BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS142E03

Length=597
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABO87603.1|  chloroplast ATP/ADP translocator                        377   4e-129   Pisum sativum [garden pea]
gb|AFD54199.1|  gibberellin 3-beta-dioxygenase 4                        375   6e-128   Vitis vinifera
ref|XP_010099654.1|  Plastidic                                          384   3e-127   Morus notabilis
ref|XP_004252326.1|  PREDICTED: plastidic ATP/ADP-transporter           384   4e-127   Solanum lycopersicum
ref|NP_001274794.1|  plastidic ATP/ADP-transporter                      383   1e-126   Solanum tuberosum [potatoes]
ref|XP_004235723.1|  PREDICTED: plastidic ATP/ADP-transporter-like      382   1e-126   Solanum lycopersicum
ref|XP_011035631.1|  PREDICTED: plastidic ATP/ADP-transporter-like      382   1e-126   Populus euphratica
ref|XP_002298119.2|  Chloroplast ADP family protein                     382   2e-126   
ref|XP_004506888.1|  PREDICTED: plastidic ATP/ADP-transporter-like      381   3e-126   Cicer arietinum [garbanzo]
gb|ABG37645.1|  plastid ATP/ADP-transporter                             385   6e-126   Populus trichocarpa [western balsam poplar]
gb|AAS82778.1|  plastidic ATP/ADP-transporter                           375   7e-126   Helianthus tuberosus [Jerusalem artichoke]
gb|EYU24674.1|  hypothetical protein MIMGU_mgv1a002918mg                380   8e-126   Erythranthe guttata [common monkey flower]
gb|KEH28732.1|  plastidic ATP/ADP-transporter-like protein              380   8e-126   Medicago truncatula
ref|XP_011039999.1|  PREDICTED: plastidic ATP/ADP-transporter-like      380   9e-126   Populus euphratica
ref|XP_007150697.1|  hypothetical protein PHAVU_005G174000g             380   9e-126   Phaseolus vulgaris [French bean]
gb|AAT73075.1|  plastidic ATP/ADP transporter                           374   1e-125   Helianthus tuberosus [Jerusalem artichoke]
gb|KJB13104.1|  hypothetical protein B456_002G057300                    379   2e-125   Gossypium raimondii
gb|KJB13103.1|  hypothetical protein B456_002G057300                    379   2e-125   Gossypium raimondii
gb|AAT99359.1|  chloroplast ATP/ADP transporter protein                 375   2e-125   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_002303268.1|  Chloroplast ADP family protein                     379   2e-125   Populus trichocarpa [western balsam poplar]
ref|XP_006465406.1|  PREDICTED: LOW QUALITY PROTEIN: plastidic AT...    378   3e-125   
ref|XP_004487222.1|  PREDICTED: plastidic ATP/ADP-transporter-like      379   4e-125   Cicer arietinum [garbanzo]
gb|AAM29152.1|  plastidic ATP/ADP transporter                           377   5e-125   Citrus hybrid cultivar
ref|XP_006427151.1|  hypothetical protein CICLE_v10025170mg             378   5e-125   Citrus clementina [clementine]
ref|XP_006341665.1|  PREDICTED: plastidic ATP/ADP-transporter-like      378   6e-125   Solanum tuberosum [potatoes]
ref|XP_003543665.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    378   6e-125   Glycine max [soybeans]
gb|KHN44149.1|  ADP,ATP carrier protein 1, chloroplastic                377   7e-125   Glycine soja [wild soybean]
gb|EYU21596.1|  hypothetical protein MIMGU_mgv1a002865mg                378   8e-125   Erythranthe guttata [common monkey flower]
ref|XP_011072264.1|  PREDICTED: plastidic ATP/ADP-transporter-like      377   1e-124   Sesamum indicum [beniseed]
ref|XP_011081074.1|  PREDICTED: plastidic ATP/ADP-transporter           376   5e-124   Sesamum indicum [beniseed]
gb|KJB68136.1|  hypothetical protein B456_010G227600                    375   5e-124   Gossypium raimondii
ref|XP_010033911.1|  PREDICTED: plastidic ATP/ADP-transporter-like      375   5e-124   Eucalyptus grandis [rose gum]
emb|CBI36236.3|  unnamed protein product                                373   5e-124   Vitis vinifera
ref|XP_009758418.1|  PREDICTED: plastidic ATP/ADP-transporter-like      375   6e-124   Nicotiana sylvestris
ref|XP_009767462.1|  PREDICTED: plastidic ATP/ADP-transporter           376   6e-124   Nicotiana sylvestris
gb|KHG23248.1|  ADP,ATP carrier 1, chloroplastic -like protein          375   6e-124   Gossypium arboreum [tree cotton]
gb|KHG10295.1|  ADP,ATP carrier 1, chloroplastic -like protein          375   1e-123   Gossypium arboreum [tree cotton]
ref|XP_009595520.1|  PREDICTED: plastidic ATP/ADP-transporter           375   1e-123   Nicotiana tomentosiformis
ref|XP_010254276.1|  PREDICTED: plastidic ATP/ADP-transporter-like      374   2e-123   Nelumbo nucifera [Indian lotus]
gb|KJB70559.1|  hypothetical protein B456_011G079600                    374   2e-123   Gossypium raimondii
ref|XP_007023973.1|  TLC ATP/ADP transporter isoform 1                  374   2e-123   
ref|XP_009624271.1|  PREDICTED: plastidic ATP/ADP-transporter-like      374   3e-123   Nicotiana tomentosiformis
gb|KDP37155.1|  hypothetical protein JCGZ_06211                         374   3e-123   Jatropha curcas
emb|CAN83628.1|  hypothetical protein VITISV_019239                     373   4e-123   Vitis vinifera
ref|XP_002285232.1|  PREDICTED: plastidic ATP/ADP-transporter           373   4e-123   Vitis vinifera
emb|CDO98099.1|  unnamed protein product                                373   7e-123   Coffea canephora [robusta coffee]
ref|XP_008377604.1|  PREDICTED: plastidic ATP/ADP-transporter-like      372   1e-122   Malus domestica [apple tree]
ref|XP_010061949.1|  PREDICTED: plastidic ATP/ADP-transporter-like      372   1e-122   Eucalyptus grandis [rose gum]
gb|AAZ23107.1|  plastid ATP/ADP transport protein 2                     372   1e-122   Manihot esculenta [manioc]
ref|XP_004302940.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    372   1e-122   Fragaria vesca subsp. vesca
gb|KJB56643.1|  hypothetical protein B456_009G129100                    372   1e-122   Gossypium raimondii
gb|KHG15786.1|  ADP,ATP carrier 1, chloroplastic -like protein          371   3e-122   Gossypium arboreum [tree cotton]
dbj|BAD91180.1|  putative plastidic adenylate transporter               370   5e-122   Mesembryanthemum crystallinum
ref|XP_009343421.1|  PREDICTED: plastidic ATP/ADP-transporter-like      370   6e-122   Pyrus x bretschneideri [bai li]
ref|XP_002517555.1|  Plastidic ATP/ADP-transporter, putative            370   1e-121   Ricinus communis
gb|AAZ23108.1|  plastid ATP/ADP transport protein 2                     370   1e-121   Manihot esculenta [manioc]
ref|XP_010249956.1|  PREDICTED: plastidic ATP/ADP-transporter           370   1e-121   Nelumbo nucifera [Indian lotus]
ref|XP_006585647.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    369   1e-121   Glycine max [soybeans]
gb|KHN47790.1|  ADP,ATP carrier protein 1, chloroplastic                369   2e-121   Glycine soja [wild soybean]
gb|KHN01355.1|  ADP,ATP carrier protein 1, chloroplastic                369   2e-121   Glycine soja [wild soybean]
ref|XP_006583133.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    369   2e-121   Glycine max [soybeans]
gb|AAZ23106.1|  plastid ATP/ADP transport protein 1                     369   2e-121   Manihot esculenta [manioc]
ref|XP_007135724.1|  hypothetical protein PHAVU_010G152900g             368   6e-121   Phaseolus vulgaris [French bean]
gb|EPS64663.1|  hypothetical protein M569_10117                         367   9e-121   Genlisea aurea
gb|ACF80277.1|  unknown                                                 358   9e-121   Zea mays [maize]
ref|XP_010429984.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    360   4e-120   Camelina sativa [gold-of-pleasure]
gb|KFK42425.1|  hypothetical protein AALP_AA2G254500                    364   1e-119   Arabis alpina [alpine rockcress]
ref|XP_010537959.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    364   2e-119   Tarenaya hassleriana [spider flower]
gb|KHG16971.1|  ADP,ATP carrier 1, chloroplastic -like protein          363   2e-119   Gossypium arboreum [tree cotton]
ref|XP_009106762.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    363   3e-119   Brassica rapa
ref|XP_008447482.1|  PREDICTED: plastidic ATP/ADP-transporter-like      363   3e-119   Cucumis melo [Oriental melon]
emb|CDX87299.1|  BnaA07g35740D                                          363   4e-119   
ref|XP_004147999.1|  PREDICTED: plastidic ATP/ADP-transporter-like      363   4e-119   Cucumis sativus [cucumbers]
emb|CDY57697.1|  BnaA07g38360D                                          363   4e-119   Brassica napus [oilseed rape]
emb|CDY39988.1|  BnaC06g40660D                                          363   4e-119   Brassica napus [oilseed rape]
ref|XP_009104454.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    363   5e-119   Brassica rapa
ref|XP_006389778.1|  hypothetical protein EUTSA_v10018281mg             362   7e-119   Eutrema salsugineum [saltwater cress]
emb|CDX79394.1|  BnaC06g19090D                                          362   7e-119   
ref|XP_006829678.1|  hypothetical protein AMTR_s00122p00140700          363   8e-119   Amborella trichopoda
ref|XP_008672827.1|  PREDICTED: plastidic ATP/ADP-transporter iso...    362   1e-118   
tpg|DAA58346.1|  TPA: plastidic ATP/ADP-transporter                     362   1e-118   
ref|XP_010429982.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    362   1e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010417726.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    362   1e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010472951.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    362   1e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002889299.1|  chloroplast ADP, ATP carrier protein 1             361   2e-118   
ref|NP_001147851.1|  plastidic ATP/ADP-transporter                      362   2e-118   Zea mays [maize]
ref|XP_002458233.1|  hypothetical protein SORBIDRAFT_03g029490          361   5e-118   Sorghum bicolor [broomcorn]
ref|XP_010691228.1|  PREDICTED: plastidic ATP/ADP-transporter           360   5e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010532151.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    360   5e-118   Tarenaya hassleriana [spider flower]
ref|XP_006300855.1|  hypothetical protein CARUB_v10019948mg             360   5e-118   
emb|CAA89201.2|  adenine nucleotide translocase                         359   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178146.1|  ADP,ATP carrier protein 1                             359   1e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AAK76577.1|  putative adenine nucleotide translocase                 359   1e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AFW83424.1|  hypothetical protein ZEAMMB73_806603                    359   2e-117   
ref|XP_010459088.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    352   4e-117   Camelina sativa [gold-of-pleasure]
gb|EAZ12893.1|  hypothetical protein OsJ_02814                          357   5e-117   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043710.1|  Os01g0647100                                       358   5e-117   
ref|XP_006646147.1|  PREDICTED: plastidic ATP/ADP-transporter-like      355   8e-117   
dbj|BAH20416.1|  AT1G15500                                              351   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140537.1|  uncharacterized protein LOC100272602               356   1e-116   Zea mays [maize]
ref|XP_004969309.1|  PREDICTED: plastidic ATP/ADP-transporter-like      357   1e-116   Setaria italica
ref|XP_008785487.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    358   2e-116   Phoenix dactylifera
ref|XP_006648444.1|  PREDICTED: plastidic ATP/ADP-transporter-like      353   3e-116   
ref|XP_008681386.1|  PREDICTED: uncharacterized protein LOC100272...    356   3e-116   Zea mays [maize]
gb|EEE56534.1|  hypothetical protein OsJ_05838                          354   4e-116   Oryza sativa Japonica Group [Japonica rice]
gb|EMS56290.1|  Plastidic ATP/ADP-transporter                           352   5e-116   Triticum urartu
gb|ADE75734.1|  unknown                                                 348   9e-116   Picea sitchensis
ref|XP_009381260.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    355   9e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006307012.1|  hypothetical protein CARUB_v10008598mg             354   1e-115   Capsella rubella
ref|XP_010476640.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    354   1e-115   Camelina sativa [gold-of-pleasure]
ref|XP_004951502.1|  PREDICTED: plastidic ATP/ADP-transporter-like      354   1e-115   Setaria italica
gb|KHN22476.1|  ADP,ATP carrier protein 1, chloroplastic                354   1e-115   Glycine soja [wild soybean]
gb|EAY84955.1|  hypothetical protein OsI_06319                          354   2e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_003546196.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    353   2e-115   Glycine max [soybeans]
ref|XP_010497204.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    353   2e-115   Camelina sativa [gold-of-pleasure]
ref|XP_006416899.1|  hypothetical protein EUTSA_v10007090mg             353   2e-115   Eutrema salsugineum [saltwater cress]
dbj|BAD24996.1|  putative plastidic ATP/ADP transporter                 354   2e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010925271.1|  PREDICTED: plastidic ATP/ADP-transporter-like      355   2e-115   Elaeis guineensis
gb|AAX63195.1|  putative plastidic ATP/ADP transporter                  353   4e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009407647.1|  PREDICTED: plastidic ATP/ADP-transporter-like      353   4e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002890107.1|  hypothetical protein ARALYDRAFT_471751             352   5e-115   
ref|NP_173003.1|  ADP,ATP carrier protein 2                             352   5e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148947.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    352   5e-115   Brassica rapa
emb|CDY36568.1|  BnaA06g10210D                                          352   6e-115   Brassica napus [oilseed rape]
emb|CDX83974.1|  BnaC08g16710D                                          352   6e-115   
ref|XP_002451752.1|  hypothetical protein SORBIDRAFT_04g007240          354   6e-115   
emb|CDY39658.1|  BnaC05g11870D                                          352   7e-115   Brassica napus [oilseed rape]
ref|XP_009388534.1|  PREDICTED: plastidic ATP/ADP-transporter-like      353   8e-115   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89983.1|  predicted protein                                      352   1e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569451.1|  PREDICTED: plastidic ATP/ADP-transporter-like      352   1e-114   Brachypodium distachyon [annual false brome]
emb|CDX96838.1|  BnaA08g23810D                                          351   1e-114   
ref|XP_009110479.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    351   1e-114   Brassica rapa
gb|EMT31396.1|  Plastidic ATP/ADP-transporter                           351   2e-114   
ref|XP_010914961.1|  PREDICTED: plastidic ATP/ADP-transporter-like      351   4e-114   Elaeis guineensis
ref|XP_008809354.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    352   5e-114   Phoenix dactylifera
gb|EMT25116.1|  ADP,ATP carrier protein 1, chloroplastic                351   8e-114   
ref|XP_007023975.1|  TLC ATP/ADP transporter isoform 3                  345   9e-114   
gb|AAX58120.1|  plastid ATP/ADP transporter                             349   2e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008228630.1|  PREDICTED: plastidic ATP/ADP-transporter-like      348   2e-113   Prunus mume [ume]
ref|XP_008657814.1|  PREDICTED: ADP,ATP carrier protein 2, chloro...    348   3e-113   
ref|XP_007217627.1|  hypothetical protein PRUPE_ppa002937mg             347   4e-113   Prunus persica
ref|XP_010925128.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    350   6e-113   
ref|XP_003571578.1|  PREDICTED: plastidic ATP/ADP-transporter-like      347   6e-113   Brachypodium distachyon [annual false brome]
ref|XP_008792130.1|  PREDICTED: plastidic ATP/ADP-transporter-like      348   7e-113   Phoenix dactylifera
ref|XP_010279263.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    346   7e-112   Nelumbo nucifera [Indian lotus]
gb|KDO58239.1|  hypothetical protein CISIN_1g012495mg                   339   1e-111   Citrus sinensis [apfelsine]
gb|ADE77264.1|  unknown                                                 333   2e-111   Picea sitchensis
gb|EMS68334.1|  ADP,ATP carrier protein 1, chloroplastic                334   1e-108   Triticum urartu
ref|XP_002990822.1|  hypothetical protein SELMODRAFT_21240              330   6e-108   
ref|XP_006838934.1|  hypothetical protein AMTR_s00002p00270350          336   1e-107   Amborella trichopoda
ref|XP_002974477.1|  hypothetical protein SELMODRAFT_101296             331   2e-106   
ref|XP_011401420.1|  ADP,ATP carrier protein 1, chloroplastic           316   3e-101   Auxenochlorella protothecoides
ref|XP_001773938.1|  predicted protein                                  313   2e-100   
ref|XP_001780035.1|  predicted protein                                  313   5e-100   
gb|KDD74050.1|  TLC ATP/ADP transporter                                 307   4e-99    Helicosporidium sp. ATCC 50920
ref|XP_005844203.1|  hypothetical protein CHLNCDRAFT_56336              309   2e-98    Chlorella variabilis
ref|XP_002947450.1|  hypothetical protein VOLCADRAFT_79605              305   3e-97    Volvox carteri f. nagariensis
ref|XP_005643478.1|  ADP/ATP carrier protein                            305   4e-97    Coccomyxa subellipsoidea C-169
ref|XP_001703733.1|  plastidic ADP/ATP translocase                      302   5e-96    Chlamydomonas reinhardtii
gb|AES68077.2|  plastidic ATP/ADP-transporter-like protein              296   1e-93    Medicago truncatula
dbj|BAD95278.1|  adenine nucleotide translocase                         283   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597826.1|  ATP/ADP transporter                                285   1e-88    
gb|EWM29257.1|  plastidic atp adp transporter                           265   7e-82    Nannochloropsis gaditana
gb|ABV25594.1|  plastid ATP/ADP translocase                             261   2e-81    Pavlova lutheri
gb|ABV25597.1|  plastid ATP/ADP translocase                             261   5e-81    Euglena gracilis
gb|KJB70561.1|  hypothetical protein B456_011G079600                    256   7e-79    Gossypium raimondii
gb|ABV25604.1|  plastid ATP/ADP translocase                             256   1e-78    Prymnesium parvum
gb|KCW53784.1|  hypothetical protein EUGRSUZ_J03031                     256   1e-78    Eucalyptus grandis [rose gum]
ref|XP_005707402.1|  ATP:ADP antiporter, AAA family                     253   2e-76    Galdieria sulphuraria
emb|CAC80882.1|  plastidic ATP/ADP transporter                          253   2e-76    Galdieria sulphuraria
emb|CBJ27353.1|  plastidic ATP/ADP transporter                          252   4e-76    Ectocarpus siliculosus
gb|EJK46221.1|  hypothetical protein THAOC_35120                        249   9e-76    Thalassiosira oceanica
ref|XP_009037704.1|  hypothetical protein AURANDRAFT_27252              248   2e-75    Aureococcus anophagefferens
emb|CAX16542.1|  putative ATP/ADP translocase                           239   2e-74    Cyanophora paradoxa
emb|CAX16540.1|  putative ATP/ADP translocase                           243   4e-74    Trieres chinensis
ref|XP_002184271.1|  nucleotide transporter 1                           246   5e-74    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005536231.1|  chloroplast ADP,ATP carrier protein                247   8e-74    Cyanidioschyzon merolae strain 10D
emb|CBJ30232.1|  plastidic ATP/ADP transporter                          244   3e-73    Ectocarpus siliculosus
gb|ABV25596.1|  plastid ATP/ADP translocase                             241   4e-73    Pyropia yezoensis
ref|XP_002292665.1|  predicted protein                                  241   9e-73    Thalassiosira pseudonana CCMP1335
gb|ABH10983.1|  plastid ATP/ADP transporter                             240   2e-72    Polytomella parva
ref|WP_013942850.1|  ATPase AAA                                         238   7e-72    Simkania negevensis
emb|CCB90293.1|  ADP,ATP carrier protein 1                              232   8e-72    Waddlia chondrophila 2032/99
ref|WP_041018366.1|  ATPase AAA                                         238   9e-72    Criblamydia sequanensis
emb|CAE46508.1|  nucleotide transport protein                           232   1e-71    Parachlamydia sp. P9
ref|WP_039386022.1|  ATPase AAA                                         233   4e-70    Neochlamydia sp. TUME1
gb|KIC75182.1|  ADP,ATP carrier protein 1                               233   4e-70    Neochlamydia sp. EPS4
ref|WP_039356341.1|  ATPase AAA                                         233   6e-70    Candidatus Protochlamydia amoebophila
gb|KIC73885.1|  ADP,ATP carrier protein 1                               233   6e-70    Candidatus Protochlamydia amoebophila
ref|WP_011174800.1|  ATPase AAA                                         232   8e-70    Candidatus Protochlamydia amoebophila
ref|WP_042280868.1|  ATPase AAA                                         232   9e-70    Candidatus Protochlamydia sp. R18
ref|WP_042239794.1|  ATPase AAA                                         232   1e-69    Neochlamydia sp. S13
gb|ADI39022.1|  ADP/ATP translocase                                     231   2e-69    Waddlia chondrophila WSU 86-1044
ref|WP_041941596.1|  ATPase AAA                                         231   2e-69    Waddlia chondrophila
ref|WP_042102387.1|  ATPase AAA                                         231   2e-69    Parachlamydiaceae bacterium HS-T3
ref|WP_032124907.1|  ATPase AAA                                         231   2e-69    Candidatus Protochlamydia massiliensis
ref|WP_006340593.1|  ATPase AAA                                         231   3e-69    Parachlamydia acanthamoebae
emb|CAE46506.1|  nucleotide transport protein                           231   4e-69    Candidatus Protochlamydia amoebophila UWE25
emb|CAE46505.1|  nucleotide transport protein                           227   3e-68    endosymbiont of Acanthamoeba sp. TUME1
ref|XP_001693815.1|  plastidic ADP/ATP translocase                      229   9e-68    Chlamydomonas reinhardtii
gb|KEI72701.1|  ATPase AAA                                              221   2e-65    Endozoicomonas elysicola
ref|XP_005763298.1|  hypothetical protein EMIHUDRAFT_465146             223   3e-64    Emiliania huxleyi CCMP1516
gb|EPP36943.1|  ADP,ATP carrier protein                                 206   3e-62    Chlamydia psittaci 84-8471/1
ref|WP_033402749.1|  ATPase AAA                                         211   4e-62    
gb|KIY98283.1|  ADP,ATP carrier protein 2                               209   4e-61    Monoraphidium neglectum
ref|WP_021756588.1|  ADP/ATP carrier protein                            208   2e-60    Chlamydia pecorum
ref|WP_021757805.1|  ADP/ATP carrier protein                            208   2e-60    Chlamydia pecorum
ref|WP_013712807.1|  ATPase AAA                                         208   2e-60    Chlamydia pecorum
gb|EPP28844.1|  ADP,ATP carrier protein                                 206   4e-60    Chlamydia psittaci 08-2626_L3
ref|WP_032742269.1|  ATPase AAA                                         205   8e-60    
ref|WP_020370051.1|  MULTISPECIES: ADP,ATP carrier family protein       206   1e-59    Chlamydia ibidis
ref|WP_010230191.1|  ATPase AAA                                         206   2e-59    Chlamydia muridarum [agent of mouse pneumonitis]
ref|WP_010882994.1|  ATPase AAA                                         205   2e-59    Chlamydia pneumoniae
ref|WP_011324550.1|  ATPase AAA                                         206   2e-59    Chlamydia trachomatis
ref|WP_010895317.1|  ATPase AAA                                         205   2e-59    Chlamydia pneumoniae
gb|EPJ16785.1|  ADP,ATP carrier protein                                 205   2e-59    Chlamydia psittaci 02DC22
ref|WP_011458125.1|  ATPase AAA                                         206   2e-59    Chlamydia felis
ref|WP_014517776.1|  ATPase AAA                                         205   2e-59    Chlamydia pneumoniae
gb|EPJ33718.1|  ADP/ATP carrier family protein                          205   2e-59    Chlamydia psittaci 06-1683
ref|WP_012727795.1|  ATPase AAA                                         205   3e-59    Chlamydia trachomatis
ref|WP_009871413.1|  ATPase AAA                                         205   3e-59    Chlamydia trachomatis
ref|WP_009873033.1|  ATPase AAA                                         205   3e-59    Chlamydia trachomatis
ref|WP_014541221.1|  ATPase AAA                                         205   3e-59    Chlamydia trachomatis
ref|WP_013747357.1|  ATPase AAA                                         205   3e-59    Chlamydia psittaci
ref|WP_006343113.1|  ATPase AAA                                         205   3e-59    Chlamydia psittaci
gb|EKE09902.1|  hypothetical protein ACD_16C00100G0064                  204   4e-59    uncultured bacterium
ref|WP_032741515.1|  ATPase AAA                                         205   4e-59    
ref|WP_011006397.1|  ATPase AAA                                         204   4e-59    Chlamydia caviae
ref|WP_006344068.1|  ATPase AAA                                         204   7e-59    Chlamydia abortus
ref|WP_011097058.1|  ATPase AAA                                         204   7e-59    Chlamydia abortus
ref|WP_009873532.1|  ATPase AAA                                         204   8e-59    Chlamydia trachomatis
ref|WP_015506544.1|  ADP/ATP carrier protein family protein             204   1e-58    Chlamydia trachomatis
ref|WP_035405565.1|  ATPase AAA                                         202   2e-58    Chlamydia suis
ref|XP_005769878.1|  hypothetical protein EMIHUDRAFT_451418             201   4e-58    Emiliania huxleyi CCMP1516
gb|EYE60388.1|  ADP,ATP carrier protein 2                               201   7e-58    Bacteroides fragilis str. S6L5
gb|AAL10405.1|AF416339_1  ADP/ATP translocase                           189   8e-58    Medicago sativa [alfalfa]
ref|WP_021828277.1|  MULTISPECIES: ADP/ATP carrier family protein       200   2e-57    Chlamydia gallinacea
ref|WP_020356125.1|  MULTISPECIES: ADP,ATP carrier protein              199   4e-57    Chlamydia
ref|NP_001046257.2|  Os02g0208100                                       187   4e-57    
gb|EKE09230.1|  hypothetical protein ACD_16C00205G0026                  196   4e-56    uncultured bacterium
gb|AEZ00863.1|  putative ATP-ADP-transporter protein                    187   5e-56    Elaeis guineensis
gb|AFS19476.1|  ADP/ATP carrier protein                                 184   3e-54    Chlamydia psittaci 84/55
ref|WP_018576123.1|  hypothetical protein                               190   1e-53    Legionella shakespearei
ref|WP_038460622.1|  ATPase AAA                                         186   4e-52    
ref|WP_013182747.1|  ATPase AAA                                         182   9e-51    Waddlia chondrophila
ref|WP_013950719.1|  ATPase AAA                                         182   1e-50    Candidatus Midichloria mitochondrii
emb|CCB92155.1|  ADP,ATP carrier protein 1                              182   1e-50    Waddlia chondrophila 2032/99
gb|KIC76343.1|  ADP,ATP carrier protein 1                               177   1e-48    Neochlamydia sp. EPS4
ref|WP_042241994.1|  ATPase AAA                                         177   1e-48    Neochlamydia sp. S13
ref|WP_013944554.1|  ATPase AAA                                         175   4e-48    Simkania negevensis
ref|WP_039383352.1|  ATPase AAA                                         175   4e-48    Neochlamydia sp. TUME1
ref|WP_034442354.1|  ATPase AAA                                         174   6e-48    
ref|WP_011174791.1|  ATPase AAA                                         174   1e-47    Candidatus Protochlamydia amoebophila
gb|KIC73929.1|  ADP,ATP carrier protein 1                               174   1e-47    Candidatus Protochlamydia amoebophila
ref|WP_039356292.1|  ATPase AAA                                         174   1e-47    Candidatus Protochlamydia amoebophila
ref|WP_031934367.1|  hypothetical protein                               172   3e-47    Candidatus Hepatobacter penaei
gb|ADR52253.1|  ATP/ADP translocase                                     171   4e-47    Candidatus Liberibacter solanacearum CLso-ZC1
gb|ACZ95367.1|  ATP/ADP translocase                                     172   4e-47    Candidatus Liberibacter solanacearum
ref|WP_044054082.1|  ATPase AAA                                         172   5e-47    
ref|WP_032124897.1|  ATPase AAA                                         172   7e-47    Candidatus Protochlamydia
ref|WP_042280889.1|  ATPase AAA                                         172   7e-47    Candidatus Protochlamydia sp. R18
ref|WP_004596612.1|  ADP,ATP carrier protein 1                          164   1e-46    
ref|WP_006341707.1|  ATPase AAA                                         171   1e-46    Parachlamydia acanthamoebae
ref|WP_042102375.1|  ATPase AAA                                         171   2e-46    Parachlamydiaceae bacterium HS-T3
gb|KIA76916.1|  ADP,ATP carrier protein 1                               171   2e-46    Parachlamydia acanthamoebae
ref|WP_006341708.1|  ATPase AAA                                         169   6e-46    Parachlamydia acanthamoebae
ref|WP_041018291.1|  ATPase AAA                                         168   2e-45    Criblamydia sequanensis
gb|ADI39042.1|  putative ADP/ATP translocase                            167   2e-45    Waddlia chondrophila WSU 86-1044
ref|WP_041941597.1|  ATPase AAA                                         167   4e-45    Waddlia chondrophila
gb|EMS36430.1|  ATP/ADP translocase                                     164   1e-44    Candidatus Liberibacter americanus PW_SP
ref|XP_005855475.1|  carrier protein                                    166   2e-44    Nannochloropsis gaditana CCMP526
ref|XP_002179404.1|  nucleotide transporter 2                           166   2e-44    Phaeodactylum tricornutum CCAP 1055/1
gb|AHA27724.1|  ATP/ADP translocase                                     164   2e-44    Candidatus Liberibacter americanus str. Sao Paulo
ref|WP_040055857.1|  ATPase AAA                                         164   3e-44    Candidatus Liberibacter americanus
gb|EWM29345.1|  carrier protein                                         166   3e-44    Nannochloropsis gaditana
ref|WP_004599717.1|  ATPase AAA                                         164   4e-44    Rickettsia prowazekii
ref|WP_014411976.1|  ATPase AAA                                         164   4e-44    Rickettsia prowazekii
emb|CAD29686.1|  nucleoside triphosphate protein                        164   5e-44    Caedimonas varicaedens
ref|WP_012461657.1|  ATPase AAA                                         164   5e-44    Orientia tsutsugamushi
ref|WP_032139269.1|  ATPase AAA                                         164   6e-44    
gb|ACX71867.1|  nucleotide tansporter                                   163   8e-44    
ref|XP_002982220.1|  hypothetical protein SELMODRAFT_116019             163   9e-44    
ref|WP_012778542.1|  ATPase AAA                                         163   9e-44    
ref|WP_011944393.1|  ATPase AAA                                         163   1e-43    
emb|CAD45254.1|  ADP/ATP carrier protein                                162   1e-43    
ref|WP_011190552.1|  ATPase AAA                                         162   1e-43    
emb|CDZ79514.1|  ADP/ATP translocase 1                                  162   2e-43    
ref|WP_012013291.1|  ATPase AAA                                         162   3e-43    
ref|WP_029374421.1|  ATPase AAA                                         161   3e-43    
emb|CAE46507.1|  nucleotide transport protein                           156   3e-43    
ref|WP_032112829.1|  ATPase AAA                                         162   4e-43    
ref|WP_016769753.1|  ATPase AAA                                         161   4e-43    
gb|AFK37381.1|  unknown                                                 154   5e-43    
ref|WP_010299901.1|  ATPase AAA                                         161   5e-43    
ref|WP_016917366.1|  ATPase AAA                                         160   8e-43    
ref|WP_012719352.1|  ATPase AAA                                         160   9e-43    
gb|EWM22407.1|  carrier protein                                         160   2e-42    
emb|CDZ79513.1|  ADP/ATP translocase 1                                  159   3e-42    
ref|WP_038465856.1|  ATPase AAA                                         159   4e-42    
ref|WP_006293548.1|  MULTISPECIES: ADP/ATP carrier protein family...    158   7e-42    
gb|AAM80566.1|  non-mitochondrial nucleotide transport protein          157   2e-41    
ref|WP_042102374.1|  ATPase AAA                                         157   3e-41    
emb|CAQ03489.1|  ATP/ADP translocase                                    156   5e-41    
ref|WP_041018292.1|  ATPase AAA                                         155   5e-41    
ref|WP_011526090.1|  ATPase AAA                                         156   6e-41    
ref|WP_042280890.1|  ATPase AAA                                         155   8e-41    
ref|WP_011174790.1|  ATPase AAA                                         155   1e-40    
gb|AAX45330.1|  ADP-ATP translocase                                     152   2e-40    
emb|CAE46504.1|  nucleotide transport protein                           148   8e-40    
emb|CBJ31945.1|  conserved unknown protein                              153   1e-39    
ref|XP_011398982.1|  Plastidic ATP/ADP-transporter                      152   1e-39    
ref|WP_032124896.1|  ATPase AAA                                         152   2e-39    
ref|WP_012461410.1|  ATPase AAA                                         151   2e-39    
emb|CAM79613.1|  ATP/ADP translocase                                    151   2e-39    
ref|WP_041621135.1|  ATPase AAA                                         151   2e-39    
ref|WP_039356289.1|  ATPase AAA                                         151   3e-39    
ref|WP_011478005.1|  ATPase AAA                                         150   3e-39    
ref|WP_012151548.1|  ATPase AAA                                         150   3e-39    
ref|XP_005823901.1|  hypothetical protein GUITHDRAFT_165621             151   3e-39    
ref|XP_005781451.1|  hypothetical protein EMIHUDRAFT_365981             141   5e-39    
ref|WP_004996827.1|  ATPase AAA                                         150   5e-39    
ref|WP_014363523.1|  ATPase AAA                                         150   7e-39    
ref|WP_012148204.1|  ATPase AAA                                         150   7e-39    
ref|XP_002293173.1|  predicted protein                                  150   1e-38    
ref|WP_014412084.1|  ATPase AAA                                         149   1e-38    
ref|WP_040256787.1|  ATPase AAA                                         149   1e-38    
ref|WP_014273134.1|  ATPase AAA                                         149   1e-38    
ref|WP_011270476.1|  MULTISPECIES: ATPase AAA                           149   2e-38    
ref|WP_012736586.1|  ATPase AAA                                         149   2e-38    
ref|WP_012150309.1|  ATPase AAA                                         149   2e-38    
ref|WP_014364363.1|  ATPase AAA                                         149   2e-38    
ref|WP_014120469.1|  ATPase AAA                                         149   2e-38    
ref|WP_029374502.1|  ATPase AAA                                         149   2e-38    
ref|WP_014410317.1|  ATPase AAA                                         148   2e-38    
ref|WP_016770196.1|  ADP,ATP carrier protein 4                          149   2e-38    
ref|WP_014363914.1|  pyruvate phosphate dikinase                        149   2e-38    
ref|WP_014120818.1|  ADP,ATP carrier protein                            149   2e-38    
ref|WP_010976765.1|  ATPase AAA                                         148   2e-38    
ref|WP_023507442.1|  ADP/ATP translocase 1                              148   2e-38    
ref|WP_014013803.1|  ATPase AAA                                         148   2e-38    
ref|WP_014391766.1|  ATPase AAA                                         148   2e-38    
ref|WP_012152377.1|  ATPase AAA                                         148   2e-38    
ref|WP_029374609.1|  ATPase AAA                                         148   2e-38    
ref|WP_014365220.1|  ATPase AAA                                         148   2e-38    
ref|WP_012148719.1|  pyruvate phosphate dikinase                        148   3e-38    
ref|WP_013943650.1|  ADP,ATP carrier protein 1                          148   3e-38    
ref|WP_014410725.1|  ADP,ATP carrier protein                            148   3e-38    
ref|WP_016728187.1|  ADP,ATP carrier protein 4                          148   3e-38    
ref|WP_004995670.1|  ADPATP carrier protein                             148   3e-38    
ref|WP_034879435.1|  hypothetical protein                               147   3e-38    
ref|WP_008580200.1|  ADP,ATP carrier protein 4                          147   4e-38    
ref|WP_016926283.1|  ADP,ATP carrier protein 4                          147   4e-38    
ref|WP_016945702.1|  ADP,ATP carrier protein 4                          147   5e-38    
ref|WP_016830784.1|  ADP,ATP carrier protein 4                          147   5e-38    
ref|WP_017442936.1|  ADP,ATP carrier protein 4                          147   5e-38    
ref|WP_010977290.1|  ADP,ATP carrier protein                            147   5e-38    
ref|WP_017443549.1|  ATPase AAA                                         147   6e-38    
ref|WP_008579514.1|  MULTISPECIES: ATPase AAA                           147   6e-38    
ref|WP_011271054.1|  ADP,ATP carrier protein                            147   6e-38    
ref|WP_037214447.1|  ADP/ATP carrier protein                            147   7e-38    
ref|WP_040255633.1|  ADP/ATP carrier protein                            147   7e-38    
emb|CAD45252.1|  ADP/ATP carrier protein                                147   8e-38    
ref|WP_010420545.1|  ATPase AAA                                         147   8e-38    
ref|WP_014409826.1|  ATPase AAA                                         147   8e-38    
ref|WP_040458412.1|  hypothetical protein                               146   9e-38    
ref|WP_014273500.1|  ATP/ADP translocase                                147   9e-38    
ref|WP_023508175.1|  ADP/ATP translocase 1                              147   1e-37    
ref|WP_014409200.1|  ATP/ADP translocase                                146   1e-37    
ref|WP_014408640.1|  ATP/ADP translocase                                146   1e-37    
gb|ABV84832.1|  ATP/ADP translocase                                     146   1e-37    
ref|WP_041404689.1|  ADP/ATP carrier protein                            146   1e-37    
ref|WP_039383351.1|  ATPase AAA                                         146   1e-37    
gb|KIC76344.1|  ADP,ATP carrier protein 1                               146   1e-37    
ref|WP_042241991.1|  ATPase AAA                                         146   1e-37    
gb|ABV25595.1|  plastid ATP/ADP translocase                             146   1e-37    
ref|WP_011477438.1|  ATP/ADP translocase                                146   1e-37    
ref|WP_012719726.1|  ATP/ADP translocase                                146   2e-37    
ref|WP_014014348.1|  ADP,ATP carrier protein                            145   2e-37    
ref|WP_012736359.1|  ADP,ATP carrier protein                            145   2e-37    
ref|WP_014362945.1|  MULTISPECIES: ADP,ATP carrier protein              145   2e-37    
ref|WP_012150855.1|  ADP,ATP carrier protein                            145   2e-37    
emb|CAD45262.1|  ADP/ATP carrier protein                                145   2e-37    
emb|CAE46502.1|  nucleotide transport protein                           143   3e-37    
ref|WP_014365801.1|  ATP/ADP translocase                                145   3e-37    
ref|WP_014412733.1|  ATP/ADP translocase                                145   3e-37    
ref|WP_041078749.1|  ADP/ATP carrier protein                            145   4e-37    
ref|WP_014409011.1|  ATP/ADP translocase                                145   4e-37    
gb|ABV85155.1|  ATP/ADP translocase                                     145   4e-37    
ref|WP_014408143.1|  ATPase AAA                                         145   4e-37    
ref|WP_041404846.1|  ADP/ATP carrier protein                            144   5e-37    
ref|WP_012151976.1|  ATP/ADP translocase                                145   5e-37    
ref|WP_023507537.1|  ADP/ATP translocase 1                              144   7e-37    
ref|WP_032138981.1|  ADP/ATP carrier protein                            144   7e-37    
ref|WP_011476837.1|  ATP/ADP translocase                                144   8e-37    
ref|WP_008579634.1|  MULTISPECIES: ADP,ATP carrier protein              144   9e-37    
ref|WP_012149628.1|  ADP,ATP carrier protein                            144   9e-37    
ref|WP_017442597.1|  ADP,ATP carrier protein 5                          144   1e-36    
ref|WP_014364180.1|  ADP,ATP carrier protein                            144   1e-36    
emb|CAD45261.1|  ADP/ATP carrier protein                                144   1e-36    
ref|WP_014409567.1|  ADP,ATP carrier protein                            143   1e-36    
ref|WP_012149067.1|  ADP,ATP carrier protein                            143   1e-36    
ref|WP_039455652.1|  hypothetical protein                               143   1e-36    
ref|WP_016916813.1|  ADP,ATP carrier protein 4                          143   1e-36    
emb|CAD45266.1|  ADP/ATP carrier protein                                143   1e-36    
ref|WP_038539003.1|  hypothetical protein                               143   1e-36    
ref|WP_014392274.1|  ATP/ADP translocase                                143   1e-36    
emb|CBJ27483.1|  ADP-ATP translocase                                    143   2e-36    
gb|EJK47706.1|  hypothetical protein THAOC_33559                        144   2e-36    
ref|WP_032138622.1|  ADP/ATP carrier protein                            142   2e-36    
ref|WP_010423014.1|  ATP/ADP translocase                                142   3e-36    
ref|WP_014365452.1|  ATP/ADP translocase                                142   3e-36    
ref|WP_014392737.1|  ATP/ADP translocase                                142   3e-36    
ref|WP_011190940.1|  ADP/ATP carrier protein 4                          142   3e-36    
ref|WP_011270513.1|  ADP,ATP carrier protein                            142   4e-36    
ref|WP_041816792.1|  ADP/ATP carrier protein                            142   5e-36    
gb|ABV75397.1|  ADP,ATP carrier protein                                 141   6e-36    
ref|WP_014412334.1|  ADP,ATP carrier protein                            141   6e-36    
ref|WP_026071769.1|  ATPase AAA                                         142   6e-36    
ref|WP_010977709.1|  ADP,ATP carrier protein                            141   6e-36    
ref|WP_041078250.1|  ADP/ATP carrier protein                            141   6e-36    
gb|AEV92626.1|  ATP/ADP translocase                                     141   6e-36    
ref|WP_004597746.1|  ADP,ATP carrier protein 4                          141   7e-36    
ref|WP_014121056.1|  ATP/ADP translocase                                141   7e-36    
ref|WP_012736677.1|  ADP,ATP carrier protein                            141   7e-36    
ref|WP_016945927.1|  ADP,ATP carrier protein 5                          141   7e-36    
ref|WP_011458427.1|  ATPase AAA                                         142   7e-36    
ref|WP_014014739.1|  ADP,ATP carrier protein                            141   7e-36    
ref|WP_016830942.1|  ADP,ATP carrier protein 5                          141   7e-36    
ref|WP_012719990.1|  MULTISPECIES: ATP/ADP translocase                  141   7e-36    
gb|ABV76706.1|  ADP,ATP carrier protein                                 141   7e-36    
ref|WP_016926548.1|  ADP,ATP carrier protein 5                          141   8e-36    
ref|WP_040256305.1|  ADP/ATP carrier protein                            141   8e-36    
ref|WP_014419937.1|  MULTISPECIES: ATP/ADP translocase                  141   8e-36    
emb|CAD45265.1|  ADP/ATP carrier protein                                141   9e-36    
ref|WP_012262574.1|  MULTISPECIES: ADP,ATP carrier protein              141   9e-36    
gb|EAA26151.1|  ADPATP carrier protein                                  141   9e-36    
ref|WP_016770338.1|  ADP,ATP carrier protein 5                          141   9e-36    
ref|WP_004597024.1|  Hemolysin C                                        141   1e-35    
ref|WP_016728342.1|  ADP,ATP carrier protein 5                          141   1e-35    
ref|WP_010421381.1|  ADP,ATP carrier protein                            141   1e-35    
emb|CAD45264.1|  ADP/ATP carrier protein                                140   1e-35    
ref|WP_011191157.1|  ADP/ATP carrier protein 5                          140   1e-35    
ref|WP_013181317.1|  ADP/ATP translocase                                139   3e-35    
ref|WP_006342008.1|  translocase                                        139   7e-35    
ref|XP_005651919.1|  plastidic ADP/ATP translocase                      138   7e-35    
ref|XP_010419393.1|  PREDICTED: ADP,ATP carrier protein 1, chloro...    131   8e-35    
ref|WP_011006099.1|  ATPase AAA                                         138   9e-35    
gb|EPJ26965.1|  ADP/ATP carrier family protein                          137   2e-34    
ref|WP_019231187.1|  hypothetical protein                               137   3e-34    
ref|WP_041621816.1|  ADP/ATP carrier protein                            136   4e-34    
ref|WP_041621426.1|  ADP/ATP carrier protein                            136   4e-34    
emb|CAM79378.1|  ATP/ADP translocase                                    136   4e-34    
gb|AFS21988.1|  ADP/ATP carrier family protein                          136   4e-34    
gb|AFS20239.1|  ADP/ATP carrier family protein                          136   4e-34    
dbj|BAG40558.1|  ADP,ATP carrier protein homolog                        136   4e-34    
gb|EPJ32453.1|  ADP/ATP carrier family protein                          136   6e-34    
ref|WP_006343793.1|  ATPase AAA                                         136   8e-34    
ref|WP_014944735.1|  ATPase AAA                                         136   8e-34    
ref|WP_011096845.1|  ATPase AAA                                         135   8e-34    
ref|WP_016966618.1|  ADP/ATP carrier family protein                     135   9e-34    
ref|WP_006342801.1|  ATPase AAA                                         135   9e-34    
ref|WP_019230826.1|  hypothetical protein                               135   1e-33    
ref|WP_014517560.1|  ATPase AAA                                         135   1e-33    
ref|XP_003061065.1|  ATP:ADP antiporter family                          136   1e-33    
ref|WP_010883252.1|  ATPase AAA                                         135   1e-33    
ref|WP_004597535.1|  Malate dehydrogenase                               135   2e-33    
ref|WP_011477389.1|  ATPase AAA                                         134   2e-33    
gb|EPP36532.1|  ADP/ATP carrier family protein                          134   2e-33    
ref|WP_019231521.1|  hypothetical protein                               134   3e-33    
ref|WP_014412653.1|  ATPase AAA                                         134   3e-33    
ref|WP_042103597.1|  ATPase AAA                                         134   3e-33    
gb|AHK63775.1|  ADP,ATP carrier protein 2                               134   5e-33    
ref|WP_011190829.1|  ADP/ATP carrier protein 2                          133   5e-33    
ref|WP_020359192.1|  MULTISPECIES: ADP/ATP carrier family protein       134   5e-33    
ref|WP_004599439.1|  ADP,ATP carrier protein 2                          133   5e-33    
ref|WP_020370844.1|  MULTISPECIES: ADP/ATP carrier family protein       133   8e-33    
ref|WP_022174379.1|  aDP ATP carrier protein                            132   9e-33    
ref|WP_041017341.1|  hypothetical protein                               132   1e-32    
gb|EWM20928.1|  carrier protein                                         134   2e-32    
ref|XP_003083204.1|  unnamed protein product                            134   2e-32    
ref|WP_010422925.1|  ATPase AAA                                         132   2e-32    
ref|WP_012149674.1|  ATPase AAA                                         131   3e-32    
ref|WP_023508224.1|  ADP/ATP translocase 1                              131   3e-32    
ref|WP_012150908.1|  ATPase AAA                                         131   3e-32    
emb|CAD45259.1|  ADP/ATP carrier protein                                130   4e-32    
ref|WP_004597720.1|  ADP,ATP carrier protein 3                          127   5e-32    
ref|WP_021828898.1|  MULTISPECIES: ADP/ATP carrier family protein       130   5e-32    
ref|WP_012148616.1|  ATPase AAA                                         130   6e-32    
emb|CAD45257.1|  ADP/ATP carrier protein                                130   6e-32    
ref|WP_014363850.1|  ATPase AAA                                         130   6e-32    
ref|WP_040255821.1|  ATPase AAA                                         130   7e-32    
ref|WP_039595009.1|  ATPase AAA                                         130   9e-32    
ref|WP_011271165.1|  ATPase AAA                                         130   9e-32    
ref|WP_004998312.1|  ATPase AAA                                         130   9e-32    
ref|WP_016916871.1|  ATPase AAA                                         130   9e-32    
ref|WP_014410778.1|  ATPase AAA                                         129   1e-31    
ref|WP_014273542.1|  MULTISPECIES: ATPase AAA                           129   1e-31    
ref|WP_014120865.1|  ATPase AAA                                         129   1e-31    
ref|WP_014014428.1|  ATPase AAA                                         129   1e-31    
ref|XP_002118821.1|  hypothetical protein TRIADDRAFT_9522               122   1e-31    



