKGIQALFPIQAMTFDIVIDGCDLVARARTGQGKTLAF  155



>ref|XP_009345013.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=858

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A+  FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAF
Sbjct  280  DPNAVLKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAF  336



>ref|XP_006279587.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
 gb|EOA12485.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
Length=668

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D E ++P AI+ FRIS  LRE LK +GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89   DVEVDNPNAISKFRISPSLREKLKERGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  148

Query  619  AF  624
            AF
Sbjct  149  AF  150



>ref|XP_004172086.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cucumis 
sativus]
 gb|KGN50393.1| hypothetical protein Csa_5G171750 [Cucumis sativus]
Length=696

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            ++E E+P A+T FRIS+PL+  L+ KGI SLF IQA TF+ V DG+D+VGRARTGQGKTL
Sbjct  98   EKEAENPNAVTQFRISEPLKAKLREKGITSLFPIQATTFDTVYDGSDLVGRARTGQGKTL  157

Query  619  AF  624
            AF
Sbjct  158  AF  159



>ref|XP_004143712.1| PREDICTED: uncharacterized protein LOC101209696 [Cucumis sativus]
Length=1247

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            ++E E+P A+T FRIS+PL+  L+ KGI SLF IQA TF+ V DG+D+VGRARTGQGKTL
Sbjct  649  EKEAENPNAVTQFRISEPLKAKLREKGITSLFPIQATTFDTVYDGSDLVGRARTGQGKTL  708

Query  619  AF  624
            AF
Sbjct  709  AF  710



>ref|XP_010555319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Tarenaya hassleriana]
Length=687

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A+T FRIS P+   LK KGI +LF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  107  NPNAVTKFRISTPVVNKLKEKGIAALFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163



>ref|XP_009346936.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=860

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A+  FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAF
Sbjct  285  AVLKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAF  338



>ref|XP_002975210.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
 gb|EFJ23995.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
Length=626

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D + E+PYA+ NFRIS  ++  L+ KGI++LF+IQA +F+ VLDG D+VGRARTGQGKTL
Sbjct  36   DIDVENPYALENFRISDAVKGMLREKGIKALFQIQAQSFDIVLDGDDLVGRARTGQGKTL  95

Query  619  AF  624
            AF
Sbjct  96   AF  97



>ref|XP_002977618.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
 gb|EFJ21622.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
Length=663

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D + E+PYA+ NFRIS  ++  L+ KGI++LF+IQA +F+ VLDG D+VGRARTGQGKTL
Sbjct  73   DIDVENPYALENFRISDAVKGMLREKGIKALFQIQAQSFDIVLDGDDLVGRARTGQGKTL  132

Query  619  AF  624
            AF
Sbjct  133  AF  134



>gb|KJB39372.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=605

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  606
            + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQ
Sbjct  108  KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQ  161



>ref|XP_010059508.1| PREDICTED: nucleolar RNA helicase 2-like [Eucalyptus grandis]
Length=584

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +EE+P A++NFRI   LR  LK  GIE+LF IQAMTF+ ++DG D+VGRA T QGKTLAF
Sbjct  218  QEENPNALSNFRILNTLRLKLKDNGIEALFPIQAMTFDIIVDGADLVGRAHTSQGKTLAF  277



>ref|XP_005854803.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
 gb|EKU21559.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
Length=737

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A++NF+IS+  R  L+A+GI+SLF IQ+MT + +LDG D++GRARTG GKTLAF
Sbjct  140  DPNALSNFKISQATRTRLEARGIKSLFPIQSMTLQKILDGCDLIGRARTGCGKTLAF  196



>ref|XP_010068038.1| PREDICTED: acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal-like 
[Eucalyptus grandis]
Length=346

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A+ NFRIS  LR  LK  GIE+LF I  MTF+ V DGTD+VGRA TGQGKTLAF
Sbjct  8    NPNAVLNFRISDSLRLKLKDNGIEALFPIHPMTFDNVHDGTDLVGRACTGQGKTLAF  64



>gb|ETK72184.1| hypothetical protein L915_20663 [Phytophthora parasitica]
Length=269

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = +1

Query  430  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  610  KTLAF  624
            KTLAF
Sbjct  155  KTLAF  159



>ref|XP_005645158.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20614.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=698

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP A+ NFR+S  ++  L+ KGIE+LF IQA T   +LDG D+VGRARTGQGKTLAF
Sbjct  102  DPLAVDNFRLSDKVKALLREKGIEALFSIQAHTLNHLLDGFDLVGRARTGQGKTLAF  158



>gb|EMS52016.1| DEAD-box ATP-dependent RNA helicase 7 [Triticum urartu]
Length=925

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  421  MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  600
            + A G +EE  DP A+ NFRIS  L++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  333  LTASGEEEEPADPNALANFRISDKLKDKLKSKGINALFPIQATTFALVLDGNDLVGRART  392

Query  601  GQGKTLAF  624
            GQGKTLAF
Sbjct  393  GQGKTLAF  400



>gb|EWM21167.1| dead deah box rna [Nannochloropsis gaditana]
Length=737

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + DP A++NF+IS+     L+A+GI+SLF IQ+MT + +LDG D++GRARTG GKTLAF
Sbjct  138  DADPNALSNFKISQATCTRLEARGIKSLFPIQSMTLQKILDGCDLIGRARTGCGKTLAF  196



>gb|ETP29814.1| hypothetical protein F442_21078 [Phytophthora parasitica P10297]
Length=684

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = +1

Query  430  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  610  KTLAF  624
            KTLAF
Sbjct  155  KTLAF  159



>ref|XP_008914911.1| hypothetical protein PPTG_18629 [Phytophthora parasitica INRA-310]
 gb|ETM99820.1| hypothetical protein PPTG_18629 [Phytophthora parasitica INRA-310]
Length=684

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = +1

Query  430  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  610  KTLAF  624
            KTLAF
Sbjct  155  KTLAF  159



>gb|ETI31844.1| hypothetical protein F443_21248 [Phytophthora parasitica P1569]
 gb|ETL25637.1| hypothetical protein L916_20525 [Phytophthora parasitica]
 gb|ETL78851.1| hypothetical protein L917_20399 [Phytophthora parasitica]
 gb|ETM32130.1| hypothetical protein L914_20404 [Phytophthora parasitica]
 gb|ETO60560.1| hypothetical protein F444_21264 [Phytophthora parasitica P1976]
 gb|ETP01634.1| hypothetical protein F441_21133 [Phytophthora parasitica CJ01A1]
Length=684

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = +1

Query  430  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  610  KTLAF  624
            KTLAF
Sbjct  155  KTLAF  159



>ref|XP_002904811.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
 gb|EEY53193.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
Length=681

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = +1

Query  430  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ ++DG D++GRARTG G
Sbjct  100  VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKIVDGKDLMGRARTGMG  155

Query  610  KTLAF  624
            KTLAF
Sbjct  156  KTLAF  160



>ref|XP_010938270.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=318

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +1

Query  475  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
             RISK LRE LK+KGIES+F IQ MTF+++ DG+++V + RTGQGKTLAF
Sbjct  84   MRISKVLREKLKSKGIESMFPIQTMTFDSIFDGSNLVCQERTGQGKTLAF  133



>ref|XP_011399479.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
 gb|KFM26541.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
Length=764

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            P+A+ NF +S PL+  L++KGIESLF IQA     +L+G D+VGRARTG GKTLAF
Sbjct  52   PHALDNFALSAPLKSMLRSKGIESLFDIQAACLTPLLEGRDLVGRARTGCGKTLAF  107



>ref|XP_005849733.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
 gb|EFN57631.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
Length=608

