BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS143C09

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010323258.1|  PREDICTED: uncharacterized protein LOC101249097  67.8    8e-17   Solanum lycopersicum
ref|XP_006359539.1|  PREDICTED: uncharacterized protein LOC102594159  63.2    9e-17   Solanum tuberosum [potatoes]
ref|XP_009769069.1|  PREDICTED: uncharacterized protein LOC104219993  65.1    1e-16   Nicotiana sylvestris
ref|XP_009595430.1|  PREDICTED: uncharacterized protein LOC104091732  57.4    3e-14   Nicotiana tomentosiformis
ref|XP_011084036.1|  PREDICTED: uncharacterized protein LOC105166393  52.4    6e-10   Sesamum indicum [beniseed]
ref|XP_002523543.1|  zinc finger protein, putative                    57.8    6e-09   Ricinus communis
emb|CDP10517.1|  unnamed protein product                              53.1    1e-08   Coffea canephora [robusta coffee]
gb|KDP38622.1|  hypothetical protein JCGZ_03975                       54.7    1e-07   Jatropha curcas
ref|XP_007013704.1|  Zinc finger protein, putative isoform 1          50.8    4e-07   
ref|XP_008443896.1|  PREDICTED: uncharacterized protein LOC103487...  58.5    9e-07   Cucumis melo [Oriental melon]
ref|XP_008443898.1|  PREDICTED: uncharacterized protein LOC103487...  58.5    9e-07   Cucumis melo [Oriental melon]
ref|XP_004146703.1|  PREDICTED: uncharacterized protein LOC101215133  52.4    2e-06   Cucumis sativus [cucumbers]
ref|XP_010265699.1|  PREDICTED: uncharacterized protein LOC104603377  43.1    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_004162452.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.8    6e-05   
gb|KCW82688.1|  hypothetical protein EUGRSUZ_C04065                   51.2    2e-04   Eucalyptus grandis [rose gum]
ref|XP_006453696.1|  hypothetical protein CICLE_v10007567mg           51.2    2e-04   Citrus clementina [clementine]
gb|KGN65218.1|  hypothetical protein Csa_1G266150                     51.2    2e-04   Cucumis sativus [cucumbers]
ref|XP_006381900.1|  hypothetical protein POPTR_0006s20380g           50.8    3e-04   
gb|KDO59352.1|  hypothetical protein CISIN_1g043289mg                 50.4    4e-04   Citrus sinensis [apfelsine]
ref|XP_011033482.1|  PREDICTED: uncharacterized protein LOC105131955  49.3    0.001   Populus euphratica



>ref|XP_010323258.1| PREDICTED: uncharacterized protein LOC101249097 [Solanum lycopersicum]
Length=789

 Score = 67.8 bits (164),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  569
            K++RG+ I Y+YPS        +  SG VKDVK    HPI+L+ +KE++I+A++DEG NK
Sbjct  81   KKSRGSEIRYVYPSADSVIRSDAVCSGGVKDVKLDSEHPILLVDTKETQIIAFVDEGPNK  140

Query  570  EPXNMEHVYDYST  608
            EP N   +YD +T
Sbjct  141  EPQNQGCIYDCTT  153


 Score = 46.2 bits (108),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 1/33 (3%)
 Frame = +1

Query  199  AYSGRALFVEGGILSEWQRFDSTPDREKNLRVE  297
            +YSGR LFVEGG+LS+W  F+S P R +NL+ E
Sbjct  21   SYSGRGLFVEGGVLSDWGDFNSPPSR-RNLKGE  52



>ref|XP_006359539.1| PREDICTED: uncharacterized protein LOC102594159 [Solanum tuberosum]
Length=790

 Score = 63.2 bits (152),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = +3

Query  399  RGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEPX  578
            RG+ I Y+YPS        +  SG VKD K    HPI+L+ +KE++IVA++DEG NKEP 
Sbjct  85   RGSEIRYVYPSANSVVRSDAVCSGGVKDDKLDWEHPILLVDTKETQIVAFVDEGQNKEPQ  144

Query  579  NMEHVYDYST  608
            N   +YD +T
Sbjct  145  NQGCIYDCTT  154


 Score = 50.4 bits (119),  Expect(2) = 9e-17, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  199  AYSGRALFVEGGILSEWQRFDSTPDREKNLRVE  297
            +YSGR LFVEGG+LS+W  F+S P R +NL+ E
Sbjct  21   SYSGRGLFVEGGVLSDWGDFNSPPSRGRNLKSE  53



>ref|XP_009769069.1| PREDICTED: uncharacterized protein LOC104219993 [Nicotiana sylvestris]
Length=787