>gb|ABO87603.1| chloroplast ATP/ADP translocator [Pisum sativum]
Length=280

 Score =   377 bits (967),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGVAAKI
Sbjct  36   SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSQYIFDKYGWGVAAKI  95

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P+AP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  96   TPTVLLLTGVGFFSLILFGGPIAPGLASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  155

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  156  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  215

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL AAKSLD QFTA
Sbjct  216  LAWLGAAKSLDTQFTA  231



>gb|AFD54199.1| gibberellin 3-beta-dioxygenase 4, partial [Vitis vinifera]
Length=317

 Score =   375 bits (963),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWG AAKI
Sbjct  66   SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGAAAKI  125

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P AP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  126  TPTVLLLTGVGFFSLILFGDPFAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  185

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV
Sbjct  186  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIV  245

Query  541  LAWLSAAKSLDVQFTA  588
            +AWL+AAKSLD QFTA
Sbjct  246  VAWLAAAKSLDTQFTA  261



>ref|XP_010099654.1| Plastidic [Morus notabilis]
 gb|EXB80175.1| Plastidic [Morus notabilis]
Length=620

 Score =   384 bits (985),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P APTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVGFFSLILFGGPFAPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  552

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AA+SLD QFTALR+
Sbjct  553  LAWLAAARSLDTQFTALRQ  571



>ref|XP_004252326.1| PREDICTED: plastidic ATP/ADP-transporter [Solanum lycopersicum]
Length=629

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+FDKYGWG AAKI
Sbjct  377  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFDKYGWGAAAKI  436

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFGAPLAPTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  437  TPTVLLLTGVGFFSLLLFGAPLAPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  496

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGGVLLVIV
Sbjct  497  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIV  556

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AAKSLD QFT LR 
Sbjct  557  LAWLAAAKSLDQQFTQLRH  575



>ref|NP_001274794.1| plastidic ATP/ADP-transporter [Solanum tuberosum]
 sp|O24381.2|TLC1_SOLTU RecName: Full=Plastidic ATP/ADP-transporter [Solanum tuberosum]
 emb|CAA71785.1| plastidic ATP/ADP-transporter [Solanum tuberosum]
Length=631

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+FDKYGWG AAKI
Sbjct  379  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFDKYGWGAAAKI  438

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFGAPLAPTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  439  TPTVLLLTGVGFFSLLLFGAPLAPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  498

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGGVLLVIV
Sbjct  499  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIV  558

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AAKSLD QFT LR+
Sbjct  559  LAWLGAAKSLDGQFTQLRQ  577



>ref|XP_004235723.1| PREDICTED: plastidic ATP/ADP-transporter-like [Solanum lycopersicum]
Length=625

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/197 (96%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+FDKYGWG AAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFDKYGWGTAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAPTLA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGDPLAPTLAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  492  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  551

Query  541  LAWLSAAKSLDVQFTAL  591
            LAWL+AA+SLD QFTAL
Sbjct  552  LAWLAAARSLDGQFTAL  568



>ref|XP_011035631.1| PREDICTED: plastidic ATP/ADP-transporter-like [Populus euphratica]
Length=621

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAKI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVGFFSLILFGGPLVPTLAQFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  549

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AAKSLD QFTALR+
Sbjct  550  LAWLAAAKSLDTQFTALRQ  568



>ref|XP_002298119.2| Chloroplast ADP family protein [Populus trichocarpa]
 gb|EEE82924.2| Chloroplast ADP family protein [Populus trichocarpa]
Length=621

 Score =   382 bits (981),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAKI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVGFFSLILFGGPLVPTLAQFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  549

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AAKSLD QFTALR+
Sbjct  550  LAWLAAAKSLDTQFTALRQ  568



>ref|XP_004506888.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cicer arietinum]
Length=618

 Score =   381 bits (979),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGVAAKI
Sbjct  374  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSQYIFDKYGWGVAAKI  433

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA+ GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  434  TPTVLLLTGVGFFSLILFGGPLAPGLASLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  493

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  494  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  553

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AAKSLD QFTALR+
Sbjct  554  LAWLAAAKSLDTQFTALRQ  572



>gb|ABG37645.1| plastid ATP/ADP-transporter [Populus trichocarpa]
Length=774

 Score =   385 bits (989),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFSTATGIATF+MMLLSQ++FDKYGWGVAAKI
Sbjct  523  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTATGIATFSMMLLSQFIFDKYGWGVAAKI  582

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAPTL  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  583  TPTVLLLTGVGFFSLILFGGPLAPTLTQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  642

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  643  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  702

Query  541  LAWLSAAKSLDVQFTALRR  597
             AWL AAKSLD QFTALR+
Sbjct  703  FAWLGAAKSLDTQFTALRQ  721



>gb|AAS82778.1| plastidic ATP/ADP-transporter [Helianthus tuberosus]
Length=459

 Score =   375 bits (963),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWGVAAKI
Sbjct  219  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGVAAKI  278

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLL+GVGFFSLILFG PLAP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  279  TPTVLLLSGVGFFSLILFGDPLAPGLMKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCK  338