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  457  PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            P A+ NF++S+P++  L+AKGIE+LF IQA     +L+G D+VGRARTG GKTLAF
Sbjct  2    PLALDNFKLSEPVKSLLRAKGIEALFDIQAQCLPPLLEGQDLVGRARTGCGKTLAF  57



>ref|XP_003058076.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58027.1| predicted protein [Micromonas pusilla CCMP1545]
Length=748

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E+DP  ++NF IS+ +   L+ KGI SL+ IQA TF+ VLDG D+V RA+TG GKTLAF
Sbjct  123  EDDPLRVSNFNISREVCARLETKGITSLYGIQAQTFQHVLDGKDIVARAKTGCGKTLAF  181



>emb|CEP17128.1| hypothetical protein [Parasitella parasitica]
Length=708

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  430  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            +  DE  E+   ++NFRIS+   + LKAKGI+SLF+IQA TF+ + DG D++ RARTG G
Sbjct  84   INSDEVPEN-LRLSNFRISQGTVDNLKAKGIKSLFEIQAATFDTIFDGNDVLARARTGTG  142

Query  610  KTLAF  624
            KTLAF
Sbjct  143  KTLAF  147



>ref|XP_001417262.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95555.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=654

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE +P A+ NF +S+P++  L+ KG ++LF IQA T E  L G D+VGRARTG GKTLAF
Sbjct  78   EEPNPLALDNFALSEPVKATLRKKGFDALFAIQAETLEIALSGKDVVGRARTGCGKTLAF  137



>emb|CDS09503.1| hypothetical protein LRAMOSA10863 [Absidia idahoensis var. thermophila]
Length=681

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 50/71 (70%), Gaps = 2/71 (3%)
 Frame = +1

Query  418  LMEAVGGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  591
            ++E  G   EE+ P    ++ FRIS+   E L+A+GI+SLF IQA TF+++ DG D++ R
Sbjct  64   VVEETGKHNEEDVPEHLKLSKFRISQGTVENLEARGIKSLFDIQAATFDSIFDGNDVLAR  123

Query  592  ARTGQGKTLAF  624
            ARTG GKTLAF
Sbjct  124  ARTGTGKTLAF  134



>dbj|GAN03042.1| nucleolar RNA helicase 2-like isoform X2 [Mucor ambiguus]
Length=705

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  466  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            ++NFRIS+   + L+AKGI+SLF+IQA TF+ + DG D++ RARTG GKTLAF
Sbjct  90   LSNFRISQGTIDNLEAKGIKSLFEIQAATFDTIFDGNDVLARARTGTGKTLAF  142



>gb|EPB89647.1| hypothetical protein HMPREF1544_03579 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=704

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +1

Query  466  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            ++NFRIS+   + L+AKGI+SLF+IQA TF+ + DG D++ RARTG GKTLAF
Sbjct  92   LSNFRISQGTIDNLEAKGIKSLFEIQAATFDTIFDGNDVLARARTGTGKTLAF  144



>emb|CDH59679.1| nucleolar rna helicase 2-like [Lichtheimia corymbifera JMRC:FSU:9682]
Length=684

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +1

Query  418  LMEAVGGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  591
            ++E  G  E+++ P    ++ FRIS+   E L+A+GI+SLF IQA TF+++ DG D++ R
Sbjct  64   VVEESGKHEDDQVPEHLQLSKFRISQGTVENLEARGIKSLFDIQAATFDSIFDGNDVLAR  123

Query  592  ARTGQGKTLAF  624
            ARTG GKTLAF
Sbjct  124  ARTGTGKTLAF  134



>ref|XP_002507890.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69148.1| predicted protein [Micromonas sp. RCC299]
Length=631

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
            EA  GD   ++ + ++NF +SK +   L+ KGI SL+ IQA  F+ +LDG D+VGRARTG
Sbjct  15   EASDGDASVDENH-VSNFNLSKEVCARLETKGITSLYSIQAQCFQPILDGKDLVGRARTG  73

Query  604  QGKTLAF  624
             GKTLAF
Sbjct  74   CGKTLAF  80



>emb|CEG79803.1| hypothetical protein RMATCC62417_14224 [Rhizopus microsporus]
Length=476

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG GKTLAF
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTGTGKTLAF  128



>ref|XP_009837773.1| hypothetical protein H257_12310 [Aphanomyces astaci]
 gb|ETV72987.1| hypothetical protein H257_12310 [Aphanomyces astaci]
Length=683

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            ED   ++NFRIS    + L+ +GI +LF IQAMTF+++ D  D++GRARTG GKTLAF
Sbjct  87   EDNPPLSNFRISAATIDNLEKRGIPTLFPIQAMTFDSIYDKKDLIGRARTGMGKTLAF  144



>gb|EIE87311.1| hypothetical protein RO3G_12022 [Rhizopus delemar RA 99-880]
Length=665

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A++NFRIS+   E L+ KGI SLF+IQA TF+ + DG D++ RARTG GKTLAF
Sbjct  70   ALSNFRISEGTIENLEKKGISSLFEIQAATFDTIYDGKDVLARARTGTGKTLAF  123



>emb|CEI86541.1| hypothetical protein RMCBS344292_00980 [Rhizopus microsporus]
Length=674

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            D   ++NFRIS+   + L+ KGI+SLF+IQA TF+ + DG D++ RARTG GKTLAF
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFEIQAATFDTIFDGKDVLARARTGTGKTLAF  128



>ref|XP_004300425.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Fragaria 
vesca subsp. vesca]
Length=329

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE P A++ FRIS+PLR  LK +GI+SL  IQA TF+ +LDG D++ +A   Q KTLAF
Sbjct  70   EETPNAVSKFRISEPLRAKLKERGIKSLSPIQARTFDTILDGFDLLAQAPADQDKTLAF  128



>emb|CBK20101.2| unnamed protein product [Blastocystis hominis]
Length=553

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E E  YA+  +RIS      L +KGI  LF IQA++F+A+ DG D++GRA TGQGKTLAF
Sbjct  10   ESESLYAMHRYRISPETIGILHSKGITELFPIQALSFDAIYDGKDLIGRAPTGQGKTLAF  69



>emb|CEG65973.1| hypothetical protein RMATCC62417_02639 [Rhizopus microsporus]
Length=674

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG GKTLAF
Sbjct  72   DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTGTGKTLAF  128



>ref|XP_007512398.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16998.1| predicted protein [Bathycoccus prasinos]
Length=689

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            D    +P A+ NF +S  +  AL+ KGI++LF IQA T +  L G D+VGRARTG GKTL
Sbjct  75   DARTPNPLALENFSLSPEVVSALQKKGIDALFAIQAQTLDTALSGKDIVGRARTGCGKTL  134

Query  619  AF  624
            AF
Sbjct  135  AF  136



>ref|XP_003078811.1| putative RNA helicase (ISS) [Ostreococcus tauri]
 emb|CAL51691.1| Helicase, C-terminal [Ostreococcus tauri]
Length=693

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = +1

Query  445  EEEDPYAITNFR-ISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  621
            EE +P A+ NF+ ++ P++  L+ KG ++LF+IQA T E  L G D+VGRARTG GKTLA
Sbjct  75   EEPNPLALDNFKGLTDPVKTTLRKKGYDALFQIQAETLEIALGGRDVVGRARTGCGKTLA  134

Query  622  F  624
            F
Sbjct  135  F  135



>ref|XP_008364905.1| PREDICTED: uncharacterized protein LOC103428569 [Malus domestica]
Length=206

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  493  LREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  612
            LR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGK
Sbjct  166  LRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGK  205