 Score = 65.1 bits (157),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 4/74 (5%)
 Frame = +3

Query  399  RGNAIAYMYPS-DGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEP  575
            RGN I Y+YPS D V D + SE    VKD K     PI+L+ +KE++IVA+IDEG NKEP
Sbjct  83   RGNEIRYIYPSADSVIDAVHSEG---VKDDKLDREQPILLVDTKETQIVAFIDEGPNKEP  139

Query  576  XNMEHVYDYSTTCT  617
             N   +YD +T  +
Sbjct  140  QNEGCIYDCTTPLS  153


 Score = 47.8 bits (112),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  199  AYSGRALFVEGGILSEWQRFDSTPDREKNLR  291
            +YSGR LFVEGG+LS+W  ++S P R +NL+
Sbjct  21   SYSGRGLFVEGGVLSDWAVYNSPPSRGRNLK  51



>ref|XP_009595430.1| PREDICTED: uncharacterized protein LOC104091732 [Nicotiana tomentosiformis]
Length=786

 Score = 57.4 bits (137),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = +3

Query  399  RGNAIAYMYPS-DGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEP  575
            RGN I Y+YPS D V    A  S+G V+D K     PI+L+ +KE++IVA+IDE  NKEP
Sbjct  83   RGNEIRYVYPSADSVSCSDAVRSAG-VEDNKLDLEQPILLVDTKETQIVAFIDEDPNKEP  141

Query  576  XNMEHVYDYST  608
             N    YD +T
Sbjct  142  QNEGCTYDCTT  152


 Score = 47.8 bits (112),  Expect(2) = 3e-14, Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  199  AYSGRALFVEGGILSEWQRFDSTPDREKNLR  291
            +YSGR LFVEGG+LS+W  ++S P R +NL+
Sbjct  21   SYSGRGLFVEGGVLSDWAVYNSPPSRGRNLK  51



>ref|XP_011084036.1| PREDICTED: uncharacterized protein LOC105166393 [Sesamum indicum]
Length=762

 Score = 52.4 bits (124),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 5/73 (7%)
 Frame = +3

Query  393  QTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKE  572
            ++RGNAI Y+YP +      A    GE  +   V   P+VL+ S+++ +VAYIDE    E
Sbjct  81   KSRGNAICYLYPQEN-----APIDEGENCENNLVVSEPVVLVDSEKTPMVAYIDEEPCNE  135

Query  573  PXNMEHVYDYSTT  611
              N+E++YDY+T+
Sbjct  136  SRNVEYIYDYTTS  148


 Score = 38.1 bits (87),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 15/22 (68%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +1

Query  211  RALFVEGGILSEWQRFDSTPDR  276
            RALFVEGG+LS+W  F S P R
Sbjct  22   RALFVEGGLLSDWSAFSSPPSR  43



>ref|XP_002523543.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38882.1| zinc finger protein, putative [Ricinus communis]
Length=775

 Score = 57.8 bits (138),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESS--GEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  563
            +++ GNA  Y YP+  +QDGL +E S  G  +D       PIVL+ SKE++IVAY+D  +
Sbjct  93   RKSNGNAFGYSYPTVEIQDGLHNELSVKGNGRDYDLDVSQPIVLVDSKETQIVAYLDNTT  152

Query  564  NKEPXNMEHVYDYSTT  611
              +P N++  YDY ++
Sbjct  153  PLKPNNVDCTYDYDSS  168


 Score = 29.3 bits (64),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 11/19 (58%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  214  ALFVEGGILSEWQRFDSTP  270
            +LFVEGG+LS+W    S P
Sbjct  46   SLFVEGGVLSDWNLSSSCP  64



>emb|CDP10517.1| unnamed protein product [Coffea canephora]
Length=770

 Score = 53.1 bits (126),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +3

Query  393  QTRGNAIAYMYPSDGVQDGLASESSG-EVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  569
            +TRG+AI Y+YPS   Q+G  S ++G E ++ K     PIVL+ S+++ IVAYIDEG +K
Sbjct  95   KTRGHAIGYVYPSLDAQEG--SFANGYEERESKLKNSCPIVLVDSEDTPIVAYIDEGPSK  152

Query  570  EPXNMEHVYDYSTTCT  617
                 E+ YDY+   T
Sbjct  153  HIQCSEYNYDYTMGFT  168


 Score = 32.3 bits (72),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +1

Query  208  GRALFVEGGILSEW-QRFDSTPDREKNL  288
            G+ALFVEGG+L++W   F+S+P REKNL
Sbjct  28   GQALFVEGGVLADWSSSFNSSPSREKNL  55