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  339  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  398

Query  541  LAWLSAAKSLDVQFTALRR  597
             AWL AA+SLD QFTALR+
Sbjct  399  GAWLGAARSLDKQFTALRQ  417



>gb|EYU24674.1| hypothetical protein MIMGU_mgv1a002918mg [Erythranthe guttata]
Length=625

 Score =   380 bits (976),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFP+PNEYSSFMGDFSTATGIATFTMMLLSQW+F KYGWGVAAKI
Sbjct  375  SINLVEVTWKSKLKAQFPTPNEYSSFMGDFSTATGIATFTMMLLSQWIFSKYGWGVAAKI  434

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  435  TPTVLLLTGVGFFSLLLFGGPLGPALANFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  494

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  495  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  554

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AAKSLD QFTALR+
Sbjct  555  LAWLGAAKSLDGQFTALRQ  573



>gb|KEH28732.1| plastidic ATP/ADP-transporter-like protein [Medicago truncatula]
Length=629

 Score =   380 bits (977),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 188/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGVAAKI
Sbjct  385  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSQYIFDKYGWGVAAKI  444

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P+AP LA+ GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  445  TPTVLLLTGVGFFSLILFGGPIAPGLASIGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  504

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  505  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  564

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AAKSLD QFTALR+
Sbjct  565  LAWLGAAKSLDTQFTALRQ  583



>ref|XP_011039999.1| PREDICTED: plastidic ATP/ADP-transporter-like [Populus euphratica]
Length=623

 Score =   380 bits (976),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 189/199 (95%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFSTATGIATFTMMLLSQ +FDKYGWGVAAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTATGIATFTMMLLSQLIFDKYGWGVAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAPTL  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGGPLAPTLTQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  492  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  551

Query  541  LAWLSAAKSLDVQFTALRR  597
             AWL AAKSLD QFTALR+
Sbjct  552  FAWLGAAKSLDTQFTALRQ  570



>ref|XP_007150697.1| hypothetical protein PHAVU_005G174000g [Phaseolus vulgaris]
 gb|ESW22691.1| hypothetical protein PHAVU_005G174000g [Phaseolus vulgaris]
Length=617

 Score =   380 bits (975),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGVAAKI
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFAMMLLSQFIFDKYGWGVAAKI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P+AP +A FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGGPVAPVIAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  550

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AAKSLD QFT LRR
Sbjct  551  LAWLAAAKSLDSQFTDLRR  569



>gb|AAT73075.1| plastidic ATP/ADP transporter [Helianthus tuberosus]
Length=459

 Score =   374 bits (961),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLK QFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWGVAAKI
Sbjct  219  SINLVEVTWKSKLKVQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGVAAKI  278

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLL+GVGFFSLILFG PLAP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  279  TPTVLLLSGVGFFSLILFGDPLAPGLMKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCK  338

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  339  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  398

Query  541  LAWLSAAKSLDVQFTALRR  597
             AWL AA+SLD QFTALR+
Sbjct  399  GAWLGAARSLDKQFTALRQ  417



>gb|KJB13104.1| hypothetical protein B456_002G057300 [Gossypium raimondii]
Length=619

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWG AA+I
Sbjct  369  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGAAARI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL PTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  429  TPTVLLLTGVGFFSLILFGDPLGPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  488

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGG+LLVIV
Sbjct  489  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGILLVIV  548

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AAKSLD QFTALR+
Sbjct  549  LAWLAAAKSLDTQFTALRQ  567



>gb|KJB13103.1| hypothetical protein B456_002G057300 [Gossypium raimondii]
Length=621

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWG AA+I
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGAAARI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL PTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGDPLGPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGG+LLVIV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGILLVIV  550

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AAKSLD QFTALR+
Sbjct  551  LAWLAAAKSLDTQFTALRQ  569



>gb|AAT99359.1| chloroplast ATP/ADP transporter protein [Helianthus tuberosus]
Length=487

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWGVAAKI
Sbjct  247  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGVAAKI  306

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLL+GVGFFSLILFG PLAP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  307  TPTVLLLSGVGFFSLILFGDPLAPGLMKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCK  366

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  367  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  426

Query  541  LAWLSAAKSLDVQFTALRR  597
             AWL AA+SLD QFTALR+
Sbjct  427  GAWLGAARSLDKQFTALRQ  445



>ref|XP_002303268.1| Chloroplast ADP family protein [Populus trichocarpa]
 gb|EEE78247.1| Chloroplast ADP family protein [Populus trichocarpa]
Length=623

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFSTATGIATF+MMLLSQ++FDKYGWGVAAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTATGIATFSMMLLSQFIFDKYGWGVAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAPTL  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGGPLAPTLTQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  492  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  551

Query  541  LAWLSAAKSLDVQFTALRR  597
             AWL AAKSLD QFTALR+
Sbjct  552  FAWLGAAKSLDTQFTALRQ  570



>ref|XP_006465406.1| PREDICTED: LOW QUALITY PROTEIN: plastidic ATP/ADP-transporter-like 
[Citrus sinensis]
Length=609

 Score =   378 bits (971),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ+VFDK+GWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFVFDKFGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVGFFSLLLFGDPLGPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  552

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QFTALR+
Sbjct  553  LAWLGAARSLDTQFTALRQ  571



>ref|XP_004487222.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cicer arietinum]
Length=632

 Score =   379 bits (972),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML+SQ++FDKYGWGVAAKI
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLVSQFIFDKYGWGVAAKI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP+VLL+TGVGFFSLILFG PLAP +   G+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  441  TPSVLLMTGVGFFSLILFGDPLAPVIGKLGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  501  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  560

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWLSAAKSLD QFTALRR
Sbjct  561  LAWLSAAKSLDTQFTALRR  579



>gb|AAM29152.1| plastidic ATP/ADP transporter [Citrus hybrid cultivar]
Length=588

 Score =   377 bits (968),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDK+GWGVAAKI
Sbjct  352  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKFGWGVAAKI  411

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  412  TPTVLLLTGVGFFSLLLFGDPLGPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  471

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  472  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  531

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QFTALR+
Sbjct  532  LAWLGAARSLDTQFTALRQ  550



>ref|XP_006427151.1| hypothetical protein CICLE_v10025170mg [Citrus clementina]
 gb|ESR40391.1| hypothetical protein CICLE_v10025170mg [Citrus clementina]
Length=621

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDK+GWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKFGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVGFFSLLLFGDPLGPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  552

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QFTALR+
Sbjct  553  LAWLGAARSLDTQFTALRQ  571



>ref|XP_006341665.1| PREDICTED: plastidic ATP/ADP-transporter-like [Solanum tuberosum]
Length=626

 Score =   378 bits (971),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+FDKYGWG AAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFDKYGWGTAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAPTL  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVGFFSLILFGDPLAPTLTKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGGVLLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGVLLVIV  552

Query  541  LAWLSAAKSLDVQFTAL  591
            LAWL AA+SLD QFTAL
Sbjct  553  LAWLGAARSLDGQFTAL  569



>ref|XP_003543665.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=615

 Score =   378 bits (970),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGVAAKI
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSQFIFDKYGWGVAAKI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P+AP +A FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVGFFSLILFGGPIAPVIAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  549

Query  541  LAWLSAAKSLDVQFTA  588
            LAWLSAAKSLD QFTA
Sbjct  550  LAWLSAAKSLDTQFTA  565



>gb|KHN44149.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=615

 Score =   377 bits (969),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 187/196 (95%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGVAAKI
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSQFIFDKYGWGVAAKI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P+AP +A FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVGFFSLILFGGPIAPVIAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  549

Query  541  LAWLSAAKSLDVQFTA  588
            LAWLSAAKSLD QFTA
Sbjct  550  LAWLSAAKSLDTQFTA  565



>gb|EYU21596.1| hypothetical protein MIMGU_mgv1a002865mg [Erythranthe guttata]
Length=629

 Score =   378 bits (970),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFP+PNEYSSFMGDFSTATGIATF MMLLSQWVF+KYGWGVAAKI
Sbjct  377  SINLVEVTWKSKLKAQFPTPNEYSSFMGDFSTATGIATFIMMLLSQWVFNKYGWGVAAKI  436

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL+P LA  G+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  437  TPTVLLLTGVGFFSLILFGGPLSPALAGIGVTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  496

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  497  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  556

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AAKSLD QFTALR+
Sbjct  557  LAWLGAAKSLDTQFTALRQ  575



>ref|XP_011072264.1| PREDICTED: plastidic ATP/ADP-transporter-like [Sesamum indicum]
Length=626

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFP+PNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWG AAKI
Sbjct  378  SINLVEVTWKSKLKAQFPTPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGTAAKI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA  GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  438  TPTVLLLTGVGFFSLILFGDPLAPGLAKIGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  557

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AAKSLD QFTALR+
Sbjct  558  LAWLGAAKSLDGQFTALRQ  576



>ref|XP_011081074.1| PREDICTED: plastidic ATP/ADP-transporter [Sesamum indicum]
Length=630

 Score =   376 bits (965),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFP+PNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWGVAAKI
Sbjct  378  SINLVEVTWKSKLKAQFPTPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGVAAKI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  438  TPTVLLLTGVGFFSLILFGDPLAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  557

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL AAKSLD QFTA
Sbjct  558  LAWLGAAKSLDGQFTA  573



>gb|KJB68136.1| hypothetical protein B456_010G227600 [Gossypium raimondii]
Length=615

 Score =   375 bits (963),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  365  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAKI  424

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  425  TPTVLLLTGVGFFSLILFGDPLGPALAEFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  484

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV
Sbjct  485  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLMIV  544

Query  541  LAWLSAAKSLDVQFTAL  591
              WLSAAKSLD QFTAL
Sbjct  545  FTWLSAAKSLDTQFTAL  561



>ref|XP_010033911.1| PREDICTED: plastidic ATP/ADP-transporter-like [Eucalyptus grandis]
 gb|KCW53783.1| hypothetical protein EUGRSUZ_J03031 [Eucalyptus grandis]
Length=615

 Score =   375 bits (963),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLS++VFDKYGWGVAAKI
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSRYVFDKYGWGVAAKI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FFSL+LFG PL PTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLVTGVAFFSLVLFGGPLVPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIV  550

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AAKSLD QFT LR+
Sbjct  551  LAWLAAAKSLDAQFTTLRQ  569



>emb|CBI36236.3| unnamed protein product [Vitis vinifera]
Length=555

 Score =   373 bits (958),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWG AAKI
Sbjct  304  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGAAAKI  363

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P AP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  364  TPTVLLLTGVGFFSLILFGDPFAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  423

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV
Sbjct  424  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIV  483

Query  541  LAWLSAAKSLDVQFTA  588
            +AWL+AAKSLD QFTA
Sbjct  484  VAWLAAAKSLDTQFTA  499



>ref|XP_009758418.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nicotiana sylvestris]
Length=629

 Score =   375 bits (964),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 186/196 (95%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+FDKYGWG AAKI
Sbjct  376  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFDKYGWGTAAKI  435

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  436  TPTVLLLTGVGFFSLILFGDPLAPALAKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCK  495

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  496  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  555

Query  541  LAWLSAAKSLDVQFTA  588
            L WL AA+SLD QFTA
Sbjct  556  LGWLGAARSLDGQFTA  571



>ref|XP_009767462.1| PREDICTED: plastidic ATP/ADP-transporter [Nicotiana sylvestris]
Length=631

 Score =   376 bits (965),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQW+FDKYGWG AAKI
Sbjct  379  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFVMMLLSQWIFDKYGWGAAAKI  438

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTG+GFFSLILFGAPLAP LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  439  TPTVLLLTGIGFFSLILFGAPLAPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  498

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGGVLLVIV
Sbjct  499  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIV  558

Query  541  LAWLSAAKSLDVQFT  585
            LAWL AAKSLD QFT
Sbjct  559  LAWLGAAKSLDAQFT  573



>gb|KHG23248.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=612

 Score =   375 bits (963),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAA I
Sbjct  369  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAGI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLL+GVGFFSLILFG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  429  TPTVLLLSGVGFFSLILFGGPLGPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  488

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  489  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  548

Query  541  LAWLSAAKSLDVQFT  585
            LAWLSAAKSLD QFT
Sbjct  549  LAWLSAAKSLDTQFT  563



>gb|KHG10295.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=630

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWG AA+I
Sbjct  380  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGAAAQI  439

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL  TLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  440  TPTVLLLTGVGFFSLILFGDPLGLTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  499

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGG+LLVIV
Sbjct  500  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGILLVIV  559

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AAKSLD QFTALR+
Sbjct  560  LAWLEAAKSLDTQFTALRQ  578



>ref|XP_009595520.1| PREDICTED: plastidic ATP/ADP-transporter [Nicotiana tomentosiformis]
Length=631

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQW+FDKYGWG AAKI
Sbjct  379  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFVMMLLSQWIFDKYGWGAAAKI  438

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTG+GFFSLILFGAPLAP LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  439  TPTVLLLTGIGFFSLILFGAPLAPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  498

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLGGVLLVIV
Sbjct  499  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGGVLLVIV  558

Query  541  LAWLSAAKSLDVQFT  585
            LAWL AAKSLD QFT
Sbjct  559  LAWLGAAKSLDGQFT  573



>ref|XP_010254276.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nelumbo nucifera]
Length=620

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATG+ATFTMMLLSQW+FDKYGWGVAAKI
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGVATFTMMLLSQWIFDKYGWGVAAKI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP +   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGGPLAPAIGKLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  550

Query  541  LAWLSAAKSLDVQFTA  588
             AWL+AAKSLD QF A
Sbjct  551  FAWLAAAKSLDGQFNA  566



>gb|KJB70559.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
 gb|KJB70562.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
Length=609

 Score =   374 bits (959),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAA I
Sbjct  369  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAGI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLL+GVGFFSLILFG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  429  TPTVLLLSGVGFFSLILFGGPLGPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  488

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  489  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  548

Query  541  LAWLSAAKSLDVQFT  585
            LAWLSAAKSLD QFT
Sbjct  549  LAWLSAAKSLDSQFT  563



>ref|XP_007023973.1| TLC ATP/ADP transporter isoform 1 [Theobroma cacao]
 gb|EOY26595.1| TLC ATP/ADP transporter isoform 1 [Theobroma cacao]
Length=620

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/196 (96%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAKI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL   LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVGFFSLILFGDPLGLGLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  549

Query  541  LAWLSAAKSLDVQFTA  588
            LAWLSAAKSLD QFTA
Sbjct  550  LAWLSAAKSLDTQFTA  565



>ref|XP_009624271.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nicotiana tomentosiformis]
Length=631

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+FDKYGWG AAKI
Sbjct  378  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFDKYGWGTAAKI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  438  TPTVLLLTGVGFFSLILFGDPLAPALAKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  557

Query  541  LAWLSAAKSLDVQFTA  588
            + WL AA+SLD QFTA
Sbjct  558  VGWLGAARSLDGQFTA  573



>gb|KDP37155.1| hypothetical protein JCGZ_06211 [Jatropha curcas]
Length=623

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSQYIFDKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVGFFSLILFGGPLAPALAQFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG LLVIV
Sbjct  493  EMAYIPLDEETKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGTLLVIV  552

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL+AAKSLD QFTA
Sbjct  553  LAWLAAAKSLDTQFTA  568



>emb|CAN83628.1| hypothetical protein VITISV_019239 [Vitis vinifera]
Length=617

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWG AAKI
Sbjct  365  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGAAAKI  424

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P AP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  425  TPTVLLLTGVGFFSLILFGDPFAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  484

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV
Sbjct  485  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIV  544

Query  541  LAWLSAAKSLDVQFTA  588
            +AWL+AAKSLD QFTA
Sbjct  545  VAWLAAAKSLDTQFTA  560



>ref|XP_002285232.1| PREDICTED: plastidic ATP/ADP-transporter [Vitis vinifera]
Length=621

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+F+KYGWG AAKI
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFNKYGWGAAAKI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P AP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVGFFSLILFGDPFAPALAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIV  549

Query  541  LAWLSAAKSLDVQFTA  588
            +AWL+AAKSLD QFTA
Sbjct  550  VAWLAAAKSLDTQFTA  565



>emb|CDO98099.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   373 bits (957),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQW+FDKYGWGVAA I
Sbjct  379  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWIFDKYGWGVAATI  438

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P  P+LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  439  TPTVLLLTGVGFFSLILFGDPFGPSLAKFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  498

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TK+KGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV
Sbjct  499  EMAYIPLDEETKIKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLIIV  558

Query  541  LAWLSAAKSLDVQFTALRR  597
             AWL+AA+SLD QFTALR 
Sbjct  559  GAWLAAARSLDGQFTALRH  577



>ref|XP_008377604.1| PREDICTED: plastidic ATP/ADP-transporter-like [Malus domestica]
Length=623

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ +F+KYGWGVAAKI
Sbjct  374  SINVVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQVIFEKYGWGVAAKI  433

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL+P +A+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  434  TPTVLLLTGVGFFSLILFGGPLSPAIASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  493

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  494  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  553

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AA SLD QFTALR+
Sbjct  554  LAWLAAASSLDKQFTALRQ  572



>ref|XP_010061949.1| PREDICTED: plastidic ATP/ADP-transporter-like [Eucalyptus grandis]
 gb|KCW68998.1| hypothetical protein EUGRSUZ_F02558 [Eucalyptus grandis]
Length=623

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATG+ TF+MMLLSQ +F+KYGWGVAAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGVMTFSMMLLSQVIFNKYGWGVAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PLAP+LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLLLFGDPLAPSLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  492  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  551

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AA+SL+ QF+ALR+
Sbjct  552  LAWLAAARSLETQFSALRQ  570



>gb|AAZ23107.1| plastid ATP/ADP transport protein 2 [Manihot esculenta]
Length=623

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/196 (94%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQYIFDKYGWGVAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP L+ FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGGPLAPVLSQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG LLVIV
Sbjct  492  EMAYIPLDEETKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGTLLVIV  551

Query  541  LAWLSAAKSLDVQFTA  588
            L WL+AA+SLD QFTA
Sbjct  552  LLWLAAARSLDTQFTA  567



>ref|XP_004302940.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=613

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++F+KYGWGVAAKI
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFEKYGWGVAAKI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL+P +A+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGGPLSPAIASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  550

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL AA+SLD QFTA
Sbjct  551  LAWLGAARSLDTQFTA  566



>gb|KJB56643.1| hypothetical protein B456_009G129100 [Gossypium raimondii]
Length=619

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFST TGIATF MMLLSQ++FDKYGWGVAA I
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTGTGIATFIMMLLSQFIFDKYGWGVAATI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P APTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVGFFSLILFGDPFAPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIV  549

Query  541  LAWLSAAKSLDVQFTA  588
             AWLSAA+SLDVQFTA
Sbjct  550  FAWLSAARSLDVQFTA  565



>gb|KHG15786.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=619

 Score =   371 bits (953),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFST TG+ATF MMLLSQ++FDKYGWGVAA I
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTGTGVATFIMMLLSQFIFDKYGWGVAATI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P APTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVGFFSLILFGDPFAPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+L+VIV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILMVIV  549

Query  541  LAWLSAAKSLDVQFTA  588
             AWLSAA+SLDVQFTA
Sbjct  550  FAWLSAARSLDVQFTA  565



>dbj|BAD91180.1| putative plastidic adenylate transporter [Mesembryanthemum crystallinum]
Length=622

 Score =   370 bits (951),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFSTATGIATF+MMLLSQ++FDK+GWGVAA I
Sbjct  376  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTATGIATFSMMLLSQFIFDKFGWGVAAAI  435

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLL+GVGFFSLILFG PL PTL++FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  436  TPTVLLLSGVGFFSLILFGGPLGPTLSSFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCK  495

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV
Sbjct  496  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLLIV  555

Query  541  LAWLSAAKSLDVQFTALRR  597
             AWL+AA+SLD QFT LRR
Sbjct  556  TAWLAAARSLDKQFTELRR  574



>ref|XP_009343421.1| PREDICTED: plastidic ATP/ADP-transporter-like [Pyrus x bretschneideri]
 ref|XP_009343422.1| PREDICTED: plastidic ATP/ADP-transporter-like [Pyrus x bretschneideri]
Length=617

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 191/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ +F+KYGWGVAAKI
Sbjct  369  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQVIFEKYGWGVAAKI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL+P +A+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  429  TPTVLLLTGVGFFSLILFGGPLSPAIASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  488

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  489  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  548

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL+AA+SLD QFTA
Sbjct  549  LAWLAAARSLDTQFTA  564



>ref|XP_002517555.1| Plastidic ATP/ADP-transporter, putative [Ricinus communis]
 gb|EEF44719.1| Plastidic ATP/ADP-transporter, putative [Ricinus communis]
Length=621

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 188/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWG AAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQYIFDKYGWGAAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P+AP LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGGPIAPALAQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG LLVIV
Sbjct  492  EMAYIPLDEETKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGTLLVIV  551

Query  541  LAWLSAAKSLDVQFTA  588
            L WL AA+SLD QFTA
Sbjct  552  LLWLGAARSLDTQFTA  567



>gb|AAZ23108.1| plastid ATP/ADP transport protein 2 [Manihot esculenta]
Length=623

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQYIFDKYGWGVAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP L+ FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGGPLAPVLSQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG LLVIV
Sbjct  492  EMAYIPLDEETKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGTLLVIV  551

Query  541  LAWLSAAKSLDVQFTA  588
            L WL+AA+SLD Q TA
Sbjct  552  LLWLAAARSLDTQSTA  567



>ref|XP_010249956.1| PREDICTED: plastidic ATP/ADP-transporter [Nelumbo nucifera]
Length=631

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/196 (92%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATG+ATFTMMLLSQW+FDKYGWGVAA+I
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGVATFTMMLLSQWIFDKYGWGVAARI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P +   GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGDPLVPAMGKLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  550

Query  541  LAWLSAAKSLDVQFTA  588
             AWL+AA SLD QF A
Sbjct  551  FAWLAAANSLDTQFNA  566



>ref|XP_006585647.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=624

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML+SQ++FDKYGWGVAA I
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLVSQFIFDKYGWGVAATI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGGPLAPGLASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV
Sbjct  492  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLLIV  551

Query  541  LAWLSAAKSLDVQFTA  588
             AWL+AAKSLD QFTA
Sbjct  552  SAWLAAAKSLDTQFTA  567



>gb|KHN47790.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=623

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML+SQ++FDKYGWGVAA I
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLVSQFIFDKYGWGVAATI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGGPLAPGLASLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLLIV  550

Query  541  LAWLSAAKSLDVQFTA  588
             AWL+AAKSLD QFTA
Sbjct  551  SAWLAAAKSLDTQFTA  566



>gb|KHN01355.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=623

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML+SQ++FDKYGWGVAA I
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLVSQFIFDKYGWGVAATI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGGPLAPGLASIGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLL+IV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLLIV  550

Query  541  LAWLSAAKSLDVQFTA  588
             AWL+AAKSLD QFTA
Sbjct  551  SAWLAAAKSLDTQFTA  566



>ref|XP_006583133.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=623

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML+SQ++FDKYGWGVAA I
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLVSQFIFDKYGWGVAATI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA+ GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGGPLAPGLASIGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLL+IV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLLIV  550

Query  541  LAWLSAAKSLDVQFTA  588
             AWL+AAKSLD QFTA
Sbjct  551  SAWLAAAKSLDTQFTA  566



>gb|AAZ23106.1| plastid ATP/ADP transport protein 1 [Manihot esculenta]
Length=619

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG P+ P L  FG+TPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  432  TPAVLLLTGVGFFSLILFGGPIQPALVQFGLTPLLAAVYVGALQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  492  EMAYIPLDEETKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  551

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL+AAKSLD QFTA
Sbjct  552  LAWLAAAKSLDTQFTA  567



>ref|XP_007135724.1| hypothetical protein PHAVU_010G152900g [Phaseolus vulgaris]
 gb|ESW07718.1| hypothetical protein PHAVU_010G152900g [Phaseolus vulgaris]
Length=623

 Score =   368 bits (944),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 190/196 (97%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPN YSSFMGDFSTATGIATFTMML+SQ++FDKYGWGVAA I
Sbjct  370  SINLVEVTWKSKLKAQFPSPNAYSSFMGDFSTATGIATFTMMLVSQFIFDKYGWGVAATI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSL+LFG P+APTLA+FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  430  TPAVLLLTGVGFFSLLLFGGPIAPTLASFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGGVLL+IV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGVLLLIV  549

Query  541  LAWLSAAKSLDVQFTA  588
             AWL+AAKSLD QFTA
Sbjct  550  SAWLAAAKSLDTQFTA  565



>gb|EPS64663.1| hypothetical protein M569_10117 [Genlisea aurea]
Length=631

 Score =   367 bits (943),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFP+PNEYSSFMGDFSTATG+ATFTMMLLSQW+F++YGWGVAA I
Sbjct  378  SINLVEVTWKSKLKAQFPTPNEYSSFMGDFSTATGVATFTMMLLSQWIFNRYGWGVAAAI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP+VLLLTGVGFFSLILFG PLAP LA FGMTPLLAAVYVGA+QNIFSKS+KYSLFDPCK
Sbjct  438  TPSVLLLTGVGFFSLILFGDPLAPVLAKFGMTPLLAAVYVGALQNIFSKSSKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL IV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLAIV  557

Query  541  LAWLSAAKSLDVQFT  585
            LAWL AA+SLD QFT
Sbjct  558  LAWLGAARSLDGQFT  572



>gb|ACF80277.1| unknown [Zea mays]
Length=348

 Score =   358 bits (919),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  88   SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  147

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  148  TPAVLLLTGVGFFSLILFGEPLTPLMTKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  207

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  208  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  267

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD+QF++L +
Sbjct  268  LAWLGAVRSLDLQFSSLAK  286



>ref|XP_010429984.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=463

 Score =   360 bits (925),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  219  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  278

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  279  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  338

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  339  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  398

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  399  TAWLAAAKSLEGQFNSLR  416



>gb|KFK42425.1| hypothetical protein AALP_AA2G254500 [Arabis alpina]
Length=626

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFP+PNEYS+FMGDFST TGIATFTMMLLSQ+VF+KYGWGVAAKI
Sbjct  380  SINLVEVTWKSKLKAQFPTPNEYSAFMGDFSTCTGIATFTMMLLSQYVFNKYGWGVAAKI  439

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  440  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  499

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  500  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  559

Query  541  LAWLSAAKSLDVQFTALR  594
            +AWL AAKSL+ QF ALR
Sbjct  560  IAWLGAAKSLEGQFNALR  577



>ref|XP_010537959.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Tarenaya 
hassleriana]
Length=628

 Score =   364 bits (934),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ++F+KYGWGVAAKI
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYIFNKYGWGVAAKI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P+AP LA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVAFFSLILFGGPVAPVLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV
Sbjct  501  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIV  560