>ref|XP_009496395.1| hypothetical protein H696_04240 [Fonticula alba]
 gb|KCV68824.1| hypothetical protein H696_04240 [Fonticula alba]
Length=712

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +P A+TNFRISK        + I +LF IQA T++A+ DG D++G+ARTG GKT++F
Sbjct  101  NPLALTNFRISKETVSQFAKRNITALFPIQAQTYDAIYDGKDVIGQARTGSGKTISF  157



>ref|XP_008873274.1| hypothetical protein H310_09087 [Aphanomyces invadans]
 gb|ETV98399.1| hypothetical protein H310_09087 [Aphanomyces invadans]
Length=675

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  451  EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +D   ++NFR+S    + L+ +GI +LF IQAMTF+++ D  D++GRARTG GKTLAF
Sbjct  82   DDNPPLSNFRVSAVTIKNLEKRGIATLFPIQAMTFDSIYDKKDLIGRARTGMGKTLAF  139



>ref|XP_007054740.1| PREDICTED: nucleolar RNA helicase 2-like [Chelonia mydas]
Length=681

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  105  EEEKEGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  164



>gb|EMP40574.1| Nucleolar RNA helicase 2, partial [Chelonia mydas]
Length=1143

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  574  EEEKEGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  633


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG GKT +F
Sbjct  11   AFSNFCISKETIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTGTGKTFSF  64



>ref|XP_006630629.1| PREDICTED: nucleolar RNA helicase 2-like [Lepisosteus oculatus]
Length=777

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRISK   + L+A+G+  LF IQ  TF+ V DG D+VG+ARTG GKT +F
Sbjct  184  AFSNFRISKETIQLLQARGVTYLFDIQVKTFDFVFDGNDVVGQARTGTGKTFSF  237



>ref|XP_005297367.1| PREDICTED: nucleolar RNA helicase 2 [Chrysemys picta bellii]
Length=813

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  237  EEEREGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  296



>ref|XP_010887236.1| PREDICTED: nucleolar RNA helicase 2-like [Esox lucius]
Length=766

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E+   A +NFRIS    + L+A+GI  LF IQ  TF +V DG D++G+ARTG GKTLAF
Sbjct  160  EQKSGAFSNFRISPNTIKLLEARGISFLFDIQTQTFNSVYDGKDVIGQARTGTGKTLAF  218



>emb|CCA17723.1| DEAD/DEAH box RNA helicase putative [Albugo laibachii Nc14]
 emb|CCA18369.1| DEAD/DEAH box RNA helicase putative [Albugo laibachii Nc14]
Length=660

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            ++ +F I    ++ LK  GI +LF IQAMTF+ ++DG +++GRARTG GKTLAF
Sbjct  96   SLDDFAICAQTKKNLKKHGIANLFPIQAMTFDKIMDGNNLIGRARTGMGKTLAF  149



>ref|XP_006273547.1| PREDICTED: nucleolar RNA helicase 2-like [Alligator mississippiensis]
Length=692

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF ISK   E LKA+G++ LF IQA TF+ + DG DM+ +ARTG GKT +F
Sbjct  128  AFSNFSISKETAELLKARGVKYLFSIQAKTFQPIYDGKDMIVQARTGTGKTFSF  181



>ref|XP_010789411.1| PREDICTED: nucleolar RNA helicase 2-like [Notothenia coriiceps]
Length=275

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRIS+   + LKA+G+  LF IQ+ TF +V DG D++ +ARTG GKT +F
Sbjct  156  AFSNFRISQVTIDKLKARGVTYLFDIQSKTFNSVFDGEDVIAQARTGTGKTFSF  209



>ref|XP_002502509.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
 gb|ACO63767.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
Length=790

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
             + DP  + NF +S   + AL+ +GIE+LF IQA   E  L G D+VGRARTG GKTL F
Sbjct  128  NKRDPMHVDNFPLSDITKAALRKRGIETLFPIQASVLEPALQGRDVVGRARTGTGKTLGF  187



>ref|XP_009520796.1| hypothetical protein PHYSODRAFT_326516 [Phytophthora sojae]
 gb|EGZ25508.1| hypothetical protein PHYSODRAFT_326516 [Phytophthora sojae]
Length=962

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +1

Query  430  VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            VGG    E+P  + +F I     + LKA+GI +LF IQAMTF+ +L G D++GRARTG G
Sbjct  94   VGG---TENP-PLESFDICAETVKNLKARGIHTLFPIQAMTFDKILAGKDLMGRARTGMG  149

Query  610  KTLAF  624
            KTLAF
Sbjct  150  KTLAF  154



>ref|NP_001120807.1| nucleolar RNA helicase 2 [Danio rerio]
 gb|AAI60629.1| Ddx21 protein [Danio rerio]
Length=759

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 4/66 (6%)
 Frame = +1

Query  439  DEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  606
            ++E+E P     A +NFRIS    + L+A+G+  LF IQ  TF AV DG D++G+ARTG 
Sbjct  155  EQEKETPEQREGAFSNFRISPNTIKLLQARGVSYLFDIQVKTFNAVYDGKDLIGQARTGT  214

Query  607  GKTLAF  624
            GKT +F
Sbjct  215  GKTFSF  220



>emb|CDQ75565.1| unnamed protein product [Oncorhynchus mykiss]
Length=749

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRIS    + L+A+GI  LF IQ  TF +V +G D++G+ARTG GKTLAF
Sbjct  172  AFSNFRISPNTIKLLQARGISYLFDIQTQTFNSVYEGKDVIGQARTGTGKTLAF  225



>ref|XP_006125341.1| PREDICTED: nucleolar RNA helicase 2 [Pelodiscus sinensis]
Length=728

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EEE   A +NF ISK   E LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  154  EEEKEGAFSNFSISKETIELLKARGVKYLFSVQVKTFQPIYDGKDVIAQARTGTGKTFSF  213



>emb|CEI94647.1| hypothetical protein RMCBS344292_08852 [Rhizopus microsporus]
Length=694

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG GKTLAF
Sbjct  230  DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTGTGKTLAF  286



>gb|ACH85363.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Salmo salar]
Length=611

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRIS    + L+A+GI  LF IQ  TF +V +G D++G+ARTG GKTLAF
Sbjct  34   AFSNFRISPNTIKLLQARGISYLFDIQTQTFNSVYEGKDVIGQARTGTGKTLAF  87



>ref|XP_003056927.1| DEAD/DEAH box RNA helicase [Micromonas pusilla CCMP1545]
 gb|EEH58572.1| DEAD/DEAH box RNA helicase [Micromonas pusilla CCMP1545]
Length=803

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +  DP  I NF IS   + AL+ +GIESLF IQ+      L+G D+VGRARTG GKTL F
Sbjct  139  KNSDPNHIDNFPISVLTKAALRKRGIESLFPIQSAVLAPALEGRDIVGRARTGTGKTLGF  198



>ref|XP_002112077.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
 gb|EDV26044.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
Length=633

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  475  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            FRIS  + ++LK +GI  LF IQA TF+ V DG D++G+ARTG GKTL+F
Sbjct  57   FRISSAIADSLKERGITYLFPIQAQTFDYVYDGQDVIGQARTGTGKTLSF  106



>ref|XP_005838835.1| hypothetical protein GUITHDRAFT_102470 [Guillardia theta CCMP2712]
 gb|EKX51855.1| hypothetical protein GUITHDRAFT_102470 [Guillardia theta CCMP2712]
Length=589

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +I NFRIS+   +AL  +GI++LF IQ  TF+ + +G D++ RARTG GKTLAF
Sbjct  138  SIRNFRISEKTIKALSEQGIQTLFPIQVATFDIIYEGYDLIARARTGTGKTLAF  191