>gb|KDP38622.1| hypothetical protein JCGZ_03975 [Jatropha curcas]
Length=756

 Score = 54.7 bits (130),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESS--GEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  563
            +++ GNA  Y YPS  +Q+ L  ESS  G  +D     + PI L+ SK+++IVAY+DE  
Sbjct  96   RKSNGNAFGYNYPSLELQERLLKESSIGGNDQDNDLDALQPITLVDSKDTQIVAYLDETP  155

Query  564  NKEPXNMEHVYDYSTT  611
            + +  N +  YDY+++
Sbjct  156  SLKASNADFTYDYNSS  171


 Score = 28.1 bits (61),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = +1

Query  217  LFVEGGILSEWQRFDSTP  270
            LFVEGG+LS+W    S P
Sbjct  50   LFVEGGVLSDWPLSSSCP  67



>ref|XP_007013704.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY31323.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=765

 Score = 50.8 bits (120),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQD--GLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  563
            +++ G+AI Y YPS  +QD      E +G+ K  +S   H +VL  SKE++IVAY+D+ +
Sbjct  84   RKSGGSAIRYEYPSLNLQDPESGVHECNGDKKMDES---HTVVLFDSKETQIVAYMDQTT  140

Query  564  NKEPXNMEHVYDYSTTCT  617
              +P ++++ Y+Y + C 
Sbjct  141  PPKPHHVKYTYEYDSDCV  158


 Score = 29.6 bits (65),  Expect(2) = 4e-07, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +1

Query  214  ALFVEGGILSEWQRFDSTPDREKN  285
            +LFVEGG+LS+WQ      +R +N
Sbjct  40   SLFVEGGLLSDWQLDSRGRNRNEN  63



>ref|XP_008443896.1| PREDICTED: uncharacterized protein LOC103487380 isoform X1 [Cucumis 
melo]
Length=800

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSV--GMHPIVLLGSKESKIVAYIDEGS  563
            KQ+ G AI Y YPS   Q+ L SES G   D +       P +LL SK ++IVAY+DE  
Sbjct  85   KQSNGYAIGYEYPSAPNQEDLQSESRGLQNDAECSLDDSQPFILLNSKSNQIVAYVDENP  144

Query  564  NKEPXNMEHVYDYSTT  611
                 N+E  YDY T+
Sbjct  145  QLMADNLEFTYDYGTS  160



>ref|XP_008443898.1| PREDICTED: uncharacterized protein LOC103487380 isoform X2 [Cucumis 
melo]
Length=795

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSV--GMHPIVLLGSKESKIVAYIDEGS  563
            KQ+ G AI Y YPS   Q+ L SES G   D +       P +LL SK ++IVAY+DE  
Sbjct  85   KQSNGYAIGYEYPSAPNQEDLQSESRGLQNDAECSLDDSQPFILLNSKSNQIVAYVDENP  144

Query  564  NKEPXNMEHVYDYSTT  611
                 N+E  YDY T+
Sbjct  145  QLMADNLEFTYDYGTS  160



>ref|XP_004146703.1| PREDICTED: uncharacterized protein LOC101215133 [Cucumis sativus]
Length=793

 Score = 52.4 bits (124),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVK--SVGMHPIVLLGSKESKIVAYIDEGS  563
            KQ+ G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE  
Sbjct  83   KQSNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENP  142

Query  564  NKEPXNMEHVYDYSTT  611
                 N+E  YDY T+
Sbjct  143  PLMADNLEFTYDYGTS  158


 Score = 26.2 bits (56),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 15/27 (56%), Gaps = 0/27 (0%)
 Frame = +1

Query  217  LFVEGGILSEWQRFDSTPDREKNLRVE  297
            LFV+GG L +WQ       RE N R +
Sbjct  35   LFVDGGFLFDWQCSPPISAREGNSRAK  61



>ref|XP_010265699.1| PREDICTED: uncharacterized protein LOC104603377 [Nelumbo nucifera]
Length=820

 Score = 43.1 bits (100),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 2/75 (3%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESS--GEVKDVKSVGMHPIVLLGSKESKIVAYIDEGS  563
            ++  GN+  Y YP   V+D +  ES   G VK        PI+LL SKE+++VAY+DE  
Sbjct  73   RRPSGNSFGYEYPVVDVEDLMRLESGIDGNVKGGDVDESRPIILLDSKETQVVAYVDETP  132

Query  564  NKEPXNMEHVYDYST  608
              +    ++ Y+Y +
Sbjct  133  CTKSCGGDYTYEYGS  147


 Score = 34.3 bits (77),  Expect(2) = 5e-06, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +1