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF ALR
Sbjct  561  TAWLAAAKSLETQFNALR  578



>gb|KHG16971.1| ADP,ATP carrier 1, chloroplastic -like protein [Gossypium arboreum]
Length=615

 Score =   363 bits (933),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKI
Sbjct  365  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAKI  424

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG  L P LA F MTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  425  TPAVLLLTGVGFFSLILFGDLLGPALAEFSMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  484

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL+IV
Sbjct  485  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLMIV  544

Query  541  LAWLSAAKSLDVQFT  585
              WLSAAKSLD QFT
Sbjct  545  FTWLSAAKSLDTQFT  559



>ref|XP_009106762.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Brassica 
rapa]
Length=614

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  552

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF ALR
Sbjct  553  TAWLAAAKSLEGQFNALR  570



>ref|XP_008447482.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cucumis melo]
Length=627

 Score =   363 bits (933),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGI TF MMLLSQ++F+KYGWGVAA I
Sbjct  375  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIVTFVMMLLSQYIFNKYGWGVAANI  434

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FFSLILFG P+AP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  435  TPTVLLVTGVAFFSLILFGGPIAPMLTQFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  494

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  495  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  554

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL AA+SLD QF+A
Sbjct  555  LAWLGAARSLDSQFSA  570



>emb|CDX87299.1| BnaA07g35740D [Brassica napus]
Length=614

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  552

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF ALR
Sbjct  553  TAWLAAAKSLEGQFNALR  570



>ref|XP_004147999.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cucumis sativus]
 ref|XP_004167037.1| PREDICTED: plastidic ATP/ADP-transporter-like [Cucumis sativus]
 gb|KGN58138.1| ATP/ADP transporter [Cucumis sativus]
Length=627

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/196 (91%), Positives = 186/196 (95%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGI TF MMLLSQ++F+KYGWGVAA I
Sbjct  375  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIVTFVMMLLSQYIFNKYGWGVAANI  434

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FFSLILFG P+AP L  FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  435  TPTVLLVTGVAFFSLILFGGPIAPMLTQFGLTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  494

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  495  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  554

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL AA+SLD QF+A
Sbjct  555  LAWLGAARSLDSQFSA  570



>emb|CDY57697.1| BnaA07g38360D [Brassica napus]
Length=616

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  552

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF ALR
Sbjct  553  TAWLAAAKSLEGQFNALR  570



>emb|CDY39988.1| BnaC06g40660D [Brassica napus]
Length=615

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  375  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  434

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  435  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  494

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  495  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  554

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF ALR
Sbjct  555  TAWLAAAKSLEGQFNALR  572



>ref|XP_009104454.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Brassica 
rapa]
Length=616

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  552

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF ALR
Sbjct  553  TAWLAAAKSLEGQFNALR  570



>ref|XP_006389778.1| hypothetical protein EUTSA_v10018281mg [Eutrema salsugineum]
 dbj|BAJ33695.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27064.1| hypothetical protein EUTSA_v10018281mg [Eutrema salsugineum]
Length=624

 Score =   362 bits (930),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  501  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGIILLVIV  560

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF ALR
Sbjct  561  TAWLAAAKSLEGQFNALR  578



>emb|CDX79394.1| BnaC06g19090D [Brassica napus]
Length=616

 Score =   362 bits (929),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  552

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF ALR
Sbjct  553  TAWLAAAKSLEGQFNALR  570



>ref|XP_006829678.1| hypothetical protein AMTR_s00122p00140700 [Amborella trichopoda]
 gb|ERM97094.1| hypothetical protein AMTR_s00122p00140700 [Amborella trichopoda]
Length=660

 Score =   363 bits (933),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLS+ +  KYGWGVAA I
Sbjct  383  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSRVILQKYGWGVAAMI  442

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP LA FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  443  TPTVLLLTGVGFFSLILFGDPLAPALAKFGITPLLAAVYVGAMQNIFSKSAKYSLFDPCK  502

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  503  EMAYIPLDEETKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  562

Query  541  LAWLSAAKSLDVQFTALR  594
            L WL+AA+SLD QFTAL 
Sbjct  563  LGWLAAARSLDKQFTALE  580



>ref|XP_008672827.1| PREDICTED: plastidic ATP/ADP-transporter isoform X1 [Zea mays]
Length=641

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAAKI
Sbjct  382  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAKI  441

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  442  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  501

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  502  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  561

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  562  LAWLGAASSLDKQFSSLAK  580



>tpg|DAA58346.1| TPA: plastidic ATP/ADP-transporter [Zea mays]
Length=612

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAAKI
Sbjct  382  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAKI  441

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  442  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  501

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  502  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  561

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  562  LAWLGAASSLDKQFSSLAK  580



>ref|XP_010429982.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010429983.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=618

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  374  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  433

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  434  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  493

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  494  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  553

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  554  TAWLAAAKSLEGQFNSLR  571



>ref|XP_010417726.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Camelina 
sativa]
Length=618

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  375  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  434

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  435  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  494

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  495  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  554

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  555  TAWLAAAKSLEGQFNSLR  572



>ref|XP_010472951.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Camelina 
sativa]
Length=617

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  552

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  553  TAWLAAAKSLEGQFNSLR  570



>ref|XP_002889299.1| chloroplast ADP, ATP carrier protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65558.1| chloroplast ADP, ATP carrier protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  501  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  560

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  561  TAWLAAAKSLEGQFNSLR  578



>ref|NP_001147851.1| plastidic ATP/ADP-transporter [Zea mays]
 gb|ACG28895.1| plastidic ATP/ADP-transporter [Zea mays]
Length=642

 Score =   362 bits (928),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAAKI
Sbjct  382  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAKI  441

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  442  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  501

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  502  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  561

Query  541  LAWLSAAKSLDVQFTALRR  597
            +AWL AA SLD QF++L +
Sbjct  562  VAWLGAASSLDKQFSSLAK  580



>ref|XP_002458233.1| hypothetical protein SORBIDRAFT_03g029490 [Sorghum bicolor]
 gb|EES03353.1| hypothetical protein SORBIDRAFT_03g029490 [Sorghum bicolor]
Length=636

 Score =   361 bits (926),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL +++  K+GWGVAA I
Sbjct  383  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRYILRKFGWGVAAMI  442

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTG GFFSLILFG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  443  TPTVLLLTGAGFFSLILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  502

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  503  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  562

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF+AL +
Sbjct  563  LAWLGAANSLDKQFSALAK  581



>ref|XP_010691228.1| PREDICTED: plastidic ATP/ADP-transporter [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score =   360 bits (925),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 188/198 (95%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFSTATG+ TF MML SQ++F+K+GWGVAA I
Sbjct  378  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTATGVMTFGMMLASQFIFNKFGWGVAAAI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLL+GVGFFSLILFG PL P L TFG+TPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  438  TPTVLLLSGVGFFSLILFGDPLGPLLGTFGLTPLLAAVYVGALQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTK+KGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  498  EMAYIPLDEDTKLKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  557

Query  541  LAWLSAAKSLDVQFTALR  594
            LAWL AA+SLD QFTALR
Sbjct  558  LAWLGAARSLDKQFTALR  575



>ref|XP_010532151.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=629

 Score =   360 bits (925),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGI TF+MMLLSQ++F+KYGWGVAAKI
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIVTFSMMLLSQYIFEKYGWGVAAKI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P+AP LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVAFFSLILFGGPIAPVLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LL IV
Sbjct  501  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGVILLGIV  560

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF  LR
Sbjct  561  TAWLAAAKSLETQFNTLR  578



>ref|XP_006300855.1| hypothetical protein CARUB_v10019948mg [Capsella rubella]
 gb|EOA33753.1| hypothetical protein CARUB_v10019948mg [Capsella rubella]
Length=639

 Score =   360 bits (925),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  396  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  455

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  456  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  515

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  516  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  575

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  576  GAWLAAAKSLEGQFNSLR  593



>emb|CAA89201.2| adenine nucleotide translocase [Arabidopsis thaliana]
Length=623

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TG+ATFTMMLLSQ+VF+KYGWGVAAKI
Sbjct  380  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGVATFTMMLLSQYVFNKYGWGVAAKI  439

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  440  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  499

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  500  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  559

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  560  TAWLAAAKSLEGQFNSLR  577



>ref|NP_178146.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
 sp|Q39002.2|TLC1_ARATH RecName: Full=ADP,ATP carrier protein 1, chloroplastic; AltName: 
Full=ADP/ATP translocase 1; AltName: Full=Adenine nucleotide 
translocase 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52434.1|AC018848_5 adenine nucleotide translocase; 19474-21800 [Arabidopsis thaliana]
 gb|AAL16246.1|AF428316_1 At1g80300/F5I6_5 [Arabidopsis thaliana]
 dbj|BAE98630.1| adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AEE36385.1| ADP,ATP carrier protein 1 [Arabidopsis thaliana]
Length=624

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TG+ATFTMMLLSQ+VF+KYGWGVAAKI
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGVATFTMMLLSQYVFNKYGWGVAAKI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  501  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  560

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  561  TAWLAAAKSLEGQFNSLR  578



>gb|AAK76577.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
Length=624

 Score =   359 bits (921),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TG+ATFTMMLLSQ+VF+KYGWGVAAKI
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGVATFTMMLLSQYVFNKYGWGVAAKI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLG +LLVIV
Sbjct  501  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGMILLVIV  560

Query  541  LAWLSAAKSLDVQFTALR  594
             AWL+AAKSL+ QF +LR
Sbjct  561  TAWLAAAKSLEGQFNSLR  578



>gb|AFW83424.1| hypothetical protein ZEAMMB73_806603 [Zea mays]
Length=634

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAMI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  501  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  560

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  561  LAWLGAASSLDKQFSSLAK  579



>ref|XP_010459088.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Camelina 
sativa]
Length=459

 Score =   352 bits (904),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF KYGWGVAAKI
Sbjct  219  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFKKYGWGVAAKI  278

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  279  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  338

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV
Sbjct  339  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIV  398

Query  541  LAWLSAAKSLDVQFTAL  591
             AWL+AAKSL+ QF  L
Sbjct  399  TAWLAAAKSLEGQFNTL  415



>gb|EAZ12893.1| hypothetical protein OsJ_02814 [Oryza sativa Japonica Group]
Length=619

 Score =   357 bits (917),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  369  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAMI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  429  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  488

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  489  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  548

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  549  LAWLGAASSLDKQFSSLAK  567



>ref|NP_001043710.1| Os01g0647100 [Oryza sativa Japonica Group]
 dbj|BAD68020.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAD68186.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAF05624.1| Os01g0647100 [Oryza sativa Japonica Group]
 gb|EAY75169.1| hypothetical protein OsI_03061 [Oryza sativa Indica Group]
Length=642

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  392  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAMI  451

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  452  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  511

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  512  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  571

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  572  LAWLGAASSLDKQFSSLAK  590



>ref|XP_006646147.1| PREDICTED: plastidic ATP/ADP-transporter-like, partial [Oryza 
brachyantha]
Length=554

 Score =   355 bits (911),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  302  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAMI  361

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  362  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  421

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL FGSLANSTPYLGG+LLVIV
Sbjct  422  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILAFGSLANSTPYLGGILLVIV  481

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  482  LAWLGAASSLDKQFSSLAK  500



>dbj|BAH20416.1| AT1G15500 [Arabidopsis thaliana]
Length=455

 Score =   351 bits (901),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF KYGWGVAAKI
Sbjct  215  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFKKYGWGVAAKI  274

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  275  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  334

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV
Sbjct  335  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGVILLGIV  394

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  395  TAWLAAAKSLEGQFN  409



>ref|NP_001140537.1| uncharacterized protein LOC100272602 [Zea mays]
 gb|ACF84037.1| unknown [Zea mays]
 gb|AFW71371.1| hypothetical protein ZEAMMB73_421978 [Zea mays]
Length=594

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  334  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  393

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  394  TPAVLLLTGVGFFSLILFGEPLTPLMTKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  453

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  454  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  513

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD+QF++L +
Sbjct  514  LAWLGAVRSLDLQFSSLAK  532



>ref|XP_004969309.1| PREDICTED: plastidic ATP/ADP-transporter-like [Setaria italica]
Length=632

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  384  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAMI  443

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  444  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  503

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL FGSLANSTPYLGG+LLVIV
Sbjct  504  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILAFGSLANSTPYLGGILLVIV  563

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  564  LAWLGAASSLDKQFSSLAK  582



>ref|XP_008785487.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Phoenix 
dactylifera]
Length=670

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  395  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAAMI  454

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PLAP L  FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  455  TPTVLLLTGVGFFSLLLFGEPLAPLLGQFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  514

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  515  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  574

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QF+ L +
Sbjct  575  LAWLGAARSLDAQFSPLAK  593



>ref|XP_006648444.1| PREDICTED: plastidic ATP/ADP-transporter-like [Oryza brachyantha]
Length=548

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQ+PSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  288  SINLVEVTWKSKLKAQYPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  347

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  348  TPAVLLLTGVGFFSLILFGEPLTPLMATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  407

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  408  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  467

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD QF+ L +
Sbjct  468  LAWLGAVRSLDSQFSPLAK  486



>ref|XP_008681386.1| PREDICTED: uncharacterized protein LOC100272602 isoform X1 [Zea 
mays]
 gb|AFW71369.1| hypothetical protein ZEAMMB73_421978 [Zea mays]
Length=630

 Score =   356 bits (913),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  430  TPAVLLLTGVGFFSLILFGEPLTPLMTKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  490  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  549

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD+QF++L +
Sbjct  550  LAWLGAVRSLDLQFSSLAK  568



>gb|EEE56534.1| hypothetical protein OsJ_05838 [Oryza sativa Japonica Group]
Length=592

 Score =   354 bits (909),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQ+PSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  332  SINLVEVTWKSKLKAQYPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  391

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  392  TPAVLLLTGVGFFSLILFGEPLTPLMATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  451

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  452  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  511

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD QF+ L +
Sbjct  512  LAWLGAVRSLDSQFSPLAK  530



>gb|EMS56290.1| Plastidic ATP/ADP-transporter [Triticum urartu]
Length=508

 Score =   352 bits (902),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +F ++GWGVAA I
Sbjct  265  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIIFQRFGWGVAAMI  324

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT+GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  325  TPTVLLLTGVGFFSLILFGQPLTPLLATWGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  384

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD D K+KGKAAIDVVCNPLGKSGGALIQQF+IL FGSLANSTPYLGG+LLVIV
Sbjct  385  EMAYIPLDGDMKLKGKAAIDVVCNPLGKSGGALIQQFLILIFGSLANSTPYLGGILLVIV  444

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QF++L +
Sbjct  445  LAWLGAARSLDKQFSSLAK  463



>gb|ADE75734.1| unknown [Picea sitchensis]
Length=416

 Score =   348 bits (892),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLS+ +F KYGWGVAA I
Sbjct  71   SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSRVIFRKYGWGVAATI  130

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL TGV FF LIL   PL P L  FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  131  TPTVLLATGVAFFGLILCSDPLTPLLGKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  190

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQF+ILTFGSLANSTPYLG +LLVIV
Sbjct  191  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFLILTFGSLANSTPYLGSILLVIV  250

Query  541  LAWLSAAKSLDVQFTALRR  597
            +AWL+AA+SLD QFT L +
Sbjct  251  VAWLAAARSLDSQFTPLVK  269



>ref|XP_009381260.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=666

 Score =   355 bits (912),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  392  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRLILRKFGWGVAAMI  451

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PLAP L + GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  452  TPTVLLLTGVGFFSLLLFGEPLAPLLGSLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  511

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+ KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  512  EMAYIPLDEEMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  571

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QF+ L +
Sbjct  572  LAWLGAARSLDSQFSPLAK  590



>ref|XP_006307012.1| hypothetical protein CARUB_v10008598mg [Capsella rubella]
 gb|EOA39910.1| hypothetical protein CARUB_v10008598mg [Capsella rubella]
Length=618

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF KYGWGVAAKI
Sbjct  378  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFKKYGWGVAAKI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  438  TPTVLLLTGVAFFSLILFGGPFAPVVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIV  557

Query  541  LAWLSAAKSLDVQFTAL  591
             AWL+AAKSL+ QF  L
Sbjct  558  TAWLAAAKSLEGQFNTL  574



>ref|XP_010476640.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Camelina 
sativa]
Length=624

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF KYGWGVAAKI
Sbjct  383  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFKKYGWGVAAKI  442

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  443  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  502

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV
Sbjct  503  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIV  562

Query  541  LAWLSAAKSLDVQFTAL  591
             AWL+AAKSL+ QF  L
Sbjct  563  TAWLAAAKSLEGQFNTL  579



>ref|XP_004951502.1| PREDICTED: plastidic ATP/ADP-transporter-like [Setaria italica]
Length=625

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  365  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  424

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  425  TPAVLLLTGVGFFSLILFGEPLTPLMTQFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  484

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  485  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  544

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD QF+ L +
Sbjct  545  LAWLGAVRSLDSQFSPLAK  563



>gb|KHN22476.1| ADP,ATP carrier protein 1, chloroplastic [Glycine soja]
Length=616

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGV AKI
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSQFIFDKYGWGVGAKI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P+AP +A FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLLTGVGFFSLILFGGPIAPVIAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  491  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  550

Query  541  LAWLSAAKSLDVQFTA  588
            L WLSAAKSLD QFTA
Sbjct  551  LVWLSAAKSLDTQFTA  566



>gb|EAY84955.1| hypothetical protein OsI_06319 [Oryza sativa Indica Group]
Length=630

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQ+PSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  370  SINLVEVTWKSKLKAQYPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  430  TPAVLLLTGVGFFSLILFGEPLTPLMATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  490  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  549

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD QF+ L +
Sbjct  550  LAWLGAVRSLDSQFSPLAK  568



>ref|XP_003546196.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Glycine 
max]
Length=617

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/196 (94%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLSQ++FDKYGWGV AKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSQFIFDKYGWGVGAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG P+AP +A FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGGPIAPVIAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV
Sbjct  492  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  551

Query  541  LAWLSAAKSLDVQFTA  588
            L WLSAAKSLD QFTA
Sbjct  552  LVWLSAAKSLDTQFTA  567



>ref|XP_010497204.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Camelina 
sativa]
Length=621

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF KYGWGVAAKI
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFKKYGWGVAAKI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV
Sbjct  501  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIV  560

Query  541  LAWLSAAKSLDVQFTAL  591
             AWL+AAKSL+ QF  L
Sbjct  561  TAWLAAAKSLEGQFNTL  577



>ref|XP_006416899.1| hypothetical protein EUTSA_v10007090mg [Eutrema salsugineum]
 gb|ESQ35252.1| hypothetical protein EUTSA_v10007090mg [Eutrema salsugineum]
Length=618

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  378  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  438  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIV  557

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  558  TAWLAAAKSLEGQFN  572



>dbj|BAD24996.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAD25005.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
 dbj|BAH01705.1| unnamed protein product [Oryza sativa Japonica Group]
Length=630

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQ+PSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  370  SINLVEVTWKSKLKAQYPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  430  TPAVLLLTGVGFFSLILFGEPLTPLMATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  490  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  549

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD QF+ L +
Sbjct  550  LAWLGAVRSLDSQFSPLAK  568



>ref|XP_010925271.1| PREDICTED: plastidic ATP/ADP-transporter-like [Elaeis guineensis]
Length=667

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWG AA I
Sbjct  392  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGGAAMI  451

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PLAP L  FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  452  TPTVLLLTGVGFFSLILFGEPLAPLLGKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  511

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  512  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  571

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAW+ AA+SLD QF+ L +
Sbjct  572  LAWIGAARSLDAQFSPLAK  590



>gb|AAX63195.1| putative plastidic ATP/ADP transporter [Oryza sativa Japonica 
Group]
Length=642

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K GWGVAA I
Sbjct  392  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKSGWGVAAMI  451

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAV VGA+QNIFSKSAKYSLFDPCK
Sbjct  452  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVNVGALQNIFSKSAKYSLFDPCK  511

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  512  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  571

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  572  LAWLGAASSLDKQFSSLAK  590



>ref|XP_009407647.1| PREDICTED: plastidic ATP/ADP-transporter-like [Musa acuminata 
subsp. malaccensis]
Length=658

 Score =   353 bits (907),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  398  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRLILRKFGWGVAAMI  457

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P L +FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  458  TPTVLLLTGVGFFSLILFGEPLTPLLGSFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  517

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+ KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  518  EMAYIPLDEEMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  577

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QF+ L +
Sbjct  578  LAWLGAARSLDSQFSPLAK  596



>ref|XP_002890107.1| hypothetical protein ARALYDRAFT_471751 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66366.1| hypothetical protein ARALYDRAFT_471751 [Arabidopsis lyrata subsp. 
lyrata]
Length=618

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF KYGWGVAAKI
Sbjct  378  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFKKYGWGVAAKI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  438  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGIILLGIV  557

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  558  TAWLAAAKSLEGQFN  572



>ref|NP_173003.1| ADP,ATP carrier protein 2 [Arabidopsis thaliana]
 sp|P92935.2|TLC2_ARATH RecName: Full=ADP,ATP carrier protein 2, chloroplastic; AltName: 
Full=ADP/ATP translocase 2; AltName: Full=Adenine nucleotide 
translocase 2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF71976.1|AC013453_1 Putative adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AAL91239.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
 gb|AAM60955.1| adenine nucleotide translocase, putative [Arabidopsis thaliana]
 gb|AAM91244.1| putative adenine nucleotide translocase [Arabidopsis thaliana]
 emb|CAA64329.2| AATP2 protein [Arabidopsis thaliana]
 gb|AEE29330.1| TLC ATP/ADP transporter [Arabidopsis thaliana]
Length=618

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 175/195 (90%), Positives = 182/195 (93%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF KYGWGVAAKI
Sbjct  378  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFKKYGWGVAAKI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  438  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLG +LL IV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGVILLGIV  557

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  558  TAWLAAAKSLEGQFN  572



>ref|XP_009148947.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Brassica 
rapa]
Length=609

 Score =   352 bits (903),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  369  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  429  TPTVLLVTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  488

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV
Sbjct  489  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIV  548

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  549  TAWLAAAKSLEGQFN  563



>emb|CDY36568.1| BnaA06g10210D [Brassica napus]
Length=610

 Score =   352 bits (903),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLVTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIV  549

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  550  TAWLAAAKSLEGQFN  564



>emb|CDX83974.1| BnaC08g16710D [Brassica napus]
Length=609

 Score =   352 bits (903),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF+KYGWGVAAKI
Sbjct  369  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFNKYGWGVAAKI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  429  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  488

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV
Sbjct  489  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIV  548

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  549  TAWLAAAKSLEGQFN  563



>ref|XP_002451752.1| hypothetical protein SORBIDRAFT_04g007240 [Sorghum bicolor]
 gb|EES04728.1| hypothetical protein SORBIDRAFT_04g007240 [Sorghum bicolor]
Length=681

 Score =   354 bits (908),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  407  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  466

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTGVGFFSLILFG PL P +  FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  467  TPAVLLLTGVGFFSLILFGEPLTPLMTKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  526

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  527  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  586

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD QF+ L +
Sbjct  587  LAWLGAVRSLDSQFSTLAK  605



>emb|CDY39658.1| BnaC05g11870D [Brassica napus]
Length=614

 Score =   352 bits (902),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VFDKYGWGVAAKI
Sbjct  374  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFDKYGWGVAAKI  433

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  434  TPTVLLVTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  493

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV
Sbjct  494  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIV  553

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  554  TAWLAAAKSLEGQFN  568



>ref|XP_009388534.1| PREDICTED: plastidic ATP/ADP-transporter-like [Musa acuminata 
subsp. malaccensis]
Length=665

 Score =   353 bits (906),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATG+ATFTMMLL + +  K+GWGVAA I
Sbjct  394  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGVATFTMMLLGRLILRKFGWGVAAMI  453

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P L + GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  454  TPTVLLLTGVGFFSLILFGEPLTPLLGSLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  513

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+ KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  514  EMAYIPLDEEMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  573

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QF+ L +
Sbjct  574  LAWLGAARSLDSQFSPLAK  592



>dbj|BAJ89983.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=620

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  360  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  419

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLL+TGVGFFSL+LFG PL P LATFGMTPLLAAV+VGA+QNIFSKSAKYSLFDPCK
Sbjct  420  TPAVLLVTGVGFFSLLLFGEPLTPLLATFGMTPLLAAVFVGALQNIFSKSAKYSLFDPCK  479

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  480  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  539

Query  541  LAWLSAAKSLDVQFTALRR  597
            +AWL A +SLD QF+ L +
Sbjct  540  IAWLGAVRSLDSQFSPLAK  558



>ref|XP_003569451.1| PREDICTED: plastidic ATP/ADP-transporter-like [Brachypodium distachyon]
Length=632

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +F K+GWGVAA I
Sbjct  380  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIIFQKFGWGVAAMI  439

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  440  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  499

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD D K+KGKAAIDVVCNPLGKSGGALIQQF+IL FGSLANSTPYLGG+LL+IV
Sbjct  500  EMAYIPLDGDMKLKGKAAIDVVCNPLGKSGGALIQQFLILIFGSLANSTPYLGGILLIIV  559

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA SLD QF++L +
Sbjct  560  LAWLRAASSLDKQFSSLAK  578



>emb|CDX96838.1| BnaA08g23810D [Brassica napus]
Length=612

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF+KYGWGVAAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFNKYGWGVAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV
Sbjct  492  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIV  551

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  552  TAWLAAAKSLEGQFN  566



>ref|XP_009110479.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Brassica 
rapa]
 ref|XP_009110480.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Brassica 
rapa]
Length=610

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 183/195 (94%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGIATFTMMLLSQ+VF+KYGWGVAAKI
Sbjct  370  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMMLLSQYVFNKYGWGVAAKI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  430  TPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLA+STPYLG +LL IV
Sbjct  490  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLASSTPYLGVILLGIV  549

Query  541  LAWLSAAKSLDVQFT  585
             AWL+AAKSL+ QF 
Sbjct  550  TAWLAAAKSLEGQFN  564



>gb|EMT31396.1| Plastidic ATP/ADP-transporter [Aegilops tauschii]
Length=620

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +F ++GWGVAA I
Sbjct  377  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIIFQRFGWGVAAMI  436

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGVGFFSLILFG PL P LAT+GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  437  TPTVLLVTGVGFFSLILFGQPLTPLLATWGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  496

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD D K+KGKAAIDVVCNPLGKSGGALIQQF+IL FGSLANSTPYLGG+LLVIV
Sbjct  497  EMAYIPLDGDMKLKGKAAIDVVCNPLGKSGGALIQQFLILIFGSLANSTPYLGGILLVIV  556