>ref|XP_006820781.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Saccoglossus 
kowalevskii]
Length=707

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +EE   A +NFR+S     +LKA+ I  LF IQA TF+ V DG D++ +ARTG GKTLAF
Sbjct  120  KEEKAGAFSNFRLSPQTIASLKARSITHLFPIQAKTFDYVYDGHDVIAQARTGTGKTLAF  179



>ref|XP_002738237.2| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Saccoglossus 
kowalevskii]
Length=708

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +EE   A +NFR+S     +LKA+ I  LF IQA TF+ V DG D++ +ARTG GKTLAF
Sbjct  121  KEEKAGAFSNFRLSPQTIASLKARSITHLFPIQAKTFDYVYDGHDVIAQARTGTGKTLAF  180



>ref|XP_009309382.1| putative nucleolar RNA helicase II [Trypanosoma grayi]
 gb|KEG12393.1| putative nucleolar RNA helicase II [Trypanosoma grayi]
Length=648

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  469  TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            T+F IS    +AL+++GIE+LF +QA+T+EA++ GTD++ +ARTG GKTLAF
Sbjct  59   TDFGISDGTVKALRSQGIETLFPVQALTYEAIMKGTDVLVQARTGSGKTLAF  110



>ref|XP_001702450.1| RNA helicase [Chlamydomonas reinhardtii]
 gb|EDO96945.1| RNA helicase [Chlamydomonas reinhardtii]
Length=737

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +1

Query  466  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +  F++S+ ++  L+++ IESLF IQAMT E  ++G D+VGRARTG GKTLAF
Sbjct  106  LDRFKLSEQVKSMLRSQNIESLFPIQAMTLEPAMEGLDVVGRARTGCGKTLAF  158



>ref|XP_005815128.1| PREDICTED: nucleolar RNA helicase 2-like [Xiphophorus maculatus]
Length=745

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRISK   + LKA+G+  LF IQ  +F AV DG D++ +ARTG GKT +F
Sbjct  160  AFSNFRISKVTIDKLKARGVTYLFDIQVKSFNAVYDGEDVIAQARTGTGKTFSF  213



>ref|XP_007549868.1| PREDICTED: nucleolar RNA helicase 2-like [Poecilia formosa]
Length=743

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRISK   + LKA+G+  LF IQ  +F AV DG D++ +ARTG GKT +F
Sbjct  160  AFSNFRISKVTIDKLKARGVTYLFDIQVKSFNAVYDGEDVIAQARTGTGKTFSF  213



>ref|XP_005733301.1| PREDICTED: nucleolar RNA helicase 2-like [Pundamilia nyererei]
Length=754

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +1

Query  442  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  149  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  208

Query  610  KTLAF  624
            KT +F
Sbjct  209  KTFSF  213



>ref|XP_005467227.1| PREDICTED: nucleolar RNA helicase 2-like [Oreochromis niloticus]
Length=757

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +1

Query  442  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  150  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  209

Query  610  KTLAF  624
            KT +F
Sbjct  210  KTFSF  214



>ref|XP_008290699.1| PREDICTED: nucleolar RNA helicase 2-like [Stegastes partitus]
Length=754

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 4/65 (6%)
 Frame = +1

Query  442  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            E+EE P     A +NFRIS+   + LKA+G+  LF IQ  TF+ V DG D++ +ARTG G
Sbjct  152  EKEETPEQREGAFSNFRISQVTIDKLKARGVSYLFDIQVKTFDPVYDGEDVIAQARTGTG  211

Query  610  KTLAF  624
            KT +F
Sbjct  212  KTFSF  216



>ref|XP_005915179.1| PREDICTED: nucleolar RNA helicase 2-like [Haplochromis burtoni]
Length=796

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +1

Query  442  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  190  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  249

Query  610  KTLAF  624
            KT +F
Sbjct  250  KTFSF  254



>ref|XP_004539930.1| PREDICTED: nucleolar RNA helicase 2-like [Maylandia zebra]
Length=797

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +1

Query  442  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  191  ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  250

Query  610  KTLAF  624
            KT +F
Sbjct  251  KTFSF  255



>ref|XP_006406182.1| hypothetical protein EUTSA_v10020290mg [Eutrema salsugineum]
 gb|ESQ47635.1| hypothetical protein EUTSA_v10020290mg [Eutrema salsugineum]
Length=632

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  370  LVEPVNFkaekkkkakLMEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAM  549
            +V P  F   +     + ++        D  AI+   IS  + +ALK+KGIE LF IQ  
Sbjct  85   MVSPAGFAISESSDRGIGDSESVGSSSADGLAISELGISPEIVKALKSKGIEKLFPIQKA  144

Query  550  TFEAVLDGTDMVGRARTGQGKTLAF  624
              E  + G DM+GRARTG GKTLAF
Sbjct  145  VLEPAMQGRDMIGRARTGTGKTLAF  169



>emb|CDY46329.1| BnaC01g31630D [Brassica napus]
Length=549

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
             A+   E   D  AI    IS  + +AL AKGIE LF IQ    E  + G DM+GRARTG
Sbjct  92   RAIADSESSGDGLAIAELGISPEIVKALSAKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  151

Query  604  QGKTLAF  624
             GKTLAF
Sbjct  152  TGKTLAF  158



>ref|XP_002883355.1| hypothetical protein ARALYDRAFT_479746 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59614.1| hypothetical protein ARALYDRAFT_479746 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  442  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  621
            + E D  AI+   IS  + +AL +KGIE LF IQ    E  ++G DM+GRARTG GKTLA
Sbjct  95   DSESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLA  154

Query  622  F  624
            F
Sbjct  155  F  155



>ref|NP_188872.2| putative mitochondrial RNA helicase 2 [Arabidopsis thaliana]
 sp|Q9LUW5.1|RH53_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 53 [Arabidopsis 
thaliana]
 dbj|BAB01770.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAL32580.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM13255.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AEE76622.1| putative mitochondrial RNA helicase 2 [Arabidopsis thaliana]
Length=616

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 5/67 (7%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
            E+VGGD       AI+   IS  + +AL +KGIE LF IQ    E  ++G DM+GRARTG
Sbjct  97   ESVGGDG-----LAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMEGRDMIGRARTG  151

Query  604  QGKTLAF  624
             GKTLAF
Sbjct  152  TGKTLAF  158



>gb|KCW88483.1| hypothetical protein EUGRSUZ_A00875 [Eucalyptus grandis]
Length=435

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  370  LVEPVNFkaekkkkakLMEAVGGDEE---EEDPYAITNFRISKPLREALKAKGIESLFKI  540
            LV+P N K +KKKK K      GD+E   EE+P  ++NFRIS  LR  LK  GI++LF I
Sbjct  97   LVDPENLKGKKKKKKKKTRLSDGDDEVAQEENPTVVSNFRISDSLRLKLKDNGIDALFPI  156

Query  541  QAMTFEAVLDGTDMV  585
            Q M F+ VLDGTD+V
Sbjct  157  QTMRFDIVLDGTDLV  171



>ref|XP_006023203.1| PREDICTED: nucleolar RNA helicase 2-like [Alligator sinensis]
Length=689

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF ISK   E LKA+G++ LF IQA TF+ + DG DM+ +ARTG GKT +F
Sbjct  127  AFSNFSISKETAELLKARGVKYLFSIQAKTFQPIYDGKDMIAQARTGTGKTFSF  180