Query  205  SGRALFVEGGILSEWQRFDSTP  270
            S RA FV+GG LSEWQ   S+P
Sbjct  18   SCRAFFVDGGFLSEWQNDSSSP  39



>ref|XP_004162452.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226078 
[Cucumis sativus]
Length=802

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVK--SVGMHPIVLLGSKESKIVAYIDEGS  563
            KQ+ G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE  
Sbjct  93   KQSNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENP  152

Query  564  NKEPXNMEHVYDYSTT  611
                 N+E  YDY T+
Sbjct  153  PLMADNLEFTYDYGTS  168



>gb|KCW82688.1| hypothetical protein EUGRSUZ_C04065 [Eucalyptus grandis]
Length=588

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 11/77 (14%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGL-----ASESSGEVKDVKSVGMHPIVLLGSKESKIVAYID  554
            + +R NA+ Y YPS  +QDGL       +++GE K   S    P +L GSK+S+IVAY+D
Sbjct  111  RNSRSNAVGYRYPSRDLQDGLHPVSTFRDTNGENKMDFS---QPFILCGSKDSQIVAYVD  167

Query  555  EG-SNKEPXNMEHVYDY  602
            EG S+ +  N+   YDY
Sbjct  168  EGPSSVDQANIS--YDY  182



>ref|XP_006453696.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 ref|XP_006453697.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66936.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
 gb|ESR66937.1| hypothetical protein CICLE_v10007567mg [Citrus clementina]
Length=744

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  569
            K++ GNA  Y YPS  +++     + G++   +S    PI LLGSK+S+IVAY+D+  + 
Sbjct  87   KKSNGNAFGYQYPSVDLKELCFGGNDGDINLDES---QPINLLGSKDSRIVAYVDQTPDL  143

Query  570  EPXNMEHVYDYSTT  611
            +P N+ +  DY ++
Sbjct  144  KPQNLIYSCDYDSS  157



>gb|KGN65218.1| hypothetical protein Csa_1G266150 [Cucumis sativus]
Length=783

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSV--GMHPIVLLGSKESKIVAYIDEGS  563
            KQ+ G AI Y YPS   Q+ L SES     D +       P +LL SK ++IVAY+DE  
Sbjct  73   KQSNGYAIGYEYPSAPNQEDLHSESRVLQNDAERPKDDSQPFILLNSKSNQIVAYVDENP  132

Query  564  NKEPXNMEHVYDYSTT  611
                 N+E  YDY T+
Sbjct  133  PLMADNLEFTYDYGTS  148



>ref|XP_006381900.1| hypothetical protein POPTR_0006s20380g [Populus trichocarpa]
 gb|ERP59697.1| hypothetical protein POPTR_0006s20380g [Populus trichocarpa]
Length=461

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 9/73 (12%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  569
            ++  GNA  Y YP   +Q+G + +      DV      PIVL+ SKE+ IVAY+DE    
Sbjct  94   RKASGNAFVYNYPCFDLQEGTSRD-----MDVS----QPIVLVDSKETHIVAYLDETPTL  144

Query  570  EPXNMEHVYDYST  608
            +P N+   Y+YS+
Sbjct  145  KPCNLNLTYEYSS  157



>gb|KDO59352.1| hypothetical protein CISIN_1g043289mg [Citrus sinensis]
Length=695

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +3

Query  390  KQTRGNAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNK  569
            K++ GNA  Y YPS  +++     + G++   +S    PI LLGSK+S+IVAY+D+  + 
Sbjct  87   KKSNGNAFGYQYPSVDLKELCFGGNDGDINLDES---QPINLLGSKDSRIVAYVDQTPDL  143

Query  570  EPXNMEHVYDYSTT  611
            +P N+ +  DY ++
Sbjct  144  KPQNLIYSCDYDSS  157



>ref|XP_011033482.1| PREDICTED: uncharacterized protein LOC105131955 [Populus euphratica]
Length=724

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 9/68 (13%)
 Frame = +3

Query  405  NAIAYMYPSDGVQDGLASESSGEVKDVKSVGMHPIVLLGSKESKIVAYIDEGSNKEPXNM  584
            NA  Y YP   VQ+G + +      DV      PIVL+ SKE+ IVAY+DE    +P N+
Sbjct  140  NAFGYNYPCFDVQEGTSRDM-----DVS----QPIVLVDSKETHIVAYLDETQTLKPCNL  190

Query  585  EHVYDYST  608
               Y+YS+
Sbjct  191  NLTYEYSS  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520