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AA+SLD QF++L +
Sbjct  557  LAWLGAARSLDKQFSSLAK  575



>ref|XP_010914961.1| PREDICTED: plastidic ATP/ADP-transporter-like [Elaeis guineensis]
Length=658

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  388  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAAMI  447

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGVGFFSLILFG PLAP L  FGMTPLLAAVYVGA+QNIFSKS+KYSLFDPCK
Sbjct  448  TPTVLLITGVGFFSLILFGEPLAPLLGKFGMTPLLAAVYVGALQNIFSKSSKYSLFDPCK  507

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVK KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  508  EMAYIPLDEDMKVKSKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  567

Query  541  LAWLSAAKSLDVQFTALRR  597
            L+W+ AA+SLD QF+ L +
Sbjct  568  LSWIGAARSLDSQFSPLAK  586



>ref|XP_008809354.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic [Phoenix 
dactylifera]
Length=679

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLL + +  K+GWGVAA I
Sbjct  404  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFAMMLLGRVILRKFGWGVAAMI  463

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PLAP L   GMTPL+AAVYVGA+QNIFSKS+KYSLFDPCK
Sbjct  464  TPTVLLLTGVGFFSLLLFGEPLAPLLGKLGMTPLIAAVYVGALQNIFSKSSKYSLFDPCK  523

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL IV
Sbjct  524  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLAIV  583

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AAKSLD QF+ L +
Sbjct  584  LAWLGAAKSLDSQFSPLAK  602



>gb|EMT25116.1| ADP,ATP carrier protein 1, chloroplastic [Aegilops tauschii]
Length=671

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  412  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRLILRKFGWGVAATI  471

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLL+TGVGFFSL+LFG PL P LATFGMTPLLAAV+VGA+QNIFSKSAKYSLFDPCK
Sbjct  472  TPAVLLVTGVGFFSLLLFGEPLTPLLATFGMTPLLAAVFVGALQNIFSKSAKYSLFDPCK  531

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  532  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  591

Query  541  LAWLSAAKSLDVQFTALRR  597
            +AWL A +SLD QF+ L +
Sbjct  592  IAWLGAVRSLDSQFSPLAK  610



>ref|XP_007023975.1| TLC ATP/ADP transporter isoform 3, partial [Theobroma cacao]
 gb|EOY26597.1| TLC ATP/ADP transporter isoform 3, partial [Theobroma cacao]
Length=491

 Score =   345 bits (885),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 173/181 (96%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = +1

Query  46   QFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKITPTVLLLTGVGFFSL  225
            QFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAAKITPTVLLLTGVGFFSL
Sbjct  297  QFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAKITPTVLLLTGVGFFSL  356

Query  226  ILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  405
            ILFG PL   LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG
Sbjct  357  ILFGDPLGLGLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKG  416

Query  406  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDVQFT  585
            KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLD QFT
Sbjct  417  KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDTQFT  476

Query  586  A  588
            A
Sbjct  477  A  477



>gb|AAX58120.1| plastid ATP/ADP transporter [Oryza sativa Japonica Group]
Length=644

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/201 (88%), Positives = 185/201 (92%), Gaps = 2/201 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQ-FPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAK  177
            SINLVEVTWKSKLKAQ FPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA 
Sbjct  392  SINLVEVTWKSKLKAQQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAM  451

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            ITPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGA+QNIFSKSAKYSLFDPC
Sbjct  452  ITPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGALQNIFSKSAKYSLFDPC  511

Query  358  KEMAYIPLDEDTK-VKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV  534
            KEMAYIPLDED K VKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLV
Sbjct  512  KEMAYIPLDEDMKVVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLV  571

Query  535  IVLAWLSAAKSLDVQFTALRR  597
            IVLAWL AA SLD QF++L +
Sbjct  572  IVLAWLGAASSLDKQFSSLAK  592



>ref|XP_008228630.1| PREDICTED: plastidic ATP/ADP-transporter-like [Prunus mume]
Length=621

 Score =   348 bits (893),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ +F+KYGWGVAAKI
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQVIFEKYGWGVAAKI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL+P + + GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLLTGVGFFSLILFGGPLSPAITSLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLL+IV
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLLIV  552

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL AA+SLD QFTA
Sbjct  553  LAWLGAARSLDTQFTA  568



>ref|XP_008657814.1| PREDICTED: ADP,ATP carrier protein 2, chloroplastic-like [Zea 
mays]
Length=650

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 185/215 (86%), Gaps = 16/215 (7%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  381  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRIILRKFGWGVAAMI  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL P LAT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  441  TPTVLLLTGVGFFSLILFGQPLTPMLATMGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  500

Query  361  EMAYIPLDEDTK----------------VKGKAAIDVVCNPLGKSGGALIQQFMILTFGS  492
            EMAYIPLDED K                VKGKAAIDVVCNPLGKSGGALIQQFMILTFGS
Sbjct  501  EMAYIPLDEDMKVFSSNHVKEICLVPSFVKGKAAIDVVCNPLGKSGGALIQQFMILTFGS  560

Query  493  LANSTPYLGGVLLVIVLAWLSAAKSLDVQFTALRR  597
            LANSTPYLGG+LLVIVLAWL AA SLD QF++L +
Sbjct  561  LANSTPYLGGILLVIVLAWLGAASSLDKQFSSLAK  595



>ref|XP_007217627.1| hypothetical protein PRUPE_ppa002937mg [Prunus persica]
 gb|EMJ18826.1| hypothetical protein PRUPE_ppa002937mg [Prunus persica]
Length=620

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ +F+KYGWGVAAKI
Sbjct  372  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQVIFEKYGWGVAAKI  431

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSLILFG PL+P + + GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  432  TPTVLLLTGVGFFSLILFGGPLSPAITSLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  491

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLL+IV
Sbjct  492  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLLIV  551

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL AA+SLD QFTA
Sbjct  552  LAWLGAARSLDTQFTA  567



>ref|XP_010925128.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic [Elaeis guineensis]
Length=745

 Score =   350 bits (899),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  470  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAAMI  529

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG  L P L   GMTPL+AAVYVGA+QNIFSKS+KYSLFDPCK
Sbjct  530  TPTVLLLTGVGFFSLLLFGETLTPLLGKLGMTPLIAAVYVGALQNIFSKSSKYSLFDPCK  589

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LL IV
Sbjct  590  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLAIV  649

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL AAKSLD QF++L +
Sbjct  650  LAWLGAAKSLDSQFSSLAK  668



>ref|XP_003571578.1| PREDICTED: plastidic ATP/ADP-transporter-like [Brachypodium distachyon]
Length=623

 Score =   347 bits (890),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQ+PSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  363  SINLVEVTWKSKLKAQYPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAATI  422

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLL+TGVGFFSL+LFG PL P L  FGMTPLLAAV++GA+QNIFSKSAKYSLFDPCK
Sbjct  423  TPAVLLVTGVGFFSLLLFGEPLTPLLTKFGMTPLLAAVFIGALQNIFSKSAKYSLFDPCK  482

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVKGKAAIDVVCNPLGKSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV
Sbjct  483  EMAYIPLDEDMKVKGKAAIDVVCNPLGKSGGALIQQFMILSFGSLANSTPYLGGILLVIV  542

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL A +SLD QF+ L +
Sbjct  543  LAWLGAVRSLDSQFSPLAK  561



>ref|XP_008792130.1| PREDICTED: plastidic ATP/ADP-transporter-like [Phoenix dactylifera]
Length=666

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA +
Sbjct  392  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRVILRKFGWGVAAMV  451

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL TGVGFFSLILFG PLAP L   GMTPLLAAVYVGA+QNIFSKS+KYSLFDPCK
Sbjct  452  TPTVLLFTGVGFFSLILFGEPLAPLLGKLGMTPLLAAVYVGALQNIFSKSSKYSLFDPCK  511

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDED KVK KAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG+LLVIV
Sbjct  512  EMAYIPLDEDMKVKSKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGILLVIV  571

Query  541  LAWLSAAKSLDVQFTALRR  597
            L+W+ AA+SLD QF+ L +
Sbjct  572  LSWIGAARSLDSQFSPLAK  590



>ref|XP_010279263.1| PREDICTED: ADP,ATP carrier protein 1, chloroplastic-like [Nelumbo 
nucifera]
Length=681

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSK+KAQFPSPNEYSSFMGDFST TG+ATFTMMLLS+++F K+GWGVAA I
Sbjct  370  SINLVEVTWKSKIKAQFPSPNEYSSFMGDFSTCTGVATFTMMLLSRFIFRKFGWGVAAAI  429

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLL+TGVGFFSLILF   LAP     G+TPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  430  TPAVLLVTGVGFFSLILFSDQLAPLFVKLGLTPLLAAVYVGAVQNIFSKSAKYSLFDPCK  489

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TKVKGKAAIDVVCNPLGKSGGALIQQF+ILTFGSL+NSTPYLGG+LL+IV
Sbjct  490  EMAYIPLDEETKVKGKAAIDVVCNPLGKSGGALIQQFLILTFGSLSNSTPYLGGILLIIV  549

Query  541  LAWLSAAKSLDVQFTALRR  597
            LAWL+AA+SLD QFT + +
Sbjct  550  LAWLAAARSLDRQFTPMAK  568



>gb|KDO58239.1| hypothetical protein CISIN_1g012495mg [Citrus sinensis]
Length=462

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/174 (96%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ+VFDK+GWGVAAKI
Sbjct  260  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFVFDKFGWGVAAKI  319

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGVGFFSL+LFG PL P LA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  320  TPTVLLLTGVGFFSLLLFGDPLGPALAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  379

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG  522
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG
Sbjct  380  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGG  433



>gb|ADE77264.1| unknown [Picea sitchensis]
Length=310

 Score =   333 bits (853),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGI TF+MMLLS+++F KYGWGVAA I
Sbjct  27   SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTYTGIVTFSMMLLSRYIFRKYGWGVAATI  86

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FF+L+L    L P +A FG+TPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  87   TPTVLLVTGVAFFALVLGSDSLTPMMAKFGVTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  146

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAA+DVVCNPLGKSGGALIQQ +IL FGSLANSTPYLG +LL  V
Sbjct  147  EMAYIPLDEDTKVKGKAAVDVVCNPLGKSGGALIQQVLILGFGSLANSTPYLGVILLATV  206

Query  541  LAWLSAAKSLDVQFTALRR  597
            ++WL AA+SLD QFT L +
Sbjct  207  ISWLYAARSLDQQFTPLVK  225



>gb|EMS68334.1| ADP,ATP carrier protein 1, chloroplastic [Triticum urartu]
Length=552

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 184/232 (79%), Gaps = 33/232 (14%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLL + +  K+GWGVAA I
Sbjct  263  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLGRLILRKFGWGVAATI  322

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAA-----------------------  291
            TP VLL+TGVGFFSL+LFG PL P LATFGMTPLLAA                       
Sbjct  323  TPAVLLVTGVGFFSLLLFGEPLTPLLATFGMTPLLAAGFVGALQNIFSKRLGEPLTPLLA  382

Query  292  ----------VYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLG  441
                      V+VGA+QNIFSKSAKYSLFDPCKEMAYIPLDED KVKGKAAIDVVCNPLG
Sbjct  383  TFGMTPLLAAVFVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDMKVKGKAAIDVVCNPLG  442

Query  442  KSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDVQFTALRR  597
            KSGGALIQQFMIL+FGSLANSTPYLGG+LLVIV+AWL A +SLD QF+ L +
Sbjct  443  KSGGALIQQFMILSFGSLANSTPYLGGILLVIVIAWLGAVRSLDSQFSPLAK  494



>ref|XP_002990822.1| hypothetical protein SELMODRAFT_21240, partial [Selaginella moellendorffii]
 gb|EFJ08095.1| hypothetical protein SELMODRAFT_21240, partial [Selaginella moellendorffii]
Length=489

 Score =   330 bits (846),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPN+YSSFMGDFST TG+ TF+MMLLS+ +F KYGWGVAA I
Sbjct  287  SINLVEVTWKSKLKAQFPSPNDYSSFMGDFSTWTGVVTFSMMLLSRVIFRKYGWGVAAAI  346

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP+VLL+TGV FFSL+LF  PL P L   G+TPL+AAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  347  TPSVLLVTGVAFFSLVLFSDPLTPFLGGIGLTPLMAAVYVGALQNIFSKSAKYSLFDPCK  406

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQ +IL+FGSLA+STPYLG +LLVIV
Sbjct  407  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQVLILSFGSLASSTPYLGAILLVIV  466

Query  541  LAWLSAAKSLDVQFTAL  591
            LAWL AA+SLD QFT +
Sbjct  467  LAWLGAARSLDKQFTPM  483



>ref|XP_006838934.1| hypothetical protein AMTR_s00002p00270350 [Amborella trichopoda]
 gb|ERN01503.1| hypothetical protein AMTR_s00002p00270350 [Amborella trichopoda]
Length=710

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYS+FMGDFST TGI TFTMMLLS+ +F KYGWGVAA I
Sbjct  374  SINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTLTGIVTFTMMLLSRVIFRKYGWGVAAAI  433

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP+VLL TGVGFFSL+LF  PL P L   G+TPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  434  TPSVLLATGVGFFSLVLFSDPLTPILGKLGLTPLLAAVYVGALQNIFSKSAKYSLFDPCK  493

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TKVKGKAAIDVVCNPLGKSGGALIQQF+ILT GSLANSTPYLG +LL I 
Sbjct  494  EMAYIPLDENTKVKGKAAIDVVCNPLGKSGGALIQQFLILTCGSLANSTPYLGVMLLAIT  553

Query  541  LAWLSAAKSLDVQFTAL  591
            LAWL AA+SLD QFT +
Sbjct  554  LAWLGAARSLDKQFTPM  570



>ref|XP_002974477.1| hypothetical protein SELMODRAFT_101296 [Selaginella moellendorffii]
 gb|EFJ24699.1| hypothetical protein SELMODRAFT_101296 [Selaginella moellendorffii]
Length=629

 Score =   331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPN+YSSFMGDFST TG+ TF+MMLLS+ +F KYGWGVAA I
Sbjct  378  SINLVEVTWKSKLKAQFPSPNDYSSFMGDFSTWTGVVTFSMMLLSRVIFRKYGWGVAAAI  437

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP+VLL+TGV FFSL+LF  PL P L   G+TPL+AAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  438  TPSVLLVTGVAFFSLVLFSDPLTPFLGGIGLTPLMAAVYVGALQNIFSKSAKYSLFDPCK  497

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQ +IL+FGSL++STPYLG +LLVIV
Sbjct  498  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQVLILSFGSLSSSTPYLGAILLVIV  557

Query  541  LAWLSAAKSLDVQFTAL  591
            LAWL AA+SLD QFT +
Sbjct  558  LAWLGAARSLDKQFTPM  574



>ref|XP_011401420.1| ADP,ATP carrier protein 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM28405.1| ADP,ATP carrier protein 1, chloroplastic [Auxenochlorella protothecoides]
Length=592

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSK+K QFP+PNEYS+FMGDFSTATG  TFTMML+S+W+F ++GWG+AA I
Sbjct  369  SINLVEVTWKSKIKQQFPNPNEYSAFMGDFSTATGAVTFTMMLVSRWIFSRFGWGMAALI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FF+L+LF  PL P LA  GMTPL AAV VGA QNIFSKS+KYSLFDPCK
Sbjct  429  TPTVLLITGVVFFALVLFSTPLTPMLAGLGMTPLFAAVLVGAAQNIFSKSSKYSLFDPCK  488

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++TK KGKAAIDV+CNPLGKSGGALIQQFMI+ FGSLA STPYLG +LLVIV
Sbjct  489  EMAYIPLDDETKTKGKAAIDVICNPLGKSGGALIQQFMIIGFGSLAASTPYLGIILLVIV  548

Query  541  LAWLSAAKSLDVQFTA  588
              W++AAK LD +F+A
Sbjct  549  AGWIAAAKDLDWRFSA  564



>ref|XP_001773938.1| predicted protein [Physcomitrella patens]
 gb|EDQ61286.1| predicted protein [Physcomitrella patens]
Length=564

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPN+YSSFMGDFST TG+ATF MMLLS+++F KYGWGVAA I
Sbjct  336  SINLVEVTWKSKLKAQFPSPNDYSSFMGDFSTYTGVATFIMMLLSRYIFRKYGWGVAAAI  395

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FF L+LF  PL P LA  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  396  TPTVLLVTGVAFFGLVLFSTPLTPMLAGLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  455

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TK+KGKAAIDVVCNPLGKSGGALIQQF+IL FGSLA+STPYLG +LL+IV
Sbjct  456  EMAYIPLDEETKLKGKAAIDVVCNPLGKSGGALIQQFLILGFGSLASSTPYLGAILLLIV  515

Query  541  LAWLSAAKSLDVQFTAL  591
            L WL AA+SLD QFT L
Sbjct  516  LLWLGAARSLDAQFTPL  532



>ref|XP_001780035.1| predicted protein [Physcomitrella patens]
 gb|EDQ55138.1| predicted protein [Physcomitrella patens]
Length=606

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPN+YSSFMGDFST TG+ATF MMLLS+++F KYGWGVAA I
Sbjct  302  SINLVEVTWKSKLKAQFPSPNDYSSFMGDFSTYTGVATFIMMLLSRYIFRKYGWGVAAAI  361

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FF L+LF  PL P LA  GMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  362  TPTVLLVTGVAFFGLVLFSTPLTPMLAGLGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  421

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDE+TK+KGKAAIDVVCNPLGKSGGALIQQF+IL FGSLA STPYLG +LL+IV
Sbjct  422  EMAYIPLDEETKLKGKAAIDVVCNPLGKSGGALIQQFLILGFGSLATSTPYLGAILLLIV  481

Query  541  LAWLSAAKSLDVQFTAL  591
            L WL AA+SLD QFT L
Sbjct  482  LLWLGAARSLDAQFTPL  498



>gb|KDD74050.1| TLC ATP/ADP transporter, partial [Helicosporidium sp. ATCC 50920]
Length=487

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 169/194 (87%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSK+K QFP+PNEYS+FMGDFSTATG+ TFTMM++S+W+F  +GWG AA I
Sbjct  282  SINLVEVTWKSKIKQQFPNPNEYSAFMGDFSTATGVVTFTMMIVSRWIFRIWGWGAAALI  341

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FF+L+LF  PL P LA+ G+TPL AAV VGA QNIFSKS+KYSLFDPCK
Sbjct  342  TPTVLLITGVVFFALVLFSVPLTPALASLGLTPLYAAVLVGAAQNIFSKSSKYSLFDPCK  401

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD +TK KGKAAIDV+CNPLGKSGGALIQQFMI+ FGSLA STPYLG +LLVIV
Sbjct  402  EMAYIPLDSETKTKGKAAIDVICNPLGKSGGALIQQFMIIGFGSLAASTPYLGIILLVIV  461

Query  541  LAWLSAAKSLDVQF  582
              W+ AAK LD +F
Sbjct  462  GGWIVAAKDLDWRF  475



>ref|XP_005844203.1| hypothetical protein CHLNCDRAFT_56336 [Chlorella variabilis]
 gb|EFN52101.1| hypothetical protein CHLNCDRAFT_56336 [Chlorella variabilis]
Length=589

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSK+KAQFP+PN+YS+FMGDFSTATG  TFTMM++S+W+F K+GWG+AA I
Sbjct  364  SINLVEVTWKSKIKAQFPNPNDYSAFMGDFSTATGAVTFTMMIISRWIFSKFGWGMAALI  423

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTGV FFSL+LF  PL P L   G+TPL AAV VGA QNIFSKS+KYSLFDPCK
Sbjct  424  TPTVLLLTGVIFFSLVLFSGPLEPGLMALGLTPLYAAVLVGAAQNIFSKSSKYSLFDPCK  483

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++TK KGKAAIDV+CNPLGKSGGALIQQFMI+ FGSLA STPYLG +LL IV
Sbjct  484  EMAYIPLDQETKTKGKAAIDVICNPLGKSGGALIQQFMIIGFGSLAASTPYLGLILLGIV  543

Query  541  LAWLSAAKSLDVQFTALRR  597
              W+ AAK LD +F A + 
Sbjct  544  AMWIYAAKDLDWRFAAAQE  562



>ref|XP_002947450.1| hypothetical protein VOLCADRAFT_79605 [Volvox carteri f. nagariensis]
 gb|EFJ51498.1| hypothetical protein VOLCADRAFT_79605 [Volvox carteri f. nagariensis]
Length=583

 Score =   305 bits (782),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWK KLKAQFP+PN+YSSFMG+FSTATG  TFTMM+LS+W+F ++GWGVAA I
Sbjct  362  SINLVEVTWKGKLKAQFPNPNDYSSFMGEFSTATGTVTFTMMILSRWIFKQFGWGVAALI  421

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP +LL+TG+ FF+L+L G  + PTLA FGMTPL AAV VGA QN+FSKS+KYSLFDPCK
Sbjct  422  TPIMLLITGLLFFTLVLAGDAVKPTLAGFGMTPLYAAVLVGAAQNVFSKSSKYSLFDPCK  481

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ K KGKAAIDV+CNPLGKSGGALIQQFMI+  GSLA STPYLG +L VI+
Sbjct  482  EMAYIPLDDEVKTKGKAAIDVICNPLGKSGGALIQQFMIIGLGSLAASTPYLGAILCVII  541

Query  541  LAWLSAAKSLDVQFTALRR  597
            + W++AA SL+ QFTAL+ 
Sbjct  542  VLWINAAASLNKQFTALQE  560



>ref|XP_005643478.1| ADP/ATP carrier protein [Coccomyxa subellipsoidea C-169]
 gb|EIE18934.1| ADP/ATP carrier protein [Coccomyxa subellipsoidea C-169]
Length=559

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSK+K QFP+PN+YS+FMGDFS+ATG  TF MMLLS+ +F KYGWGVAA+I
Sbjct  279  SINLVEVTWKSKIKQQFPNPNDYSAFMGDFSSATGAVTFIMMLLSRVIFRKYGWGVAAQI  338

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FF+L+LF APL P LAT  +TPL+AAV +GA QN+FSKSAKYSLFDPCK
Sbjct  339  TPTVLLITGVAFFALVLFSAPLTPWLATINLTPLMAAVLIGAAQNVFSKSAKYSLFDPCK  398

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++T++KGKAAIDVVCNPLGKSGG+ IQQ MI+ FGSLA STPYLG +LL +V
Sbjct  399  EMAYIPLDQETQLKGKAAIDVVCNPLGKSGGSAIQQMMIIGFGSLAASTPYLGVILLGVV  458

Query  541  LAWLSAAKSLDVQFTALRR  597
            + W+ AA SL  QFT L++
Sbjct  459  VMWIGAAGSLSKQFTELQQ  477



>ref|XP_001703733.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
 gb|EDO96373.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
Length=577

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWK KLKAQFP+PN+YSSFMG+FSTATG  TFTMM+LS+W+F ++GWGVAA I
Sbjct  360  SINLVEVTWKGKLKAQFPNPNDYSSFMGEFSTATGTVTFTMMILSRWIFKQFGWGVAALI  419

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP +LL+TG+ FF+L+L G  + P LA +GMTPL AAV VGA QN+FSKS+KYSLFDPCK
Sbjct  420  TPIMLLITGLLFFTLVLAGDTVKPALAAWGMTPLYAAVLVGAAQNVFSKSSKYSLFDPCK  479

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPL+++ K KGKAAIDV+CNPLGKSGGALIQQFMI+  GSLA STPYLG +L VI+
Sbjct  480  EMAYIPLEDEVKTKGKAAIDVICNPLGKSGGALIQQFMIIGLGSLAASTPYLGAILCVII  539

Query  541  LAWLSAAKSLDVQFTALRR  597
            +AW++AA SL+ QFTAL+ 
Sbjct  540  VAWINAAASLNKQFTALQE  558



>gb|AES68077.2| plastidic ATP/ADP-transporter-like protein [Medicago truncatula]
Length=595

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 162/196 (83%), Gaps = 22/196 (11%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML+SQ++F+KYGWGVAA I
Sbjct  373  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLVSQFIFNKYGWGVAATI  432

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGVGFFSLILFG PLAP +   G+TPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  433  TPTVLLMTGVGFFSLILFGDPLAPVIGKLGLTPLLAAVYVGALQNIFSKSAKYSLFDPCK  492

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLDEDTKVKGKAAIDVVCNPL KS                         VLLVI 
Sbjct  493  EMAYIPLDEDTKVKGKAAIDVVCNPLRKSWWC----------------------VLLVIG  530

Query  541  LAWLSAAKSLDVQFTA  588
            LAWL+AAKSLD QFTA
Sbjct  531  LAWLAAAKSLDTQFTA  546



>dbj|BAD95278.1| adenine nucleotide translocase [Arabidopsis thaliana]
Length=204

 Score =   283 bits (724),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  121  MMLLSQWVFDKYGWGVAAKITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYV  300
            MMLLSQ+VF+KYGWGVAAKITPTVLLLTGV FFSLILFG P AP +A  GMTPLLAAVYV
Sbjct  1    MMLLSQYVFNKYGWGVAAKITPTVLLLTGVAFFSLILFGGPFAPLVAKLGMTPLLAAVYV  60

Query  301  GAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL  480
            GA+QNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL
Sbjct  61   GALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMIL  120

Query  481  TFGSLANSTPYLGGVLLVIVLAWLSAAKSLDVQFTALR  594
            +FGSLANSTPYLG +LLVIV AWL+AAKSL+ QF +LR
Sbjct  121  SFGSLANSTPYLGMILLVIVTAWLAAAKSLEGQFNSLR  158



>ref|XP_003597826.1| ATP/ADP transporter [Medicago truncatula]
Length=645

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 162/212 (76%), Gaps = 38/212 (18%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQ----------------FPSPNEYSSFMGDFSTATGIATFTMMLL  132
            SINLVEVTWKSKLKAQ                FPSPNEYSSFMGDFSTATGIATFTMML+
Sbjct  407  SINLVEVTWKSKLKAQVIYHLFQFWFSYCLFVFPSPNEYSSFMGDFSTATGIATFTMMLV  466

Query  133  SQWVFDKYGWGVAAKITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQ  312
            SQ++F+KYGWGVAA ITPTVLL+TGVGFFSLILFG PLAP +   G+TPLLAAVYVGA+Q
Sbjct  467  SQFIFNKYGWGVAATITPTVLLMTGVGFFSLILFGDPLAPVIGKLGLTPLLAAVYVGALQ  526

Query  313  NIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGS  492
            NIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPL KS               
Sbjct  527  NIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLRKSWWC------------  574

Query  493  LANSTPYLGGVLLVIVLAWLSAAKSLDVQFTA  588
                      VLLVI LAWL+AAKSLD QFTA
Sbjct  575  ----------VLLVIGLAWLAAAKSLDTQFTA  596