>ref|XP_006297190.1| hypothetical protein CARUB_v10013195mg [Capsella rubella]
 gb|EOA30088.1| hypothetical protein CARUB_v10013195mg [Capsella rubella]
Length=636

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
            E V GD E  D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG
Sbjct  91   ERVIGDSES-DGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTG  149

Query  604  QGKTLAF  624
             GKTLAF
Sbjct  150  TGKTLAF  156



>ref|XP_006780037.1| PREDICTED: nucleolar RNA helicase 2-like [Neolamprologus brichardi]
Length=794

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +1

Query  442  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  189  ETEETPEQKEGAFSNFRISKVTIDKLKARGVAYLFDIQVKTFNHVYDGEDVIAQARTGTG  248

Query  610  KTLAF  624
            KT +F
Sbjct  249  KTFSF  253



>emb|CDY10634.1| BnaA05g17280D [Brassica napus]
Length=602

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
            E+VG      D  AI+   IS  + +AL  +GI+ LF IQ    E  + G DM+GRARTG
Sbjct  103  ESVGSSSNGGDGLAISELGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIGRARTG  162

Query  604  QGKTLAF  624
             GKTLAF
Sbjct  163  TGKTLAF  169



>ref|XP_009145390.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9 [Brassica rapa]
Length=602

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
            E+VG      D  AI+   IS  + +AL  +GI+ LF IQ    E  + G DM+GRARTG
Sbjct  103  ESVGSSSNGGDGLAISELGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIGRARTG  162

Query  604  QGKTLAF  624
             GKTLAF
Sbjct  163  TGKTLAF  169



>ref|XP_007253243.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Astyanax 
mexicanus]
Length=777

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF+IS+   + L+A+G+  LF IQ  TF  V DG D++G+ARTG GKT +F
Sbjct  173  AFSNFKISQKTIQLLQARGVTYLFDIQVKTFNPVYDGKDVIGQARTGTGKTFSF  226



>ref|XP_007253242.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Astyanax 
mexicanus]
Length=737

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF+IS+   + L+A+G+  LF IQ  TF  V DG D++G+ARTG GKT +F
Sbjct  133  AFSNFKISQKTIQLLQARGVTYLFDIQVKTFNPVYDGKDVIGQARTGTGKTFSF  186



>ref|XP_010753600.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Larimichthys 
crocea]
 ref|XP_010753601.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Larimichthys 
crocea]
Length=754

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRIS+   + LKA+G+  LF IQ  TF  V DG D++ +ARTG GKT +F
Sbjct  157  AFSNFRISQVTIDKLKARGVSYLFDIQVKTFNPVYDGEDVIAQARTGTGKTFSF  210



>ref|XP_003079318.1| ATP-dependent RNA helicase (ISS) [Ostreococcus tauri]
Length=683

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + DP  + NF +S+   +AL+ +G+++LF IQ       +DG D+VGRARTG GKTLAF
Sbjct  21   DADPADVDNFGMSETTVQALRKRGVDALFPIQQAVLRPAMDGQDVVGRARTGTGKTLAF  79



>ref|XP_010511255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Camelina sativa]
Length=640

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  94   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  152



>emb|CEF97957.1| Helicase, C-terminal [Ostreococcus tauri]
Length=765

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            + DP  + NF +S+   +AL+ +G+++LF IQ       +DG D+VGRARTG GKTLAF
Sbjct  98   DADPADVDNFGMSETTVQALRKRGVDALFPIQQAVLRPAMDGQDVVGRARTGTGKTLAF  156



>ref|XP_010511251.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Camelina sativa]
Length=616

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  94   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  152



>ref|XP_008611506.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
 gb|EQC35222.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
Length=662

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  466  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +++FR+      AL+ +GI +LF IQ+MTF+ + D  D++GRARTG GKTLAF
Sbjct  82   VSDFRVGDITIAALEKRGISTLFPIQSMTFDKIYDEFDLIGRARTGMGKTLAF  134



>ref|XP_010488258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 isoform X2 
[Camelina sativa]
Length=628

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  97   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  155



>ref|XP_010488257.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 isoform X1 
[Camelina sativa]
Length=638

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E D  AI+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  97   ESDGLAISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  155



>gb|KDO19871.1| hypothetical protein SPRG_14901 [Saprolegnia parasitica CBS 223.65]
Length=648

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  466  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +++FR+      AL+ +GI +LF IQ+MTF+ + D  D++GRARTG GKTLAF
Sbjct  83   VSDFRVGDITIAALEKRGISTLFPIQSMTFDKIYDEFDLIGRARTGMGKTLAF  135



>ref|XP_006297246.1| hypothetical protein CARUB_v10013251mg [Capsella rubella]
 gb|EOA30144.1| hypothetical protein CARUB_v10013251mg [Capsella rubella]
Length=609

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  119  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  172



>ref|XP_011406566.1| PREDICTED: ATP-dependent RNA helicase DDX50-like [Amphimedon 
queenslandica]
Length=371

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  475  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +RISK  R+ LK++GI  LF IQ  TF+ + D  D++G+ARTG GKTL+F
Sbjct  44   YRISKVSRKTLKSRGITHLFPIQYKTFDPIYDNKDVIGQARTGTGKTLSF  93



>ref|XP_010488255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X2 [Camelina sativa]
Length=594

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  120  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  173



>ref|XP_010488254.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X1 [Camelina sativa]
Length=606

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            AI+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  120  AISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  173



>ref|XP_002955657.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
 gb|EFJ43297.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
Length=727

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +1

Query  466  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +  F +S+ ++  L+++ IESLF IQAMT E  L G D+VGRARTG GKTLAF
Sbjct  104  LDRFPLSEQVKSMLRSQNIESLFPIQAMTLEPGLAGVDVVGRARTGCGKTLAF  156



>ref|XP_003976441.1| PREDICTED: nucleolar RNA helicase 2-like [Takifugu rubripes]
Length=713

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRIS      LKA+G+  LF IQ  TF++V DG D++ +ARTG GKT +F
Sbjct  131  AFSNFRISPVTINKLKARGVSYLFDIQVKTFDSVYDGEDVIAQARTGTGKTFSF  184



>gb|KFK39521.1| hypothetical protein AALP_AA3G255300 [Arabis alpina]
Length=606

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            D  AI+   IS  + +ALK +GIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  117  DGLAISELGISPEIVKALKGRGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  173



>gb|KFH66922.1| hypothetical protein MVEG_07447 [Mortierella verticillata NRRL 
6337]
Length=687

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +1

Query  433  GGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  606
            G   E E P    +T+++IS    +AL  +GI+SLF IQA  F  + +G D++GRARTG 
Sbjct  104  GATVENEIPENLRLTSYKISLSTVDALAKRGIKSLFPIQAEVFNPIYNGNDVLGRARTGT  163

Query  607  GKTLAF  624
            GKTLAF
Sbjct  164  GKTLAF  169



>ref|XP_009108947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Brassica 
rapa]
Length=617

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
             A+   E   D  AI    IS  + +AL AKGIE LF IQ    E    G DM+GRARTG
Sbjct  88   RAIADSESSGDGLAIAELGISPEIVKALSAKGIEKLFPIQKAVLEPATQGRDMIGRARTG  147

Query  604  QGKTLAF  624
             GKTLAF
Sbjct  148  TGKTLAF  154



>ref|NP_188870.1| DEAD-box ATP-dependent RNA helicase [Arabidopsis thaliana]
 sp|Q9LUW6.1|RH9_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 9 [Arabidopsis 
thaliana]
 dbj|BAB01768.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM14042.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AEE76620.1| DEAD-box ATP-dependent RNA helicase [Arabidopsis thaliana]
Length=610