>gb|EWM29257.1| plastidic atp adp transporter [Nannochloropsis gaditana]
Length=577

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEVTWK KLK  FP PN YS+FMG+FSTATG  T  MMLL + +F KYGWGVAA I
Sbjct  371  SINIVEVTWKGKLKEAFPDPNAYSAFMGNFSTATGCVTLIMMLLGRGIFQKYGWGVAALI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP +LL TGV FFSLI+F    +P  A  GMTPL+ AV +GA QN+ SKS+KYSLFDPCK
Sbjct  431  TPIMLLSTGVAFFSLIIFNGFFSPVTAALGMTPLMLAVIIGAAQNVLSKSSKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD + K KGKAAIDV+ NPLGKSGG+ IQQ +IL  GSL+ STPYL G++ +IV
Sbjct  491  EMAYIPLDAEQKTKGKAAIDVIGNPLGKSGGSFIQQILILILGSLSASTPYLAGIIFLIV  550

Query  541  LAWLSAAKSLDVQF  582
             AW+ AA SL  QF
Sbjct  551  GAWIKAAASLSKQF  564



>gb|ABV25594.1| plastid ATP/ADP translocase, partial [Pavlova lutheri]
Length=471

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 153/195 (78%), Gaps = 1/195 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEV+WKSKLKA FP+PN+YS FMG FS+ATG AT  MML+ Q VF  +GWGVAA +
Sbjct  265  SINIVEVSWKSKLKAAFPNPNDYSEFMGSFSSATGAATLVMMLIGQRVFKVFGWGVAALV  324

Query  181  TPTVLLLTGVGFFSLILFGAPLAP-TLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            TP+VLL TG  FF LILF   LAP  +   G TPL+ AV  GA QNI SKSAKYSLFDPC
Sbjct  325  TPSVLLATGGAFFGLILFNDALAPWIVRALGTTPLMLAVLCGAAQNILSKSAKYSLFDPC  384

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLD ++K KGKAA+DV+ NPLGKSGG+LIQQ +I  FGSLA STPYL  +L+V 
Sbjct  385  KEMAYIPLDAESKTKGKAAVDVIGNPLGKSGGSLIQQALIFGFGSLAASTPYLAAILVVT  444

Query  538  VLAWLSAAKSLDVQF  582
            ++ W+ AA+SL+V F
Sbjct  445  IVVWMKAARSLNVMF  459



>gb|ABV25597.1| plastid ATP/ADP translocase [Euglena gracilis]
Length=505

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 154/194 (79%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEVTWKSKLKAQFP PN YS+FMG+FS+ATG  T  MM+L + +F+K+GWGVAA I
Sbjct  295  SINIVEVTWKSKLKAQFPDPNSYSAFMGNFSSATGTVTLVMMILGRQIFEKFGWGVAASI  354

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP  L +TG  FFSLIL  +   P  A  G TPL+ AV +GA QNI SKSAKYSLFDPCK
Sbjct  355  TPITLGVTGAMFFSLILAPSFWNPITAAIGTTPLMLAVLIGAFQNIMSKSAKYSLFDPCK  414

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD ++K KGKAA+DV+ NPLGKSGG+ IQQ +I   GSLA STPYLG +L +I+
Sbjct  415  EMAYIPLDAESKTKGKAAVDVIGNPLGKSGGSFIQQGLIFGLGSLAVSTPYLGVILGLII  474

Query  541  LAWLSAAKSLDVQF  582
            + WLSAA+SL+VQF
Sbjct  475  MGWLSAARSLNVQF  488



>gb|KJB70561.1| hypothetical protein B456_011G079600 [Gossypium raimondii]
Length=519

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQ++FDKYGWGVAA I
Sbjct  369  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQFIFDKYGWGVAAGI  428

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLL+GVGFFSLILFG PL PTLA FGMTPLLAAVYVGA+QNIFSKSAKYSLFDPCK
Sbjct  429  TPTVLLLSGVGFFSLILFGGPLGPTLAKFGMTPLLAAVYVGALQNIFSKSAKYSLFDPCK  488

Query  361  EMAYIPLDEDTKV  399
            EMAYIPLDEDTKV
Sbjct  489  EMAYIPLDEDTKV  501



>gb|ABV25604.1| plastid ATP/ADP translocase [Prymnesium parvum]
Length=552

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEVTWKSKLK  FP P+ YS+FMG FS+ATG+ T   ML  ++VF K+GWGVAA I
Sbjct  349  SINIVEVTWKSKLKLAFPDPSAYSAFMGQFSSATGVVTLAAMLFGRFVFRKWGWGVAATI  408

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL TG  FF+LIL G   +P +A  G TPL+ AV VGA+QNI SK+AKYSLFDPCK
Sbjct  409  TPTVLLATGATFFALILGGDFFSPLVAVLGTTPLMLAVIVGALQNILSKAAKYSLFDPCK  468

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ K KGKAAIDV+  PLGKSGG+LIQQ +I+  GSLA +TPYL  +L  I+
Sbjct  469  EMAYIPLDQEQKTKGKAAIDVIGGPLGKSGGSLIQQVLIVAVGSLAAATPYLAVILTAII  528

Query  541  LAWLSAAKSLDVQF  582
             AW+ AA+SL VQF
Sbjct  529  GAWILAARSLSVQF  542



>gb|KCW53784.1| hypothetical protein EUGRSUZ_J03031 [Eucalyptus grandis]
Length=520

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATF MMLLS++VFDKYGWGVAAKI
Sbjct  371  SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFIMMLLSRYVFDKYGWGVAAKI  430

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TGV FFSL+LFG PL PTLA FGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK
Sbjct  431  TPTVLLVTGVAFFSLVLFGGPLVPTLAKFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  490

Query  361  EMAYIPLDEDTKVK  402
            EMAYIPLDEDTKV+
Sbjct  491  EMAYIPLDEDTKVQ  504



>ref|XP_005707402.1| ATP:ADP antiporter, AAA family [Galdieria sulphuraria]
 gb|EME30882.1| ATP:ADP antiporter, AAA family [Galdieria sulphuraria]
Length=670

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 150/200 (75%), Gaps = 1/200 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEV+WKSKLK  FP PN YS+FMG FST TG  T  MMLL +++F K+GWG AA I
Sbjct  444  SINIVEVSWKSKLKEAFPDPNSYSTFMGWFSTCTGSVTLIMMLLGRFIFRKFGWGFAALI  503

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVL +TG  FF L LF   L P +   G TPL+ AV VGA QNI SKS+KYSLFDPCK
Sbjct  504  TPTVLGITGFLFFCLTLFSRQLHPVVGMLGTTPLMLAVLVGAAQNILSKSSKYSLFDPCK  563

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD + K KGKAAIDV+ NP+GKSGG+ IQQ +I   GSLA STPYL  +L VIV
Sbjct  564  EMAYIPLDAEQKSKGKAAIDVIGNPMGKSGGSFIQQGLIFAVGSLAASTPYLAFILFVIV  623

Query  541  LAWLSAAKSLDVQF-TALRR  597
              W++AA+SLD QF  A++R
Sbjct  624  GMWIAAARSLDKQFQEAMKR  643



>emb|CAC80882.1| plastidic ATP/ADP transporter [Galdieria sulphuraria]
Length=671

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 150/200 (75%), Gaps = 1/200 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEV+WKSKLK  FP PN YS+FMG FST TG  T  MMLL +++F K+GWG AA I
Sbjct  445  SINIVEVSWKSKLKEAFPDPNSYSTFMGWFSTCTGSVTLIMMLLGRFIFRKFGWGFAALI  504

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVL +TG  FF L LF   L P +   G TPL+ AV VGA QNI SKS+KYSLFDPCK
Sbjct  505  TPTVLGITGFLFFCLTLFSRQLHPVVGMLGTTPLMLAVLVGAAQNILSKSSKYSLFDPCK  564

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD + K KGKAAIDV+ NP+GKSGG+ IQQ +I   GSLA STPYL  +L VIV
Sbjct  565  EMAYIPLDAEQKSKGKAAIDVIGNPMGKSGGSFIQQGLIFAVGSLAASTPYLAFILFVIV  624

Query  541  LAWLSAAKSLDVQF-TALRR  597
              W++AA+SLD QF  A++R
Sbjct  625  GMWIAAARSLDKQFQEAMKR  644



>emb|CBJ27353.1| plastidic ATP/ADP transporter [Ectocarpus siliculosus]
Length=643

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEVTWK  LK  FP PN YS+FMG+FSTATG  T  MM+L +++F K+GW  AA +
Sbjct  422  SINIVEVTWKGNLKRAFPDPNAYSAFMGNFSTATGSVTLMMMILGRFIFQKFGWTTAALV  481

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVL LTG  FFSLILF    +P LA FG TPL+AAV +GA QNI SKS+KYSLFDPCK
Sbjct  482  TPTVLALTGAFFFSLILFEGAFSPLLAFFGTTPLMAAVLIGAAQNILSKSSKYSLFDPCK  541

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYI LD + K KGKAA+DV+ NPLGKSGG+ IQQ +I++ GSL+ STPYL  +L+ I+
Sbjct  542  EMAYINLDAEQKTKGKAAVDVIGNPLGKSGGSFIQQVLIVSLGSLSASTPYLAAILVGII  601

Query  541  LAWLSAAKSL  570
              WL++AKSL
Sbjct  602  GVWLTSAKSL  611



>gb|EJK46221.1| hypothetical protein THAOC_35120 [Thalassiosira oceanica]
Length=561

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 148/193 (77%), Gaps = 0/193 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            INLVEV+WKSKLKA +P PN YS+FMG+FS+ATG  T  MML+ + +F K+GW  AA IT
Sbjct  358  INLVEVSWKSKLKAAYPDPNSYSAFMGNFSSATGTVTLAMMLIGRKIFKKFGWKFAAMIT  417

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            PT + +TG+ F++L LF    AP  A+ G TPL+ AV VGA+QNI SKS+KYSLFDPCKE
Sbjct  418  PTTIGVTGLMFYALTLFAPFFAPIAASLGTTPLMLAVLVGAVQNILSKSSKYSLFDPCKE  477

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD D+K KGKAA+DV+ NPLGKSGGALIQQ +I   GSLA +TPYL  +L V++L
Sbjct  478  MAYIPLDSDSKTKGKAAVDVIGNPLGKSGGALIQQILIFGVGSLAAATPYLACILGVLLL  537

Query  544  AWLSAAKSLDVQF  582
             W  A  SL VQF
Sbjct  538  FWYKAVDSLSVQF  550



>ref|XP_009037704.1| hypothetical protein AURANDRAFT_27252 [Aureococcus anophagefferens]
 gb|EGB07715.1| hypothetical protein AURANDRAFT_27252 [Aureococcus anophagefferens]
Length=558

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 146/194 (75%), Gaps = 0/194 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            +IN+VEVTWK+ LK QFP P  YS+FMG FS++TG+ TF MML+ Q V  ++GWG+AA +
Sbjct  355  AINIVEVTWKANLKKQFPDPAAYSAFMGGFSSSTGVVTFFMMLVGQQVLKRFGWGIAAAV  414

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP  LL TGV FFSL+L      P  A  G TPL+ AV+VGA QNI SKS KYSLFDPCK
Sbjct  415  TPVTLLATGVTFFSLVLAPGFWQPVAAKLGTTPLMMAVFVGAAQNIASKSTKYSLFDPCK  474

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD + K KGKAA+DV+ NPLGKSGGAL QQ +IL+ GSLA STPYL G L +I+
Sbjct  475  EMAYIPLDAEQKTKGKAAVDVIGNPLGKSGGALYQQGLILSLGSLAASTPYLAGSLFLII  534

Query  541  LAWLSAAKSLDVQF  582
              WL +AKSL  QF
Sbjct  535  AFWLKSAKSLAGQF  548



>emb|CAX16542.1| putative ATP/ADP translocase, partial [Cyanophora paradoxa]
Length=333

 Score =   239 bits (610),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSK+K  FP+PN+YSSFMGDFST TGI T  MMLLS+ VF K+GWG AA +
Sbjct  150  SINLVEVTWKSKIKQAFPNPNQYSSFMGDFSTLTGICTLGMMLLSRVVFKKFGWGTAAMV  209

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLL TG+ FF LILF     P    FG++PL+ AV+ GA QNI SK+ KYSLFDP K
Sbjct  210  TPGVLLATGLSFFGLILFEDFFTPVTQMFGISPLMLAVFCGAAQNILSKATKYSLFDPTK  269

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD +TKVKGKAAIDVV   LGKSGGA +QQ +I++ GSL+ STP L    LV++
Sbjct  270  EMAYIPLDPETKVKGKAAIDVVGARLGKSGGAFLQQVLIVSLGSLSASTPVLAACFLVVI  329

Query  541  LAWL  552
            L W+
Sbjct  330  LMWV  333



>emb|CAX16540.1| putative ATP/ADP translocase [Odontella sinensis]
Length=470

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 146/193 (76%), Gaps = 0/193 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            IN+VEV+WK+KLK  +P PN YSSFMG+FS+ATG  T  MMLL + +F K+GW  AA +T
Sbjct  271  INIVEVSWKAKLKQAYPDPNAYSSFMGNFSSATGAVTLVMMLLGRSIFQKFGWRKAALVT  330

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            PT++ +TG+GFF+L +F     P  A  G TPL+ AV VGA QNI SKS+KYSLFDPCKE
Sbjct  331  PTMIGVTGLGFFALNIFAPTFVPVAAALGTTPLMLAVLVGAAQNILSKSSKYSLFDPCKE  390

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD+D+K KGKAA+DV+ NPLGKSGG+LIQQ +I   GSLA +TPYL  +L V++ 
Sbjct  391  MAYIPLDQDSKTKGKAAVDVIGNPLGKSGGSLIQQALIFGVGSLAVATPYLAAILGVLIF  450

Query  544  AWLSAAKSLDVQF  582
             W  AA SL  QF
Sbjct  451  FWFKAANSLAGQF  463



>ref|XP_002184271.1| nucleotide transporter 1 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44449.1| nucleotide transporter 1 [Phaeodactylum tricornutum CCAP 1055/1]
Length=610

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 148/194 (76%), Gaps = 0/194 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            IN+VEV+WK+KLK  FP PN YS+FMG+FS+ATG AT  MMLL + +F K+GW  AA +T
Sbjct  407  INIVEVSWKAKLKQAFPDPNSYSAFMGNFSSATGAATLIMMLLGRSIFQKFGWRTAALVT  466

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            PT++ +TG+GFF+  +F   ++P  A  G TPL+ AV +GA QNI SKS+KYSLFDPCKE
Sbjct  467  PTMIGVTGLGFFATNVFSGAMSPVAALLGTTPLMLAVLLGAAQNILSKSSKYSLFDPCKE  526

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD+++K KGKAAIDVV NPLGKSGGALIQQ +I   GSLA +TPYL  +L  +V 
Sbjct  527  MAYIPLDQESKTKGKAAIDVVGNPLGKSGGALIQQVLIFGVGSLAAATPYLAVILAGLVF  586

Query  544  AWLSAAKSLDVQFT  585
             W+ AA SL  QF 
Sbjct  587  MWVRAANSLAGQFN  600



>ref|XP_005536231.1| chloroplast ADP,ATP carrier protein [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM79945.1| chloroplast ADP,ATP carrier protein [Cyanidioschyzon merolae 
strain 10D]
Length=684

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEV+WKSKL+ Q+P PN YS+FMG FST TG  T  MML S+ +F ++GWGVAA I
Sbjct  462  SINIVEVSWKSKLREQYPDPNAYSTFMGWFSTCTGSFTIIMMLASRIIFRRFGWGVAAMI  521

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP  L +TG+ FF+L LF   L+P +A  G TPL  AV +GA QNI SK +KYSLFDPCK
Sbjct  522  TPITLGITGMMFFALTLFAKQLSPVVAALGTTPLFLAVLIGAAQNIASKGSKYSLFDPCK  581

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD ++K KGKAAIDV+ NPLGKSGG+ IQQ +I   GSLA STP+L   L  I+
Sbjct  582  EMAYIPLDAESKSKGKAAIDVIGNPLGKSGGSFIQQALIFATGSLAASTPFLAVFLASII  641

Query  541  LAWLSAAKSLDVQFT  585
            + WL+AA+SLD QFT
Sbjct  642  IMWLAAARSLDRQFT  656



>emb|CBJ30232.1| plastidic ATP/ADP transporter [Ectocarpus siliculosus]
Length=608

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 143/198 (72%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SIN+VEVTWK+KLK  +P PN+YS+FMG+FS+ TG+ T  MMLL   VF  YGWG AAK 
Sbjct  338  SINIVEVTWKAKLKMAYPDPNDYSAFMGNFSSTTGLVTLGMMLLGGQVFKNYGWGTAAKA  397

Query  181  TPTVLLLTGVGFFSLILFG--APLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDP  354
            TP VLLLTGVGFFSL +FG  AP+   L      PL  AV  GA QN+ SKS KYSLFDP
Sbjct  398  TPVVLLLTGVGFFSLSMFGDAAPMQEMLGALSTNPLTLAVLAGAAQNVLSKSCKYSLFDP  457

Query  355  CKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV  534
            CKEMAYIPL ++ K KGKAA+DV+ NPLGKS G+ +QQ + L  GSL  STPYL GVLL 
Sbjct  458  CKEMAYIPLSQEEKRKGKAAVDVIGNPLGKSTGSFVQQGLFLATGSLQASTPYLAGVLLA  517

Query  535  IVLAWLSAAKSLDVQFTA  588
            ++  WL AA SL  +F A
Sbjct  518  VITTWLFAADSLSKKFEA  535



>gb|ABV25596.1| plastid ATP/ADP translocase, partial [Pyropia yezoensis]
Length=536

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 148/197 (75%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            +IN+VEV++KS LK  FP PN YS+FMG+FS+ TG+ T  MML+ +WVF  +GWGVAA I
Sbjct  310  AINIVEVSFKSHLKTAFPDPNAYSAFMGNFSSVTGVVTLVMMLVGRWVFRNFGWGVAAAI  369

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VL +TG+GFF+L LF    AP +A  G TPL+AAV++GA Q I SK+ KYS FDP K
Sbjct  370  TPVVLGITGIGFFALTLFAGQAAPIIALAGTTPLMAAVFIGAAQVIMSKACKYSCFDPSK  429

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EM YI LDE ++ +GKAAIDV+ NPLGKSGG+ IQQ +I   GSLA STPYL  +L+ I+
Sbjct  430  EMLYISLDETSRNEGKAAIDVIGNPLGKSGGSFIQQVLIFGTGSLAASTPYLAVILVGII  489

Query  541  LAWLSAAKSLDVQFTAL  591
              WL AAKSLD QF+A 
Sbjct  490  GMWLVAAKSLDKQFSAF  506



>ref|XP_002292665.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED89861.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=566

 Score =   241 bits (616),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 147/193 (76%), Gaps = 0/193 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            INLVEV+WKSKLKA +P PN YS+FMG+FS+ATG  T  MMLL + +F KYGW  AA +T
Sbjct  363  INLVEVSWKSKLKAAYPDPNAYSAFMGNFSSATGSVTLIMMLLGRKIFQKYGWRKAALVT  422

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            P+++ +TG+ F++L +F     P  A+ G TPL+ AV VGA QNI SKS+KYSLFDPCKE
Sbjct  423  PSMIGITGLAFYALTIFAPFFEPIAASLGTTPLMLAVLVGAAQNILSKSSKYSLFDPCKE  482

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD+D+K KGKAA+DVV NPLGKSGGA+IQQ +I   GSLA +TP+L G+L V++ 
Sbjct  483  MAYIPLDQDSKTKGKAAVDVVGNPLGKSGGAMIQQILIFGVGSLAAATPWLAGILGVLLF  542

Query  544  AWLSAAKSLDVQF  582
             W  +  SL  QF
Sbjct  543  FWYKSVNSLAGQF  555



>gb|ABH10983.1| plastid ATP/ADP transporter [Polytomella parva]
Length=564

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 152/195 (78%), Gaps = 0/195 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            INLVEVTWK+KLKAQ+P+P E+S+FMG FS ATG+ T  MM++ + V  K+GWGV A  T
Sbjct  342  INLVEVTWKAKLKAQYPNPAEFSAFMGAFSEATGVFTLGMMMVGRIVLGKFGWGVTALAT  401

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            PTVLL+T + FF+L+L G  L   LA FG+TPL AAV VGA+QNIFS+S+KYSLFDPCKE
Sbjct  402  PTVLLVTAILFFALVLAGDVLKGPLAPFGITPLYAAVLVGALQNIFSRSSKYSLFDPCKE  461

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD   + +GKAAIDV+ N +GKSGGA +QQ +I+  GSL NSTPY+G +L  I+L
Sbjct  462  MAYIPLDPVMQAQGKAAIDVMGNLIGKSGGAAVQQTLIVLCGSLNNSTPYIGVLLTGIIL  521

Query  544  AWLSAAKSLDVQFTA  588
            AW+ +  SL+ QF A
Sbjct  522  AWMRSCVSLNTQFQA  536



>ref|WP_013942850.1| ATPase AAA [Simkania negevensis]
 emb|CCB88383.1| ADP,ATP carrier protein 1 [Simkania negevensis Z]
Length=528

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 147/195 (75%), Gaps = 1/195 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAK  177
            +INL+EVTWKS+LK QFP PN YS+FMG FS  TG+ T F M+ +   V  ++GWG AA 
Sbjct  298  AINLIEVTWKSQLKIQFPDPNAYSTFMGRFSQITGVVTIFMMLFVGGNVIRRFGWGRAAL  357

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            +TP VLL+TG+ FFS I+F   L   +A+ G TPL+ AV  G  QNI SKSAKYSLFDP 
Sbjct  358  VTPVVLLITGIAFFSFIIFRDNLTGFIASIGTTPLMLAVIFGTAQNIMSKSAKYSLFDPT  417

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLD++ KVKGKAA+DVV   LGKSGGALIQQ +IL  GS+A  TPY+GG+LL I
Sbjct  418  KEMAYIPLDQEQKVKGKAAVDVVGARLGKSGGALIQQGLILGLGSIAAMTPYVGGILLFI  477

Query  538  VLAWLSAAKSLDVQF  582
            +L W+ AAKSL+ QF
Sbjct  478  ILMWIIAAKSLNKQF  492



>emb|CCB90293.1| ADP,ATP carrier protein 1 [Waddlia chondrophila 2032/99]
Length=312

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWK++LK Q+P+PN+YS+FMG FS  TG+ T  MM +  ++    GWG AA I
Sbjct  93   SINLVEVTWKNQLKLQYPNPNDYSAFMGGFSRWTGLVTICMMFVGGYIIRTKGWGFAAAI  152

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTG+ FF+ +LF   L+  +A  G TPL  AV +G +QNI SKS+KYSLFDP K
Sbjct  153  TPVVLLLTGIAFFTFVLFRENLSTYIAALGTTPLFLAVVIGMIQNIMSKSSKYSLFDPTK  212

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD+++KVKGKAAIDVV   LGKSGG+LIQQ +++ FG+++  TPY+    + ++
Sbjct  213  EMAYIPLDQESKVKGKAAIDVVGARLGKSGGSLIQQGLLVAFGTISAITPYVAIATIAVI  272

Query  541  LAWLSAAKSLDVQFTAL  591
            + WL A +SL+ QF AL
Sbjct  273  IGWLFAVRSLNKQFVAL  289



>ref|WP_041018366.1| ATPase AAA [Criblamydia sequanensis]
 emb|CDR34749.1| ADP/ATP translocase [Criblamydia sequanensis CRIB-18]
Length=511

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 141/196 (72%), Gaps = 0/196 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            INLVEVTWK +LK Q+P+PN+YS+FMG FS  TG  T  MM +  W+  K GWG AA IT
Sbjct  299  INLVEVTWKGELKKQYPNPNDYSTFMGRFSQMTGFVTIIMMFIGGWIIRKKGWGFAAAIT  358

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            PTVLLLTG+GFFS ++F   L   +   G TPL  AV  G  QNI SKS+KYSLFDP KE
Sbjct  359  PTVLLLTGIGFFSFVIFSDSLQHYITMLGTTPLFLAVMFGTAQNIMSKSSKYSLFDPTKE  418

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            M+YIPLD++ KVKGKAAIDVV   LGKSGG+LIQQ +++ FGSLA  TPY+   ++  ++
Sbjct  419  MSYIPLDQEAKVKGKAAIDVVGARLGKSGGSLIQQILLVGFGSLAAITPYIAICMIATII  478

Query  544  AWLSAAKSLDVQFTAL  591
             WL A KSL+ QF  L
Sbjct  479  VWLFAVKSLNKQFVEL  494



>emb|CAE46508.1| nucleotide transport protein [Parachlamydia sp. P9]
Length=335

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWK++LK Q+P+PNEY++FMG FST TG  T  MM +  ++  K GWG AA  
Sbjct  132  SINLVEVTWKNQLKLQYPNPNEYNTFMGAFSTFTGAITIIMMFVGGYIVRKKGWGFAAMT  191

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTG+GFFS ++F   L   +A  G TPL+ AV +G +QNI SKS KYSLFDP K
Sbjct  192  TPTVLLLTGLGFFSFVIFRDSLQGYIAMLGTTPLMLAVVIGMIQNIMSKSTKYSLFDPTK  251

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD+++KVKGKAAIDVV   LGKSGG+ IQQ +++ FG+++  TPY+    + ++
Sbjct  252  EMAYIPLDQESKVKGKAAIDVVGARLGKSGGSFIQQGLLVFFGTISAITPYVAVATIAVI  311

Query  541  LAWLSAAKSLDVQFTAL  591
            + W+ A +SL+ QF AL
Sbjct  312  VVWMIAVRSLNKQFVAL  328



>ref|WP_039386022.1| ATPase AAA [Neochlamydia sp. TUME1]
 gb|KIC74410.1| ADP,ATP carrier protein 1 [Neochlamydia sp. TUME1]
Length=517

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            INLVEVTWK +LK Q+ +PN+Y++FMG FST TG+ T  MM L  W+  K GWG AA  T
Sbjct  298  INLVEVTWKGQLKLQYKNPNDYNAFMGMFSTITGLVTIIMMFLGGWITRKKGWGFAAMAT  357

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            P VLL+TG+GFFS ++F   LA  ++ FG TPL+ AV  G +QNI SKS KYSLFDP KE
Sbjct  358  PIVLLITGIGFFSFVIFKDHLAGFISYFGTTPLMLAVIFGMIQNIMSKSTKYSLFDPTKE  417

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD+++KVKGKAAIDVV   LGKSGG+ IQQ +++  GSLA  TPY+  ++   +L
Sbjct  418  MAYIPLDQESKVKGKAAIDVVGARLGKSGGSFIQQGLLVALGSLAAITPYVAIIMTFFIL  477