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            AI +  IS  + +ALK +GIE LF IQ    E  ++G DM+GRARTG GKTLAF
Sbjct  117  AIADLGISPEIVKALKGRGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLAF  170



>ref|XP_010466510.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Camelina 
sativa]
Length=605

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            AI+   IS  + ++LKA+GIE LF IQ    E  ++G DM+GRARTG GKTLAF
Sbjct  119  AISELGISPEIVKSLKARGIEKLFPIQKAVLEPAMEGRDMIGRARTGTGKTLAF  172



>gb|EPY22928.1| nucleolar RNA helicase II [Strigomonas culicis]
 gb|EPY23267.1| nucleolar RNA helicase II [Strigomonas culicis]
Length=672

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  475  FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            F ++  + +ALKAKGI++LF +QA+TF+A++ G D++ +ARTG GKTLAF
Sbjct  87   FDLTADMVKALKAKGIDALFPVQALTFDAIMKGKDVLVQARTGSGKTLAF  136



>ref|XP_845112.1| nucleolar RNA helicase II [Trypanosoma brucei brucei TREU927]
 gb|AAX70758.1| nucleolar RNA helicase II, putative [Trypanosoma brucei]
 gb|AAX80591.1| nucleolar RNA helicase II, putative [Trypanosoma brucei]
 gb|AAZ11553.1| nucleolar RNA helicase II, putative [Trypanosoma brucei brucei 
TREU927]
 emb|CBH11456.1| nucleolar RNA helicase Gu, putative [Trypanosoma brucei gambiense 
DAL972]
Length=632

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 8/75 (11%)
 Frame = +1

Query  424  EAVGGDEEEEDP--------YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTD  579
            E  G +E +++P           + F +S  + +AL+A+GI SLF +QA+TFEA++ G D
Sbjct  25   EMTGNEETDQEPNNGSAAVGRPFSEFNLSSGMVKALEAQGIVSLFPVQALTFEAIMRGED  84

Query  580  MVGRARTGQGKTLAF  624
            ++ +ARTG GKTLAF
Sbjct  85   VLVQARTGSGKTLAF  99



>ref|XP_011490446.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Oryzias 
latipes]
Length=740

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 40/65 (62%), Gaps = 4/65 (6%)
 Frame = +1

Query  442  EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            E EE P     A +NFRIS+     LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  137  ETEETPEQKEGAFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTGTG  196

Query  610  KTLAF  624
            KT +F
Sbjct  197  KTFSF  201



>ref|XP_004067286.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Oryzias 
latipes]
Length=775

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NFRIS+     LKA+G+  LF IQ  TF  V DG D++ +ARTG GKT +F
Sbjct  183  AFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTGTGKTFSF  236



>ref|XP_010466515.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X3 [Camelina sativa]
Length=631

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  155



>ref|XP_010466514.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Camelina sativa]
Length=635

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  155



>ref|XP_010466512.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Camelina sativa]
Length=645

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E D   I+   IS  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  97   ESDGLVISELGISPEIVKALSSKGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  155



>ref|XP_004334405.1| DEAD/DEAH box helicase domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR12392.1| DEAD/DEAH box helicase domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=723

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  469  TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            ++FRIS    + L+ +G + LF IQA T++ + DG D++GRARTG GKTL+F
Sbjct  119  SDFRISPTTVKLLQDRGFKCLFAIQAQTYDHIYDGKDIIGRARTGSGKTLSF  170



>ref|XP_002461445.1| hypothetical protein SORBIDRAFT_02g002790 [Sorghum bicolor]
 gb|EER97966.1| hypothetical protein SORBIDRAFT_02g002790 [Sorghum bicolor]
Length=602

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +1

Query  424  EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  603
            E VG D   E+   I    IS  + E L A+GI  LF IQ    E  + G DM+GRARTG
Sbjct  74   EGVGVDTGAEEGLEIARLWISPRIVEKLAARGITKLFPIQRAVLEPAMQGKDMIGRARTG  133

Query  604  QGKTLAF  624
             GKTLAF
Sbjct  134  TGKTLAF  140



>ref|XP_010511242.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9 [Camelina sativa]
Length=591

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  466  ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            I+   IS  + +ALKA+GIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  120  ISELGISPEIVKALKARGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  172



>ref|XP_002883354.1| hypothetical protein ARALYDRAFT_479744 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59613.1| hypothetical protein ARALYDRAFT_479744 [Arabidopsis lyrata subsp. 
lyrata]
Length=615

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            AI+   IS  + +ALK +GIE LF IQ    E  + G DM+GRARTG GKTLAF
Sbjct  121  AISELGISPEIVKALKGRGIEKLFPIQKAVLEPAMQGRDMIGRARTGTGKTLAF  174



>emb|CBJ26838.1| DEAD box helicase [Ectocarpus siliculosus]
Length=694

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            ++  F IS+  +  L+ +GI +LF IQA TFE +  G D++GRARTG GKTLAF
Sbjct  148  SVDEFDISETTKGHLRNRGITTLFPIQAQTFEHIRRGKDLIGRARTGMGKTLAF  201



>gb|EFB22545.1| hypothetical protein PANDA_001614 [Ailuropoda melanoleuca]
Length=765

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF IS+P  + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F
Sbjct  160  AFSNFPISEPTIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSF  213



>ref|XP_002913778.1| PREDICTED: nucleolar RNA helicase 2 [Ailuropoda melanoleuca]
Length=794

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF IS+P  + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F
Sbjct  189  AFSNFPISEPTIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSF  242



>ref|XP_005708224.1| ATP-dependent RNA helicase [Galdieria sulphuraria]
 gb|EME31704.1| ATP-dependent RNA helicase [Galdieria sulphuraria]
Length=758

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  442  EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  621
            E  E P   T+F++SK + E L+ +G+     IQ+ TFE +  G D++GR+RTG GKTLA
Sbjct  184  EANETPVPFTSFQLSKKILEILEERGLRDATPIQSATFELIYSGRDIIGRSRTGTGKTLA  243

Query  622  F  624
            F
Sbjct  244  F  244



>emb|CDY37406.1| BnaC05g30240D [Brassica napus]
Length=510

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 8/72 (11%)
 Frame = +1

Query  433  GGDEEEE--------DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVG  588
            GGD EE         D  AI++  IS  + +AL  +GI+ LF IQ    E  + G DM+G
Sbjct  97   GGDSEESVGSSGDGGDGLAISDLGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIG  156

Query  589  RARTGQGKTLAF  624
            RARTG GKTLAF
Sbjct  157  RARTGTGKTLAF  168



>emb|CDY37408.1| BnaC05g30220D [Brassica napus]
Length=601

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 8/72 (11%)
 Frame = +1

Query  433  GGDEEEE--------DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVG  588
            GGD EE         D  AI++  IS  + +AL  +GI+ LF IQ    E  + G DM+G
Sbjct  97   GGDSEESVGSSGDGGDGLAISDLGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIG  156

Query  589  RARTGQGKTLAF  624
            RARTG GKTLAF
Sbjct  157  RARTGTGKTLAF  168



>ref|XP_005297366.1| PREDICTED: nucleolar RNA helicase 2-like [Chrysemys picta bellii]
Length=699

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG GKT +F
Sbjct  134  AFSNFCISKGTIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTGTGKTFSF  187



>ref|XP_009035969.1| hypothetical protein AURANDRAFT_895, partial [Aureococcus anophagefferens]
 gb|EGB09312.1| hypothetical protein AURANDRAFT_895, partial [Aureococcus anophagefferens]
Length=591