Query  544  AWLSAAKSLDVQFTALRR  597
             WL+A +SL+ QF AL  
Sbjct  478  IWLAAVRSLNRQFIALTH  495



>gb|KIC75182.1| ADP,ATP carrier protein 1 [Neochlamydia sp. EPS4]
Length=517

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            INLVEVTWK +LK Q+ +PN+Y++FMG FST TG+ T  MM L  W+  K GWG AA  T
Sbjct  298  INLVEVTWKGQLKLQYKNPNDYNAFMGMFSTITGLVTIIMMFLGGWITRKKGWGFAAMAT  357

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            P VLL+TG+GFFS ++F   LA  ++ FG TPL+ AV  G +QNI SKS KYSLFDP KE
Sbjct  358  PIVLLITGIGFFSFVIFKDHLAGFISYFGTTPLMLAVIFGMIQNIMSKSTKYSLFDPTKE  417

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD+++KVKGKAAIDVV   LGKSGG+ IQQ +++  GSLA  TPY+  ++   +L
Sbjct  418  MAYIPLDQESKVKGKAAIDVVGARLGKSGGSFIQQGLLVALGSLAAITPYVAIIMTFFIL  477

Query  544  AWLSAAKSLDVQFTALRR  597
             WL+A +SL+ QF AL  
Sbjct  478  IWLAAVRSLNRQFIALTH  495



>ref|WP_039356341.1| ATPase AAA [Candidatus Protochlamydia amoebophila]
Length=513

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAK  177
            SINLVE+TWKS++K Q+P+PN+YS+FMG FST TG  T  MML +   V    GWG AA 
Sbjct  298  SINLVEITWKSQVKLQYPNPNDYSTFMGWFSTMTGAVTILMMLFVGGNVIRHKGWGFAAL  357

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            ITP VLL+TG+ FFS ++F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP 
Sbjct  358  ITPVVLLVTGIAFFSFVIFKGHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPT  417

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLD+++KVKGKAA+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI
Sbjct  418  KEMAYIPLDDESKVKGKAAVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVI  476

Query  538  VLAWLSAAKSLDVQFTAL  591
            + AW+ AA+SL  QFT L
Sbjct  477  IAAWIVAARSLSKQFTQL  494



>gb|KIC73885.1| ADP,ATP carrier protein 1 [Candidatus Protochlamydia amoebophila]
Length=529

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAK  177
            SINLVE+TWKS++K Q+P+PN+YS+FMG FST TG  T  MML +   V    GWG AA 
Sbjct  314  SINLVEITWKSQVKLQYPNPNDYSTFMGWFSTMTGAVTILMMLFVGGNVIRHKGWGFAAL  373

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            ITP VLL+TG+ FFS ++F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP 
Sbjct  374  ITPVVLLVTGIAFFSFVIFKGHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPT  433

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLD+++KVKGKAA+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI
Sbjct  434  KEMAYIPLDDESKVKGKAAVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVI  492

Query  538  VLAWLSAAKSLDVQFTAL  591
            + AW+ AA+SL  QFT L
Sbjct  493  IAAWIVAARSLSKQFTQL  510



>ref|WP_011174800.1| ATPase AAA [Candidatus Protochlamydia amoebophila]
 emb|CAF22974.1| probable ADP/ATP translocase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=513

 Score =   232 bits (592),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAK  177
            SINLVE+TWKS++K Q+P+PN+YS+FMG FST TG  T  MML +   V    GWG AA 
Sbjct  298  SINLVEITWKSQVKLQYPNPNDYSTFMGWFSTMTGAVTILMMLFVGGNVIRHKGWGFAAL  357

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            ITP VLL+TG+ FFS ++F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP 
Sbjct  358  ITPVVLLVTGIAFFSFVIFKDHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPT  417

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLD+++KVKGKAA+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI
Sbjct  418  KEMAYIPLDDESKVKGKAAVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVI  476

Query  538  VLAWLSAAKSLDVQFTAL  591
            + AW+ AA+SL  QFT L
Sbjct  477  IAAWIVAARSLSKQFTQL  494



>ref|WP_042280868.1| ATPase AAA [Candidatus Protochlamydia sp. R18]
Length=513

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (75%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKY-GWGVAAK  177
            SINLVE+TWKS++K Q+P+PN+YS+FMG FST TG  T  MML       +Y GWG AA 
Sbjct  298  SINLVEITWKSQVKLQYPNPNDYSTFMGWFSTMTGAVTILMMLFVGGNVIRYKGWGFAAL  357

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            ITP VLL+TG+ FFS ++F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP 
Sbjct  358  ITPVVLLVTGIAFFSFVIFKDHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPT  417

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLD+++KVKGKAA+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI
Sbjct  418  KEMAYIPLDDESKVKGKAAVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVI  476

Query  538  VLAWLSAAKSLDVQFTAL  591
            + AW+ AA+SL  QFT L
Sbjct  477  IAAWIVAARSLSKQFTQL  494



>ref|WP_042239794.1| ATPase AAA [Neochlamydia sp. S13]
Length=517

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 145/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            INLVEVTWK +LK Q+ +PN+Y++FMG FST TG+ T  MM L  W+  K GWG AA  T
Sbjct  298  INLVEVTWKGQLKLQYKNPNDYNAFMGIFSTITGLVTIIMMFLGGWITRKKGWGFAAMAT  357

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            P VLL+TG+GFFS ++F   LA  ++ FG TPL+ AV  G +QNI SKS KYSLFDP KE
Sbjct  358  PLVLLITGIGFFSFVIFKDHLAGFISYFGTTPLMLAVIFGMIQNIMSKSTKYSLFDPTKE  417

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD+++KVKGKAAIDVV   LGKSGG+ IQQ +++  GSLA  TPY+  ++   +L
Sbjct  418  MAYIPLDQESKVKGKAAIDVVGARLGKSGGSFIQQGLLVALGSLAAITPYVAIIMTFFIL  477

Query  544  AWLSAAKSLDVQFTALRR  597
             W++A +SL+ QF AL  
Sbjct  478  IWIAAVRSLNRQFIALTH  495



>gb|ADI39022.1| ADP/ATP translocase [Waddlia chondrophila WSU 86-1044]
Length=502

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWK++LK Q+P+PN+YS+FMG FS  TG+ T  MM +  ++    GWG AA I
Sbjct  283  SINLVEVTWKNQLKLQYPNPNDYSAFMGGFSRWTGLVTICMMFVGGYIIRTKGWGFAAAI  342

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTG+ FF+ +LF   L+  +A  G TPL  AV +G +QNI SKS+KYSLFDP K
Sbjct  343  TPVVLLLTGIAFFTFVLFRENLSTYIAALGTTPLFLAVVIGMIQNIMSKSSKYSLFDPTK  402

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD+++KVKGKAAIDVV   LGKSGG+LIQQ +++ FG+++  TPY+    + ++
Sbjct  403  EMAYIPLDQESKVKGKAAIDVVGARLGKSGGSLIQQGLLVAFGTISAITPYVAIATIAVI  462

Query  541  LAWLSAAKSLDVQFTAL  591
            + WL A +SL+ QF AL
Sbjct  463  IGWLFAVRSLNKQFVAL  479



>ref|WP_041941596.1| ATPase AAA [Waddlia chondrophila]
Length=515

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWK++LK Q+P+PN+YS+FMG FS  TG+ T  MM +  ++    GWG AA I
Sbjct  296  SINLVEVTWKNQLKLQYPNPNDYSAFMGGFSRWTGLVTICMMFVGGYIIRTKGWGFAAAI  355

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLLLTG+ FF+ +LF   L+  +A  G TPL  AV +G +QNI SKS+KYSLFDP K
Sbjct  356  TPVVLLLTGIAFFTFVLFRENLSTYIAALGTTPLFLAVVIGMIQNIMSKSSKYSLFDPTK  415

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD+++KVKGKAAIDVV   LGKSGG+LIQQ +++ FG+++  TPY+    + ++
Sbjct  416  EMAYIPLDQESKVKGKAAIDVVGARLGKSGGSLIQQGLLVAFGTISAITPYVAIATIAVI  475

Query  541  LAWLSAAKSLDVQFTAL  591
            + WL A +SL+ QF AL
Sbjct  476  IGWLFAVRSLNKQFVAL  492



>ref|WP_042102387.1| ATPase AAA [Parachlamydiaceae bacterium HS-T3]
Length=512

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 148/198 (75%), Gaps = 1/198 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAK  177
            SINLVEVTWKS+LK Q+P+ N+YS+FMG FS  TG+ T F M+ +   +  K GWG AA 
Sbjct  296  SINLVEVTWKSQLKLQYPNANDYSTFMGKFSFFTGLVTIFMMLFVGGNLIRKKGWGFAAM  355

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            ITP VLL+TG GFF  +LF   LA  +++ G +PL  AV  GA QNI SKSAKYSLFDP 
Sbjct  356  ITPVVLLVTGTGFFGFVLFRDNLAGLISSLGTSPLFLAVMFGAAQNIMSKSAKYSLFDPT  415

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLD+++KVKGKAAIDVV   LGKSGG+ +QQ +++ FGS+A  TPY+  +LLVI
Sbjct  416  KEMAYIPLDQESKVKGKAAIDVVGARLGKSGGSFVQQALLVGFGSIAAITPYVAAILLVI  475

Query  538  VLAWLSAAKSLDVQFTAL  591
            ++AW+ A KSL+ QF  L
Sbjct  476  IIAWMYAVKSLNKQFVEL  493



>ref|WP_032124907.1| ATPase AAA [Chlamydia sp. 'Diamant']
Length=512

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 147/198 (74%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAK  177
            SINLVE+TWK+++K Q+P+PN+YS+FMG FST TG  T  MML +   V  + GWG AA 
Sbjct  296  SINLVEITWKNQVKLQYPNPNDYSTFMGWFSTMTGAVTILMMLFVGGNVIRRKGWGFAAL  355

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            ITP VLL+TG+GFFS ++F   L   +A  G TPL  AV  GA QNI SKSAKYSLFDP 
Sbjct  356  ITPVVLLVTGIGFFSFVIFRDSLLGYIAAIGSTPLFLAVMFGAAQNIMSKSAKYSLFDPT  415

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLDED+KVKGKAA+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI
Sbjct  416  KEMAYIPLDEDSKVKGKAAVDVVGARLGKSGGSIIQM-TLLAFGTLATITPYIGAILMVI  474

Query  538  VLAWLSAAKSLDVQFTAL  591
            +  W+ AA+SL  QF  L
Sbjct  475  IAIWIVAARSLSKQFAKL  492



>ref|WP_006340593.1| ATPase AAA [Parachlamydia acanthamoebae]
 gb|AAQ06407.1| ADP-ATP translocase [Parachlamydia acanthamoebae str. Hall's 
coccus]
 gb|EFB42215.1| ADP/ATP translocase [Parachlamydia acanthamoebae str. Hall's 
coccus]
 emb|CCB85168.1| ADP,ATP carrier protein 1 [Parachlamydia acanthamoebae UV-7]
 gb|KIA76370.1| ADP,ATP carrier protein 1 [Parachlamydia acanthamoebae]
Length=517

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWK++LK Q+P+PNEY++FMG FST TG  T  MM +  ++  K GWG AA  
Sbjct  297  SINLVEVTWKNQLKLQYPNPNEYNTFMGAFSTFTGAITIIMMFVGGYIVRKKGWGFAAMT  356

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLLLTG+GFFS ++F   L   +A  G TPL+ AV +G +QNI SKS KYSLFDP K
Sbjct  357  TPTVLLLTGLGFFSFVIFRDSLQGYIAMLGTTPLMLAVVIGMIQNIMSKSTKYSLFDPTK  416

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD+++KVKGKAAIDVV   LGKSGG+ IQQ +++ FG+++  TPY+    + ++
Sbjct  417  EMAYIPLDQESKVKGKAAIDVVGARLGKSGGSFIQQGLLVFFGTISAITPYVAVATIAVI  476

Query  541  LAWLSAAKSLDVQFTAL  591
            + W+ A +SL+ QF AL
Sbjct  477  VVWMIAVRSLNKQFVAL  493



>emb|CAE46506.1| nucleotide transport protein [Candidatus Protochlamydia amoebophila 
UWE25]
Length=513

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 147/198 (74%), Gaps = 2/198 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAK  177
            SINLVE+TWKS +K Q+P+PN+YS+FMG FST TG  T  MML +   V    GWG AA 
Sbjct  298  SINLVEITWKSLVKLQYPNPNDYSTFMGWFSTMTGAVTILMMLFVGGNVIRHKGWGFAAL  357

Query  178  ITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            ITP VLL+TG+ FFS ++F   LA  +A  G TPL  AV  GA QNI SKSAKYSLFDP 
Sbjct  358  ITPVVLLVTGIAFFSFVIFKDHLAGYIAALGTTPLFLAVIFGAAQNIMSKSAKYSLFDPT  417

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMAYIPLD+++KVKGKAA+DVV   LGKSGG++IQ   +L FG+LA  TPY+G +L+VI
Sbjct  418  KEMAYIPLDDESKVKGKAAVDVVGARLGKSGGSIIQM-GLLAFGTLATITPYIGAILMVI  476

Query  538  VLAWLSAAKSLDVQFTAL  591
            + AW+ AA+SL  QFT L
Sbjct  477  IAAWIVAARSLSKQFTQL  494



>emb|CAE46505.1| nucleotide transport protein [endosymbiont of Acanthamoeba sp. 
TUME1]
Length=470

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 144/198 (73%), Gaps = 0/198 (0%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKIT  183
            INLVEVTWK +LK Q+ +PN+Y++FMG FST TG+ T  MM L  W+  K GWG AA  T
Sbjct  251  INLVEVTWKGQLKLQYKNPNDYNAFMGMFSTITGLVTIIMMFLGGWITRKKGWGFAAMAT  310

Query  184  PTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKE  363
            P VLL+TG+GFFS ++F   LA  ++ FG   ++ AV  G +QNI SKS KYSLFDP KE
Sbjct  311  PIVLLITGIGFFSFVIFKDHLAGFISYFGTHSIMLAVIFGMIQNIMSKSTKYSLFDPTKE  370

Query  364  MAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVL  543
            MAYIPLD+++KVKGKAAIDVV   LGKSGG+ IQQ +++  GSLA  TPY+  ++   +L
Sbjct  371  MAYIPLDQESKVKGKAAIDVVGARLGKSGGSFIQQGLLVALGSLAAITPYVAIIMTFFIL  430

Query  544  AWLSAAKSLDVQFTALRR  597
             WL+A +SL+ QF AL +
Sbjct  431  IWLAAVRSLNRQFIALTQ  448



>ref|XP_001693815.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
 gb|EDP09069.1| plastidic ADP/ATP translocase [Chlamydomonas reinhardtii]
Length=615

 Score =   229 bits (584),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            ++ LVEVTWK+KLK  +P P +YS+FMG FS  TGI T TMMLL ++V  K+GWGVAA  
Sbjct  381  ALQLVEVTWKAKLKTAYPDPADYSAFMGKFSETTGIVTLTMMLLGRFVIKKFGWGVAALA  440

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTV+L T + F +L++     A  LA  G TPL+AAV VG++QN+FS+++KYSLFDPCK
Sbjct  441  TPTVILATAIVFLALVMSKNLFAAPLAAMGTTPLMAAVVVGSLQNVFSRASKYSLFDPCK  500

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ K KGKAA+DVV N +GKSGGA++QQ  I TFGSLA STPYLG  L +I+
Sbjct  501  EMAYIPLDDEIKGKGKAAVDVVGNLVGKSGGAVLQQAAIFTFGSLAASTPYLGIGLAIII  560

Query  541  LAWLSAAKSLDVQFTALR  594
            + W+ A  SL+ QF AL+
Sbjct  561  INWIRAVLSLEKQFYALK  578



>gb|KEI72701.1| ATPase AAA [Endozoicomonas elysicola]
Length=502

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 1/199 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            IN+VEVTWK++L+ Q+PSPNEY+ FMG FST TGI T F M+ ++  V  ++GW VAA  
Sbjct  298  INMVEVTWKNQLRMQYPSPNEYNQFMGLFSTCTGIFTIFMMLFVTNNVIRRFGWTVAALC  357

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLL TG  FFS +LF   +       GM+PL+  V +GA+QNI SKS KYSLFDP K
Sbjct  358  TPAVLLTTGCLFFSFVLFRDSVPNGWFILGMSPLMMTVVIGALQNILSKSTKYSLFDPTK  417

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EM+YIPLD + KVKGKAA+DV+ NPLGKS G+LIQQ +++ FGSL+  TPY+  ++L   
Sbjct  418  EMSYIPLDPEKKVKGKAAVDVIGNPLGKSTGSLIQQVLLVIFGSLSAITPYVAVIVLGFF  477

Query  541  LAWLSAAKSLDVQFTALRR  597
            + W+++AKSL  +F  L +
Sbjct  478  IVWITSAKSLGTRFRHLAK  496



>ref|XP_005763298.1| hypothetical protein EMIHUDRAFT_465146 [Emiliania huxleyi CCMP1516]
 gb|EOD10869.1| hypothetical protein EMIHUDRAFT_465146 [Emiliania huxleyi CCMP1516]
Length=823

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 138/196 (70%), Gaps = 18/196 (9%)
 Frame = +1

Query  49   FPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKITPTVLLLTGVGFFSLI  228
            FP P  YS+FMG FS+ATG+AT  MML  ++VF K+GWG AA ITP+VLL TGV FF+L 
Sbjct  264  FPDPTAYSAFMGSFSSATGVATLAMMLFGRFVFRKWGWGTAAMITPSVLLGTGVAFFALC  323

Query  229  LFGAP------------------LAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDP  354
            L G                     AP L+T G+TPL+ AV+VGA QNI SK+AKYSLFDP
Sbjct  324  LTGNTPATAARPFAGDTPAARNTFAPLLSTVGLTPLMLAVFVGAAQNIVSKAAKYSLFDP  383

Query  355  CKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV  534
            CKEMAYIPLD + K KGKAA+DV+  PLGKSGG+L+QQ +I  FGSLA STPYL  +L  
Sbjct  384  CKEMAYIPLDAEEKTKGKAAVDVIGGPLGKSGGSLVQQLLIFGFGSLAASTPYLAVILGG  443

Query  535  IVLAWLSAAKSLDVQF  582
            I+ AW+ AA+SL  QF
Sbjct  444  IIFAWMGAARSLSGQF  459



>gb|EPP36943.1| ADP,ATP carrier protein, partial [Chlamydia psittaci 84-8471/1]
Length=289

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  57   INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  116

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  117  TPVMVLLTGVFFFVLVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATK  176

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  177  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVII  236

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  237  AIWLVSATKLNKLF  250



>ref|WP_033402749.1| ATPase AAA, partial [Endozoicomonas elysicola]
Length=484

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            IN+VEVTWK++L+ Q+PSPNEY+ FMG FST TGI T F M+ ++  V  ++GW VAA  
Sbjct  298  INMVEVTWKNQLRMQYPSPNEYNQFMGLFSTCTGIFTIFMMLFVTNNVIRRFGWTVAALC  357

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLL TG  FFS +LF   +       GM+PL+  V +GA+QNI SKS KYSLFDP K
Sbjct  358  TPAVLLTTGCLFFSFVLFRDSVPNGWFILGMSPLMMTVVIGALQNILSKSTKYSLFDPTK  417

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EM+YIPLD + KVKGKAA+DV+ NPLGKS G+LIQQ +++ FGSL+  TPY+  ++L   
Sbjct  418  EMSYIPLDPEKKVKGKAAVDVIGNPLGKSTGSLIQQVLLVIFGSLSAITPYVAVIVLGFF  477

Query  541  LAWLSAA  561
            + W+++A
Sbjct  478  IVWITSA  484



>gb|KIY98283.1| ADP,ATP carrier protein 2 [Monoraphidium neglectum]
Length=485

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKSK+KAQFP+PN+YS+FMGDFSTATG  TFTMM+LS+++F  +GWGVAA I
Sbjct  354  SINLVEVTWKSKIKAQFPNPNDYSAFMGDFSTATGAVTFTMMILSRYIFRYFGWGVAALI  413

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TPTVLL+TG+ FFSL+LF   +APTL   G+TPL+AAV VGA QN+FSKS+KYSLFDPCK
Sbjct  414  TPTVLLITGILFFSLVLFSDSVAPTLKALGLTPLMAAVLVGAAQNVFSKSSKYSLFDPCK  473

Query  361  EMAYIPLDED  390
            EMAYIPLDE+
Sbjct  474  EMAYIPLDEE  483



>ref|WP_021756588.1| ADP/ATP carrier protein [Chlamydia pecorum]
 gb|AGW37916.1| ADP/ATP carrier protein [Chlamydia pecorum PV3056/3]
Length=533

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 140/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ N+YS FMG+FS  TG+ + F M+ +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKLQYPNANDYSEFMGNFSFWTGVVSVFVMVFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FFSL++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVVFFSLVIFRDKASGLVAMFGTTPLMLAVIVGAIQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGGALIQQ +++  GS+   TP+L  +L +I+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGALIQQGLLVVCGSIGAMTPHLAIILFLII  479

Query  541  LAWLSAAKSLDVQFTA  588
              WL +A  L+  F A
Sbjct  480  AVWLVSATKLNKLFLA  495



>ref|WP_021757805.1| ADP/ATP carrier protein [Chlamydia pecorum]
 gb|AGW39762.1| ADP/ATP carrier protein [Chlamydia pecorum P787]
 gb|ETF37490.1| ADP,ATP carrier protein 1 [Chlamydia pecorum VR629]
 gb|ETF37998.1| ADP,ATP carrier protein 1 [Chlamydia pecorum DBDeUG]
 gb|ETF38266.1| ADP,ATP carrier protein 1 [Chlamydia pecorum MC/MarsBar]
 gb|ETF40232.1| ADP,ATP carrier protein 1 [Chlamydia pecorum IPTaLE]
Length=533

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 140/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ N+YS FMG+FS  TG+ + F M+ +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKLQYPNANDYSEFMGNFSFWTGVVSVFVMVFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FFSL++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVVFFSLVIFRDKASGLVAMFGTTPLMLAVIVGAIQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGGALIQQ +++  GS+   TP+L  +L +I+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGALIQQGLLVVCGSIGAMTPHLAIILFLII  479

Query  541  LAWLSAAKSLDVQFTA  588
              WL +A  L+  F A
Sbjct  480  AVWLVSATKLNKLFLA  495



>ref|WP_013712807.1| ATPase AAA [Chlamydia pecorum]
 gb|AEB41729.1| ADP,ATP carrier protein 1 [Chlamydophila pecorum E58]
 gb|AGW38837.1| ADP/ATP carrier protein [Chlamydia pecorum W73]
Length=533

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 140/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ N+YS FMG+FS  TG+ + F M+ +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKLQYPNANDYSEFMGNFSFWTGVVSVFVMVFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FFSL++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVVFFSLVIFRDKASGLVAMFGTTPLMLAVIVGAIQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGGALIQQ +++  GS+   TP+L  +L +I+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGALIQQGLLVVCGSIGAMTPHLAIILFLII  479

Query  541  LAWLSAAKSLDVQFTA  588
              WL +A  L+  F A
Sbjct  480  AVWLVSATKLNKLFLA  495



>gb|EPP28844.1| ADP,ATP carrier protein [Chlamydia psittaci 08-2626_L3]
Length=454

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  222  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  281

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  282  TPVMVLLTGVFFFVLVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATK  341

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  342  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVII  401

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  402  AIWLVSATKLNKLF  415



>ref|WP_032742269.1| ATPase AAA, partial [Chlamydia psittaci]
Length=469

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  237  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  296

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  297  TPVMVLLTGVFFFVLVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATK  356

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  357  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVII  416

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  417  AIWLVSATKLNKLF  430



>ref|WP_020370051.1| MULTISPECIES: ADP,ATP carrier family protein [Chlamydia]
 gb|EPP35655.1| ADP,ATP carrier family protein [Chlamydia psittaci 10_1398_11]
 gb|EQM62559.1| ADP/ATP carrier protein [Chlamydia ibidis 10-1398/6]
Length=532

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 141/202 (70%), Gaps = 4/202 (2%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ + F M+ +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKLQYPNANEYSQFMGNFSFWTGVVSVFVMLFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF+L++F    +  +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVLFFALVIFRDQASGIVAMLGTTPLMLAVVVGAIQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVICGSIGAMTPYLAVTLFVII  479

Query  541  LAWLSAAKSLDVQF---TALRR  597
              WL +A  L+  F   +ALR 
Sbjct  480  GVWLVSATKLNKLFLIQSALRE  501



>ref|WP_010230191.1| ATPase AAA [Chlamydia muridarum]
 sp|Q9PKX5.1|TLC1_CHLMU RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia muridarum str. Nigg]
 gb|AAF39198.1| ADP, ATP carrier protein [Chlamydia muridarum str. Nigg]
 gb|AHH22725.1| ATPase AAA [Chlamydia muridarum str. Nigg3 CMUT3-5]
 gb|AHH23650.1| ATPase AAA [Chlamydia muridarum str. Nigg CM972]
 gb|KDU80686.1| ADP/ATP carrier protein family [Chlamydia muridarum]
 gb|KDU81343.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU82181.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU83295.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|KDU84629.1| ADP/ATP carrier protein [Chlamydia muridarum]
 gb|AID37867.1| ATPase AAA [Chlamydia muridarum str. Nigg 2 MCR]
 gb|AIT90534.1| ATPase AAA [Chlamydia muridarum]
 gb|AIT91421.1| ATPase AAA [Chlamydia muridarum]
 gb|AIW23299.1| ATPase AAA [Chlamydia muridarum]
 gb|AJR10420.1| ATPase AAA [Chlamydia muridarum]
Length=529

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PNEYS+FMG FS  TG+ + F M+ +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNEYSAFMGTFSFWTGVVSVFVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPVMVLVTGAIFFALVIFRDHATGLVAALGTTPLMLAVVVGAVQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS++  TP+L   L  I+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSISAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|WP_010882994.1| ATPase AAA [Chlamydia pneumoniae]
 ref|NP_224551.1| ADP/ATP translocase [Chlamydophila pneumoniae CWL029]
 ref|NP_444957.1| ADP, ATP carrier protein [Chlamydophila pneumoniae AR39]
 sp|Q9Z8J2.1|TLC1_CHLPN RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia pneumoniae]
 gb|AAD18495.1| ADP/ATP Translocase [Chlamydophila pneumoniae CWL029]
 gb|AAF38252.1| ADP, ATP carrier protein [Chlamydophila pneumoniae AR39]
 gb|AAP98290.1| ATP/ADP-transporter [Chlamydophila pneumoniae TW-183]
Length=515