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLD-GTDMVGRARTGQGKTLAF  624
            A+ +F +S   R+AL  +GI+ LF IQA TF A+ D G D++ RARTG GKTLAF
Sbjct  1    ALGDFALSTGTRQALDKRGIKVLFPIQAATFAAIFDAGKDLLARARTGTGKTLAF  55



>ref|XP_007054739.1| PREDICTED: nucleolar RNA helicase 2-like [Chelonia mydas]
Length=678

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG GKT +F
Sbjct  113  AFSNFCISKETIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTGTGKTFSF  166



>ref|XP_006380943.1| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
 gb|ERP58740.1| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
Length=593

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +1

Query  379  PVNFkaekkkkakLMEA-VGGDEEE----EDPYAITNFRISKPLREALKAKGIESLFKIQ  543
            P++FKA    +A +  A  G DEE+    E+   I+N  ISK +  +L  KGI  LF IQ
Sbjct  72   PLDFKASSVTQAGIAVADYGSDEEKGKGSEEGLEISNLGISKEIVNSLAKKGITKLFPIQ  131

Query  544  AMTFEAVLDGTDMVGRARTGQGKTLAF  624
                E  + G DM GRARTG GKTLAF
Sbjct  132  KAVLEPAMQGKDMFGRARTGTGKTLAF  158



>ref|XP_009993187.1| PREDICTED: nucleolar RNA helicase 2-like [Chaetura pelagica]
Length=681

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF +S+   + LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  110  AFSNFPLSQNTIDLLKARGVKYLFPVQAKTFQPIYDGKDLIAQARTGTGKTFSF  163



>ref|XP_011040644.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Populus 
euphratica]
Length=593

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +1

Query  379  PVNFkaekkkkakLMEA-VGGDEEE----EDPYAITNFRISKPLREALKAKGIESLFKIQ  543
            P++FKA    +A +  A  G DEE+    E+   I+N  ISK +  +L  KGI  LF IQ
Sbjct  72   PLDFKASSVTQAGIAVADYGSDEEKVKGSEEGLEISNLGISKEIVNSLAKKGITKLFPIQ  131

Query  544  AMTFEAVLDGTDMVGRARTGQGKTLAF  624
                E  + G DM GRARTG GKTLAF
Sbjct  132  KAVLEPAMQGKDMFGRARTGTGKTLAF  158



>ref|XP_002130533.1| PREDICTED: nucleolar RNA helicase 2 [Ciona intestinalis]
Length=672

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +1

Query  439  DEEEEDPYAI---TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  609
            D +++ P A+    NFRI++  +  LK KG+  LF IQ  +F  V DG D+V +ARTG G
Sbjct  80   DIDDQSPEALGDFNNFRITEQTKVLLKKKGVAYLFPIQIQSFNHVYDGKDVVAQARTGTG  139

Query  610  KTLAF  624
            KTL+F
Sbjct  140  KTLSF  144



>ref|XP_009064553.1| hypothetical protein LOTGIDRAFT_221850 [Lottia gigantea]
 gb|ESO84752.1| hypothetical protein LOTGIDRAFT_221850 [Lottia gigantea]
Length=719

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 4/68 (6%)
 Frame = +1

Query  433  GGDEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  600
            G  EEE  P     A +NFRIS    + L+  GI  LF +Q+ TF+ V  G+D++ +ART
Sbjct  108  GKQEEELSPQQKAGAFSNFRISPNTVKKLQKNGITYLFPVQSETFDIVYSGSDIITQART  167

Query  601  GQGKTLAF  624
            G GKTLAF
Sbjct  168  GTGKTLAF  175



>ref|XP_011004482.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Populus 
euphratica]
Length=593

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +1

Query  379  PVNFkaekkkkakLMEA-VGGDEEE----EDPYAITNFRISKPLREALKAKGIESLFKIQ  543
            P++FKA    +A +  A  G DEE+    E+   I+N  ISK +  +L  KGI  LF IQ
Sbjct  72   PLDFKASSVTQAGIAVADYGSDEEKVKGSEEGLEISNLGISKEIVNSLAKKGITKLFPIQ  131

Query  544  AMTFEAVLDGTDMVGRARTGQGKTLAF  624
                E  + G DM GRARTG GKTLAF
Sbjct  132  KAVLEPAMQGKDMFGRARTGTGKTLAF  158



>ref|XP_002308835.2| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
 gb|EEE92358.2| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
Length=556

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 50/87 (57%), Gaps = 5/87 (6%)
 Frame = +1

Query  379  PVNFkaekkkkakLMEA-VGGDEEE----EDPYAITNFRISKPLREALKAKGIESLFKIQ  543
            P++FKA    +A +  A  G DEE+    E+   I+N  ISK +  +L  KGI  LF IQ
Sbjct  35   PLDFKASSVTQAGIAVADYGSDEEKGKGSEEGLEISNLGISKEIVNSLAKKGITKLFPIQ  94

Query  544  AMTFEAVLDGTDMVGRARTGQGKTLAF  624
                E  + G DM GRARTG GKTLAF
Sbjct  95   KAVLEPAMQGKDMFGRARTGTGKTLAF  121



>ref|XP_007514064.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15501.1| predicted protein [Bathycoccus prasinos]
Length=935

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  454  DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            DP +I NF +      ALK KGIE+LF IQ    E    G D+V RA+TG GKTLAF
Sbjct  218  DPTSINNFNLHPITIAALKKKGIETLFPIQVAALEPAQSGRDVVARAKTGTGKTLAF  274



>ref|XP_010295282.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Phaethon lepturus]
Length=703

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE    A TNF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  102  EEAKEGAFTNFPLSQDTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  161



>ref|XP_006676381.1| hypothetical protein BATDEDRAFT_84954 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84232.1| hypothetical protein BATDEDRAFT_84954 [Batrachochytrium dendrobatidis 
JAM81]
Length=764

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +1

Query  499  EALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            E+LKA+GI  LF IQA +F+ ++ G D++GRARTG GKTLAF
Sbjct  154  ESLKARGIVQLFPIQAASFDPIIKGMDLLGRARTGTGKTLAF  195



>ref|XP_005235246.1| PREDICTED: nucleolar RNA helicase 2-like [Falco peregrinus]
Length=670

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE    A +NF +S+     LKA+GI+ LF +Q  TF+ + DG D++ +ARTG GKT AF
Sbjct  93   EEAKEGAFSNFPLSQNTINLLKARGIKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFAF  152



>ref|XP_005433605.1| PREDICTED: nucleolar RNA helicase 2-like [Falco cherrug]
Length=675

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE    A +NF +S+     LKA+GI+ LF +Q  TF+ + DG D++ +ARTG GKT AF
Sbjct  98   EEAKEGAFSNFPLSQNTINLLKARGIKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFAF  157



>ref|XP_009990339.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Tauraco erythrolophus]
Length=581

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE    A +NF +S+     LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  4    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQAKTFQPIYDGKDLIAQARTGTGKTFSF  63



>gb|KFK39522.1| hypothetical protein AALP_AA3G255500 [Arabis alpina]
Length=622

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +1

Query  436  GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  615
            G     D  AI+   I+  + +AL +KGIE LF IQ    E  + G DM+GRARTG GKT
Sbjct  92   GRSSSGDGLAISELGIAPEIVKALSSKGIEKLFPIQKEVLEPAMQGRDMIGRARTGTGKT  151

Query  616  LAF  624
            LAF
Sbjct  152  LAF  154



>ref|XP_009674650.1| PREDICTED: nucleolar RNA helicase 2-like [Struthio camelus australis]
Length=597

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 3/69 (4%)
 Frame = +1

Query  427  AVGGDEE---EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  597
              GG EE   E    A +NF +SK     LKA+G++ LF +Q  TF+ + DG D++ +AR
Sbjct  11   CAGGPEELTEEAREGAFSNFPLSKNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQAR  70

Query  598  TGQGKTLAF  624
            TG GKT +F
Sbjct  71   TGTGKTFSF  79



>ref|XP_009919521.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Haliaeetus 
albicilla]
Length=238

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  56   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  115



>ref|XP_004344972.1| nucleolar RNA helicase 2 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95811.1| nucleolar RNA helicase 2 [Capsaspora owczarzaki ATCC 30864]
Length=793

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +1

Query  439  DEEEEDP-YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  615
            DEE ++  +A+ NF +S      L A+GI +LF IQA T+  + +G D+V +ARTG GKT
Sbjct  187  DEEADNSEFALKNFGVSATSIANLHAQGIRTLFPIQAQTYHPIFEGKDIVAQARTGSGKT  246

Query  616  LAF  624
            L+F
Sbjct  247  LSF  249



>ref|XP_001762375.1| predicted protein [Physcomitrella patens]
 gb|EDQ72842.1| predicted protein [Physcomitrella patens]
Length=689

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            ++ED  A+ N  I + + +AL  +GIE LF IQ    +  + G D++GRA+TG GKTLAF
Sbjct  42   DDEDELAVANLGIPQAVVDALAKRGIEKLFPIQRAVLDPAMQGRDLIGRAKTGTGKTLAF  101



>ref|XP_007902730.1| PREDICTED: nucleolar RNA helicase 2-like [Callorhinchus milii]
Length=735

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            +E+   A +NF+IS+   E LK +G+  LF IQ  TF  V +G D V +ARTG GKT +F
Sbjct  144  QEQREGAFSNFKISQETIELLKGRGVTYLFPIQVQTFNFVYNGQDCVAQARTGTGKTFSF  203



>gb|EDL92964.1| rCG22008, isoform CRA_a [Rattus norvegicus]
Length=283

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  463  AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F
Sbjct  183  AFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSF  236



>ref|WP_013170431.1| DNA helicase [Arcanobacterium haemolyticum]
 gb|ADH92939.1| DEAD/DEAH box helicase domain protein [Arcanobacterium haemolyticum 
DSM 20595]
Length=520

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = +1

Query  421  MEAVGGDEE-EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  597
            +EA G D   EE  +A  ++ +S P+ +AL AKGI   F IQA+T    L G+D++G+A+
Sbjct  25   IEAAGKDLNLEEKTFA--DYGVSAPIVDALAAKGISHPFPIQALTLPVALKGSDIIGQAK  82

Query  598  TGQGKTLAF  624
            TG GKTL F
Sbjct  83   TGTGKTLGF  91



>gb|KEH33609.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=579

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 37/66 (56%), Gaps = 4/66 (6%)
 Frame = +1

Query  427  AVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  606
             V GDE  E    I    ISK +  AL  KGI  LF IQ    E  + G DM+GRARTG 
Sbjct  82   GVNGDEGLE----IAKLGISKEIVNALGKKGIAKLFPIQRAVLEPAMQGRDMIGRARTGT  137

Query  607  GKTLAF  624
            GKTLAF
Sbjct  138  GKTLAF  143



>ref|XP_004251555.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 [Solanum lycopersicum]
Length=643

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            +E+ E+   I+   IS+ +  AL  +GI SLF IQ    E  + G+DM+GRARTG GKTL
Sbjct  104  EEDCEEGLEISKLGISEEIVSALAQRGITSLFPIQRAVLEPAMQGSDMIGRARTGTGKTL  163

Query  619  AF  624
            AF
Sbjct  164  AF  165



>ref|XP_009865080.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Apaloderma 
vittatum]
Length=575

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE    A +NF +S+     LKA+G++ LF +Q  TFE + DG D++ +ARTG GKT +F
Sbjct  4    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVRTFEPIYDGKDLIAQARTGTGKTFSF  63



>ref|XP_786504.3| PREDICTED: nucleolar RNA helicase 2-like [Strongylocentrotus 
purpuratus]
Length=751

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            +E +E   A +NF I     E L AKG++ LF IQA TF+ + DG D++ +ARTG GKTL
Sbjct  109  EETQEKIGAFSNFGIRPKTIEKLHAKGVKYLFPIQAQTFKPIDDGFDVIAQARTGTGKTL  168

Query  619  AF  624
            +F
Sbjct  169  SF  170



>ref|XP_006351994.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X4 [Solanum tuberosum]
Length=670

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            +E+ E+   I+   IS+ +  AL  +GI SLF IQ    E  + G+DM+GRARTG GKTL
Sbjct  104  EEDCEEGLEISKLGISEEIVSALAQRGITSLFPIQRAVLEPAMQGSDMIGRARTGTGKTL  163

Query  619  AF  624
            AF
Sbjct  164  AF  165



>gb|KEH33610.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=558

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 37/66 (56%), Gaps = 4/66 (6%)
 Frame = +1

Query  427  AVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  606
             V GDE  E    I    ISK +  AL  KGI  LF IQ    E  + G DM+GRARTG 
Sbjct  82   GVNGDEGLE----IAKLGISKEIVNALGKKGIAKLFPIQRAVLEPAMQGRDMIGRARTGT  137

Query  607  GKTLAF  624
            GKTLAF
Sbjct  138  GKTLAF  143



>ref|XP_006351993.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X3 [Solanum tuberosum]
Length=679

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            +E+ E+   I+   IS+ +  AL  +GI SLF IQ    E  + G+DM+GRARTG GKTL
Sbjct  104  EEDCEEGLEISKLGISEEIVSALAQRGITSLFPIQRAVLEPAMQGSDMIGRARTGTGKTL  163

Query  619  AF  624
            AF
Sbjct  164  AF  165



>ref|XP_006351991.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006351992.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Solanum tuberosum]
Length=688

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +1

Query  439  DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  618
            +E+ E+   I+   IS+ +  AL  +GI SLF IQ    E  + G+DM+GRARTG GKTL
Sbjct  104  EEDCEEGLEISKLGISEEIVSALAQRGITSLFPIQRAVLEPAMQGSDMIGRARTGTGKTL  163

Query  619  AF  624
            AF
Sbjct  164  AF  165



>ref|XP_009499705.1| PREDICTED: nucleolar RNA helicase 2-like [Phalacrocorax carbo]
Length=688

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE+   A +NF ISK   + L+A+G+  LF +Q  TF+ V  G D++ +ARTG GKT +F
Sbjct  109  EEQKEGAFSNFSISKGTVQLLQARGVTYLFPVQVKTFDPVFSGKDVIAQARTGTGKTFSF  168



>ref|XP_005009180.1| PREDICTED: nucleolar RNA helicase 2 [Anas platyrhynchos]
Length=728

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE+   A +NF ISK   E L+A+G+  LF +Q  TF  V  G D++ +ARTG GKT +F
Sbjct  148  EEQKEGAFSNFPISKGTVELLQARGVTYLFPVQVKTFHPVFSGKDVIAQARTGTGKTFSF  207



>gb|EOB09008.1| Nucleolar RNA helicase 2, partial [Anas platyrhynchos]
Length=592

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +1

Query  445  EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  624
            EE+   A +NF ISK   E L+A+G+  LF +Q  TF  V  G D++ +ARTG GKT +F
Sbjct  94   EEQKEGAFSNFPISKGTVELLQARGVTYLFPVQVKTFHPVFSGKDVIAQARTGTGKTFSF  153



Lambda      K        H        a         alpha
   0.316    0.130    0.361    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380