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 140/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INL+EVTWKS+LK Q+P+ N+YS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  301  INLIEVTWKSQLKLQYPNMNDYSEFMGNFSFWTGVVSVLIMLFVGGNVIRKFGWLTGALV  360

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTG+ FF+L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  361  TPVMVLLTGIVFFALVIFRNQASGLVAMFGTTPLMLAVVVGAIQNILSKSTKYALFDSTK  420

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGGALIQQ +++  GS+   TPYL  +LL I+
Sbjct  421  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGALIQQGLLVICGSIGAMTPYLAVILLFII  480

Query  541  LAWLSAAKSLDVQFTA  588
              WL +A  L+  F A
Sbjct  481  AIWLVSATKLNKLFLA  496



>ref|WP_011324550.1| ATPase AAA [Chlamydia trachomatis]
 gb|AAX50316.1| ADP,ATP carrier protein [Chlamydia trachomatis A/HAR-13]
 emb|CAX09618.1| ADP,ATP carrier protein [Chlamydia trachomatis B/TZ1A828/OT]
 gb|AEP34876.1| ADP,ATP carrier protein [Chlamydia trachomatis A2497]
 emb|CAX08724.1| ADP,ATP carrier protein [Chlamydia trachomatis A2497]
 emb|CCP49241.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/7249]
 emb|CCP48342.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/5291]
 emb|CCP47442.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
A/363]
Length=526

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PN+YS+FMG+FS  TG+ + F M+ +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPIMVLVTGAVFFALVIFRDHATGLVAALGTTPLMLAVVVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TP+L   L  I+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|WP_010895317.1| ATPase AAA [Chlamydia pneumoniae]
 dbj|BAA98559.1| ADP/ATP translocase [Chlamydophila pneumoniae J138]
Length=515

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 140/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INL+EVTWKS+LK Q+P+ N+YS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  301  INLIEVTWKSQLKLQYPNMNDYSEFMGNFSFWTGVVSVLIMLFVGGNVIRKFGWLTGALV  360

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTG+ FF+L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  361  TPVMVLLTGIVFFALVIFRNQASGLVAMFGTTPLMLAVVVGAIQNILSKSTKYALFDSTK  420

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGGALIQQ +++  GS+   TPYL  +LL I+
Sbjct  421  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGALIQQGLLVICGSIGAMTPYLAVILLFII  480

Query  541  LAWLSAAKSLDVQFTA  588
              WL +A  L+  F A
Sbjct  481  AIWLVSATKLNKLFLA  496



>gb|EPJ16785.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC22]
Length=500

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  268  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  327

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  328  TPVMVLLTGVFFFVLVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATK  387

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  388  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVII  447

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  448  AIWLVSATKLNKLF  461



>ref|WP_011458125.1| ATPase AAA [Chlamydophila felis]
 dbj|BAE81345.1| ADP/ATP translocase [Chlamydophila felis Fe/C-56]
Length=530

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ N+YS FMG+FS  TG+ + F M+ +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKMQYPNANDYSQFMGNFSFWTGVVSVFVMLFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTG  FF+L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGTLFFTLVIFRDQASGIVAMFGTTPLMLAVVVGAIQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL  +L  I+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAVILFGII  479

Query  541  LAWLSAAKSLDVQF  582
              WL +AK L+  F
Sbjct  480  SIWLVSAKKLNKLF  493



>ref|WP_014517776.1| ATPase AAA [Chlamydia pneumoniae]
 gb|ACZ33326.1| ADP/ATP carrier protein family [Chlamydophila pneumoniae LPCoLN]
 gb|ETR80236.1| ADP/ATP Translocase, NTT1 [Chlamydia pneumoniae B21]
Length=526

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 140/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INL+EVTWKS+LK Q+P+ N+YS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  301  INLIEVTWKSQLKLQYPNMNDYSEFMGNFSFWTGVVSVLIMLFVGGNVIRKFGWLTGALV  360

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTG+ FF+L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  361  TPVMVLLTGIVFFALVIFRNQASGLVAMFGTTPLMLAVVVGAIQNILSKSTKYALFDSTK  420

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGGALIQQ +++  GS+   TPYL  +LL I+
Sbjct  421  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGALIQQGLLVICGSIGAMTPYLAVILLFII  480

Query  541  LAWLSAAKSLDVQFTA  588
              WL +A  L+  F A
Sbjct  481  AIWLVSATKLNKLFLA  496



>gb|EPJ33718.1| ADP/ATP carrier family protein, partial [Chlamydia psittaci 06-1683]
Length=510

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVFFFVLVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVII  479

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  480  AIWLVSATKLNKLF  493



>ref|WP_012727795.1| ATPase AAA [Chlamydia trachomatis]
 emb|CAX10512.1| ADP,ATP carrier protein [Chlamydia trachomatis B/Jali20/OT]
Length=528

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PN+YS+FMG+FS  TG+ + F M+ +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPIMVLVTGAVFFALVIFRDHATGLVAALGTTPLMLAVVVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TP+L   L  I+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|WP_009871413.1| ATPase AAA [Chlamydia trachomatis]
 ref|NP_219568.1| ADP/ATP translocase [Chlamydia trachomatis D/UW-3/CX]
 sp|O84068.1|TLC1_CHLTR RecName: Full=ADP,ATP carrier protein 1; AltName: Full=ADP/ATP 
translocase 1 [Chlamydia trachomatis D/UW-3/CX]
 gb|AAC67656.1| ADP/ATP Translocase [Chlamydia trachomatis D/UW-3/CX]
 gb|ADH17756.1| ADP,ATP carrier protein [Chlamydia trachomatis G/9768]
 gb|ADH18676.1| ADP,ATP carrier protein [Chlamydia trachomatis G/11222]
 gb|ADH19603.1| ADP,ATP carrier protein [Chlamydia trachomatis G/11074]
 gb|ADH96699.1| ADP,ATP carrier protein [Chlamydia trachomatis G/9301]
 gb|ADI50741.1| ADP,ATP carrier protein [Chlamydia trachomatis D-EC]
 gb|ADI51753.1| ADP,ATP carrier protein [Chlamydia trachomatis D-LC]
 emb|CCP50231.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
K/SotonK1]
 emb|CCP53140.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD5]
 emb|CCP54031.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD6]
 emb|CCP57630.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
G/SotonG1]
 emb|CCP58522.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
Ia/SotonIa1]
 emb|CCP59416.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
Ia/SotonIa3]
 gb|AGR95329.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F(s)/852]
 gb|AGR99047.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F(s)/342]
 gb|AGS01861.1| ADP,ATP carrier protein [Chlamydia trachomatis J/6276tet1]
 gb|AGT69628.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT70547.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT72389.1| ATPase AAA [Chlamydia trachomatis]
 gb|AHC16911.1| ATPase AAA [Chlamydia trachomatis C/TW-3]
Length=528

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PN+YS+FMG+FS  TG+ + F M+ +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPIMVLVTGAVFFALVIFRDHATGLVAALGTTPLMLAVVVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TP+L   L  I+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|WP_009873033.1| ATPase AAA [Chlamydia trachomatis]
 ref|YP_008655229.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SWFPminus]
 emb|CCE14119.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SW5]
 emb|CCE13230.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SW4]
 emb|CCP52247.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
D/SotonD1]
 emb|CCP56739.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
F/SotonF3]
 gb|AGT64069.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT65918.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT66848.1| ATPase AAA [Chlamydia trachomatis F/11-96]
 gb|AGT68699.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT71473.1| ATPase AAA [Chlamydia trachomatis]
 emb|CDG42069.1| ADP,ATP carrier protein [Chlamydia trachomatis F/SWFPminus]
Length=528

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PN+YS+FMG+FS  TG+ + F M+ +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPIMVLVTGAVFFALVIFRDHATGLVAALGTTPLMLAVVVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TP+L   L  I+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|WP_014541221.1| ATPase AAA [Chlamydia trachomatis]
 ref|YP_008634577.1| ADP,ATP carrier protein [Chlamydia trachomatis E/C599]
 emb|CBJ14581.1| ADP,ATP carrier protein [Chlamydia trachomatis Sweden2]
 gb|ADH16831.1| ADP,ATP carrier protein [Chlamydia trachomatis E/150]
 gb|ADH20523.1| ADP,ATP carrier protein [Chlamydia trachomatis E/11023]
 emb|CCE12341.1| ADP,ATP carrier protein [Chlamydia trachomatis E/SW3]
 emb|CCP54923.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/SotonE4]
 emb|CCP55816.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/SotonE8]
 emb|CCP60311.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
E/Bour]
 emb|CCP27852.1| ADP,ATP carrier protein [Chlamydia trachomatis IU824]
 emb|CCP28756.1| ADP,ATP carrier protein [Chlamydia trachomatis IU888]
 gb|AGT64992.1| ATPase AAA [Chlamydia trachomatis]
 gb|AGT67776.1| ATPase AAA [Chlamydia trachomatis]
 emb|CDG42958.1| ADP,ATP carrier protein [Chlamydia trachomatis E/C599]
Length=528

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PN+YS+FMG+FS  TG+ + F M+ +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPIMVLVTGAVFFALVIFRDHATGLVAALGTTPLMLAVVVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TP+L   L  I+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|WP_013747357.1| ATPase AAA [Chlamydia psittaci]
 gb|ADZ18583.1| ADP/ATP carrier protein [Chlamydia psittaci 6BC]
 gb|AEB55460.1| ADP, ATP carrier protein [Chlamydia psittaci 6BC]
 gb|AFS20568.1| ADP/ATP carrier family protein [Chlamydia psittaci GR9]
 gb|AFS21220.1| ADP/ATP carrier family protein [Chlamydia psittaci MN]
 gb|AFS22669.1| ADP/ATP carrier family protein [Chlamydia psittaci VS225]
 gb|AFS24249.1| ADP/ATP carrier family protein [Chlamydia psittaci WS/RT/E30]
 gb|AFS25137.1| ADP/ATP carrier family protein [Chlamydia psittaci M56]
 gb|AFS25886.1| ADP/ATP carrier family protein [Chlamydia psittaci WC]
 gb|AFS26909.1| ADP/ATP carrier family protein [Chlamydia psittaci CP3]
 gb|AFS27997.1| ADP/ATP carrier family protein [Chlamydia psittaci NJ1]
 emb|CCO01942.1| ADP/ATP carrier protein [Chlamydia psittaci 01DC12]
 gb|AGE75021.1| ADP/ATP carrier protein [Chlamydia psittaci Mat116]
 gb|EPJ24811.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC77]
 gb|EPJ26367.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC80]
 gb|EPJ27592.1| ADP,ATP carrier protein [Chlamydia psittaci 99DC5]
 gb|EPJ29787.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC78]
 gb|EPL01129.1| ADP,ATP carrier protein [Chlamydia psittaci 09DC79]
 gb|EPP31854.1| ADP,ATP carrier protein [Chlamydia psittaci C1/97]
Length=532

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVFFFVLVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVII  479

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  480  AIWLVSATKLNKLF  493



>ref|WP_006343113.1| ATPase AAA [Chlamydia psittaci]
 ref|YP_004064394.1| ADP/ATP carrier protein [Chlamydia psittaci RD1]
 emb|CBY16956.1| ADP/ATP carrier protein [Chlamydia psittaci RD1]
 gb|EGF85036.1| ADP/ATP carrier protein [Chlamydia psittaci Cal10]
 gb|AEG85482.1| ADP/ATP carrier protein [Chlamydia psittaci C19/98]
 gb|AEG86461.1| ADP/ATP carrier protein [Chlamydia psittaci 01DC11]
 gb|AEG87435.1| ADP/ATP carrier protein [Chlamydia psittaci 02DC15]
 gb|AEG88411.1| ADP/ATP carrier protein [Chlamydia psittaci 08DC60]
 gb|EPJ13171.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC16]
 gb|EPJ14902.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC15]
 gb|EPJ15526.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC18]
 gb|EPJ18880.1| ADP,ATP carrier protein [Chlamydia psittaci 01DC11]
 gb|EPJ20128.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC21]
 gb|EPJ21222.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC23]
 gb|EPJ21971.1| ADP,ATP carrier protein [Chlamydia psittaci 04DC42]
 gb|EPJ23230.1| ADP,ATP carrier protein [Chlamydia psittaci 03DC29]
 gb|EPJ24421.1| ADP,ATP carrier protein [Chlamydia psittaci 08DC60]
 gb|EPJ29395.1| ADP,ATP carrier protein [Chlamydia psittaci C19/98]
 gb|EPJ30143.1| ADP,ATP carrier protein [Chlamydia psittaci 03DC35]
 gb|EPJ97988.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC14]
 gb|EPL00331.1| ADP,ATP carrier protein [Chlamydia psittaci 02DC24]
 gb|EPP33497.1| ADP,ATP carrier protein [Chlamydia psittaci C6/98]
Length=532

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVFFFVLVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVII  479

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  480  AIWLVSATKLNKLF  493



>gb|EKE09902.1| hypothetical protein ACD_16C00100G0064 [uncultured bacterium]
Length=505

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 134/190 (71%), Gaps = 1/190 (1%)
 Frame = +1

Query  7    NLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKITP  186
            N+++VTWKS++K  FP PN+Y SFM +FS  TGI+T   +LL++ +  ++GW V A +TP
Sbjct  303  NIIDVTWKSQVKENFPEPNDYFSFMANFSFWTGISTVIFILLTKGIVRRFGWFVGAMVTP  362

Query  187  TVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEM  366
            +V L+T + FFS ILF   L   L  FG+T LL AVYVGA+QNI  KS KYSLFDP KEM
Sbjct  363  SVFLITTILFFSFILFKDYLEGLLLLFGVTSLLMAVYVGAIQNILGKSMKYSLFDPTKEM  422

Query  367  AYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQF-MILTFGSLANSTPYLGGVLLVIVL  543
             YIPLD++ KVKGKAA+DV+ +  GKS G +IQ F +ILT G+     PYL GVL+ I+L
Sbjct  423  TYIPLDQELKVKGKAAVDVIFSRFGKSSGGIIQIFLLILTAGTQMTIMPYLSGVLIFIML  482

Query  544  AWLSAAKSLD  573
             W+ A K L 
Sbjct  483  IWMGAVKGLS  492



>ref|WP_032741515.1| ATPase AAA [Chlamydia psittaci]
Length=545

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  313  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  372

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  373  TPVMVLLTGVFFFVLVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATK  432

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  433  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVII  492

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  493  AIWLVSATKLNKLF  506



>ref|WP_011006397.1| ATPase AAA [Chlamydophila caviae]
 gb|AAP05181.1| ADP, ATP carrier protein [Chlamydophila caviae GPIC]
Length=533

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKMQYPNANEYSQFMGNFSFWTGVVSVIVMLFVGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF+L++F    +  +AT G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVLFFALVIFRDQASGIVATLGTTPLMLAVMVGAIQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L +I+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQSLLVVCGSIGAMTPYLAIALFLII  479

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  480  AVWLVSATKLNKLF  493



>ref|WP_006344068.1| ATPase AAA [Chlamydophila abortus]
 gb|EGK69188.1| ADP/ATP carrier protein [Chlamydophila abortus LLG]
Length=532

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVFFFILVIFRDQASGIVAMFGTTPLMLAVMVGAIQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L +I+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFLII  479

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  480  AVWLVSATKLNKLF  493



>ref|WP_011097058.1| ATPase AAA [Chlamydophila abortus]
 emb|CAH63874.1| ADP/ATP carrier protein [Chlamydophila abortus S26/3]
 emb|CED80479.1| ADP/ATP carrier protein [Chlamydophila abortus]
Length=532

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +
Sbjct  300  INLVEVTWKSQLKMQYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALV  359

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++LLTGV FF L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  360  TPVMVLLTGVFFFILVIFRDQASGIVAMFGTTPLMLAVMVGAIQNILSKSTKYALFDATK  419

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L +I+
Sbjct  420  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFLII  479

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  480  AVWLVSATKLNKLF  493



>ref|WP_009873532.1| ATPase AAA [Chlamydia trachomatis]
 ref|YP_001654404.1| ADP,ATP carrier protein [Chlamydia trachomatis 434/Bu]
 ref|YP_007717365.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Canada2]
 emb|CAB39534.1| nucleoside triphosphate transport protein 1 [Chlamydia trachomatis]
 emb|CAP03760.1| ADP,ATP carrier protein [Chlamydia trachomatis 434/Bu]
 emb|CAP06714.1| ADP,ATP carrier protein [Chlamydia trachomatis L2b/UCH-1/proctitis]
 gb|AEJ76967.1| ADP,ATP carrier protein 1 [Chlamydia trachomatis L2c]
 emb|CCP51356.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/8200/07]
 emb|CCP61209.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/795]
 emb|CCP62100.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/440/LN]
 emb|CCP63882.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/115]
 emb|CCP64771.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/224]
 emb|CCP65661.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2/25667R]
 emb|CCP66551.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L3/404/LN]
 emb|CCP67439.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/UCH-2]
 emb|CCP68329.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Canada2]
 emb|CCP69221.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/LST]
 emb|CCP70111.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams1]
 emb|CCP71001.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/CV204]
 emb|CCP90166.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams2]
 emb|CCP91056.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams3]
 emb|CCP91946.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Canada1]
 emb|CCP92841.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams4]
 emb|CCP93731.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L2b/Ams5]
 gb|AGJ65359.1| ATPase AAA [Chlamydia trachomatis L2/434/Bu(f)]
 gb|AGJ64419.1| ATPase AAA [Chlamydia trachomatis L2/434/Bu(i)]
 gb|AGR93480.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-F/69]
 gb|AGR94404.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2(s)/46]
 gb|AGR96282.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/943]
 gb|AGR97209.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/953]
 gb|AGR98129.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2(s)/3]
 gb|AGR99998.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J(s)/122]
 gb|AGS00936.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/966]
 gb|AGS02818.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-J/971]
 gb|AGS03743.1| ADP,ATP carrier protein [Chlamydia trachomatis RC-L2/55]
Length=528

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PN+YS+FMG+FS  TG+ + F M+ +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPIMVLVTGAVFFALVIFRDHATGLVAALGTTPLMLAVVVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            E+AYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TP+L   L  I+
Sbjct  419  ELAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|WP_015506544.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis]
 emb|CCP62992.1| ADP/ATP carrier protein family protein [Chlamydia trachomatis 
L1/1322/p2]
Length=528

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 139/196 (71%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PN+YS+FMG+FS  TG+ + F M+ +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPIMVLVTGAVFFALVIFRDHATGLVAALGTTPLMLAVVVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            E+AYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TP+L   L  I+
Sbjct  419  ELAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|WP_035405565.1| ATPase AAA [Chlamydia suis]
 gb|ESN89754.1| ADP,ATP carrier protein 1 [Chlamydia suis MD56]
Length=529

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 138/196 (70%), Gaps = 1/196 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK QFP+PN+YS+FMG FS  TG+ +  +ML +   V  ++GW   A +
Sbjct  299  INLVEVTWKSQLKMQFPNPNDYSAFMGQFSFWTGVVSVIVMLFIGGNVIRRFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L+TG  FF+L++F       +A  G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPIMVLVTGAIFFALVIFRDHATGLVAALGTTPLMLAVVVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TP+L   L  I+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPFLAVALFAII  478

Query  541  LAWLSAAKSLDVQFTA  588
            + WL++A  L+  F A
Sbjct  479  MVWLTSATKLNKLFLA  494



>ref|XP_005769878.1| hypothetical protein EMIHUDRAFT_451418 [Emiliania huxleyi CCMP1516]
 gb|EOD17449.1| hypothetical protein EMIHUDRAFT_451418 [Emiliania huxleyi CCMP1516]
Length=513

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 121/169 (72%), Gaps = 11/169 (7%)
 Frame = +1

Query  112  TFTMMLLSQWVFDKYGWGVAAKITPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAA  291
            T  MML  Q +F  +GWG AA +TPT+L +TG  FFSLILFG  L+P +A  G TPL+ A
Sbjct  335  TLFMMLAGQRIFKYFGWGAAALVTPTMLFITGAIFFSLILFGGSLSPLVAALGTTPLMLA  394

Query  292  VYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVV-----------CNPL  438
            V VGA QNI SKS+KYSLFDPCKEMAYIPLD + K KGKAA+DV+            NPL
Sbjct  395  VVVGAAQNILSKSSKYSLFDPCKEMAYIPLDAEAKTKGKAAVDVIGSELRADRSSTRNPL  454

Query  439  GKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDVQFT  585
            GKSGG+L+QQ MI + GSLA STPYL G L VI+  WL AA+SL+ QFT
Sbjct  455  GKSGGSLLQQAMIFSVGSLAASTPYLAGCLFVIIAVWLRAARSLNTQFT  503



>gb|EYE60388.1| ADP,ATP carrier protein 2 [Bacteroides fragilis str. S6L5]
Length=506

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 135/194 (70%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ + F M+ +   V  K+GW   A +
Sbjct  270  INLVEVTWKSQLKMQYPNANEYSQFMGNFSFWTGVVSVFVMLFIGGNVIRKFGWLTGALV  329

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L TGV FF+L++F    +  +   G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  330  TPVMVLATGVLFFTLVIFRDQSSGIVTALGTTPLMLAVIVGAVQNILSKSTKYALFDATK  389

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  390  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVICGSIGAMTPYLAIALFVII  449

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  450  SIWLISATKLNKLF  463



>gb|AAL10405.1|AF416339_1 ADP/ATP translocase [Medicago sativa]
Length=105

 Score =   189 bits (479),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/97 (95%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  244  LAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV  423
            +AP LA+ GMTPLL AVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV
Sbjct  1    IAPGLASIGMTPLLTAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDV  60

Query  424  VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV  534
            VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV
Sbjct  61   VCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLV  97



>ref|WP_021828277.1| MULTISPECIES: ADP/ATP carrier family protein [Bacteria]
 gb|ERL53970.1| ADP/ATP carrier family protein [Chlamydia gallinacea 08-1274/3]
Length=535

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 135/194 (70%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ + F M+ +   V  K+GW   A +
Sbjct  299  INLVEVTWKSQLKMQYPNANEYSQFMGNFSFWTGVVSVFVMLFIGGNVIRKFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L TGV FF+L++F    +  +   G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPVMVLATGVLFFTLVIFRDQSSGIVTALGTTPLMLAVIVGAVQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVICGSIGAMTPYLAIALFVII  478

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  479  SIWLISATKLNKLF  492



>ref|WP_020356125.1| MULTISPECIES: ADP,ATP carrier protein [Chlamydia]
 gb|EPP36701.1| ADP,ATP carrier protein [Chlamydia psittaci 10_743_SC13]
 gb|EPP38163.1| ADP,ATP carrier protein [Chlamydia psittaci 10_881_SC42]
 gb|AHK63109.1| ADP,ATP carrier protein 1 [Chlamydia avium 10DC88]
Length=534

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 134/194 (69%), Gaps = 1/194 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIAT-FTMMLLSQWVFDKYGWGVAAKI  180
            INLVEVTWKS+LK Q+P+ NEYS FMG+FS  TG+ + F M+ +   V  K+GW   A +
Sbjct  299  INLVEVTWKSQLKMQYPNANEYSQFMGNFSFWTGVVSVFVMLFIGGNVIRKFGWLTGALV  358

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP ++L TG+ FF+L++F       +   G TPL+ AV VGA+QNI SKS KY+LFD  K
Sbjct  359  TPVMVLATGILFFALVIFRDQAFGIVTALGTTPLMLAVIVGAIQNILSKSTKYALFDATK  418

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EMAYIPLD++ KVKGKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+
Sbjct  419  EMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLIQQGLLVICGSIGAMTPYLAIALFVII  478

Query  541  LAWLSAAKSLDVQF  582
              WL +A  L+  F
Sbjct  479  SIWLISATKLNKLF  492



>ref|NP_001046257.2| Os02g0208100 [Oryza sativa Japonica Group]
 dbj|BAF08171.2| Os02g0208100 [Oryza sativa Japonica Group]
Length=108

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +1

Query  79   MGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKITPTVLLLTGVGFFSLILFGAPLAPTL  258
            MGDFSTATGIATFTMMLL + +  K+GWGVAA ITP VLLLTGVGFFSLILFG PL P +
Sbjct  1    MGDFSTATGIATFTMMLLGRVILRKFGWGVAATITPAVLLLTGVGFFSLILFGEPLTPLM  60

Query  259  ATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKV  399
            AT GMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDED KV
Sbjct  61   ATLGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDMKV  107



>gb|EKE09230.1| hypothetical protein ACD_16C00205G0026 [uncultured bacterium]
Length=511

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 135/197 (69%), Gaps = 2/197 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINLVEVTWKS+LK Q+ + N +++FMG+FST TGIAT  ++LL + +  ++GW   A +
Sbjct  302  SINLVEVTWKSELKMQYANENAFAAFMGNFSTFTGIATIALILLGKGIIRRFGWFTGAIL  361

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP +L +TGV FF+ ++F   L+      G TPL  AV +GA QNI SK  KYSLFDP K
Sbjct  362  TPLILSITGVLFFTFVIFSDSLSWMTLLMGTTPLFMAVMIGATQNILSKGTKYSLFDPTK  421

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANST--PYLGGVLLV  534
            EM+YIPLD++ KVKGKAA DV+   LGKSGGA++QQF+++   +    T  PY  G+LLV
Sbjct  422  EMSYIPLDQELKVKGKAAADVIGGRLGKSGGAIVQQFLLVISATATQLTIAPYTCGLLLV  481

Query  535  IVLAWLSAAKSLDVQFT  585
            ++ AW+ A   L   + 
Sbjct  482  VIFAWMFAVGGLSKMYN  498



>gb|AEZ00863.1| putative ATP-ADP-transporter protein, partial [Elaeis guineensis]
Length=174

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  292  VYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQF  471
            VYVGA+QNIFSKS+KYSLFDPCKEM YIPLDED KVK KAAIDVVCNPLGKSGGALIQQF
Sbjct  1    VYVGALQNIFSKSSKYSLFDPCKEMVYIPLDEDMKVKSKAAIDVVCNPLGKSGGALIQQF  60

Query  472  MILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDVQFTALRR  597
            MILTFGSLANSTPYLGG+LLVIVL+W+ AA+SLD QF+ L +
Sbjct  61   MILTFGSLANSTPYLGGILLVIVLSWIGAARSLDSQFSPLAK  102



>gb|AFS19476.1| ADP/ATP carrier protein [Chlamydia psittaci 84/55]
Length=220

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 124/180 (69%), Gaps = 1/180 (1%)
 Frame = +1

Query  46   QFPSPNEYSSFMGDFSTATGIATFTMML-LSQWVFDKYGWGVAAKITPTVLLLTGVGFFS  222
            Q+P+ NEYS FMG+FS  TG+ +  +ML +   V  K+GW   A +TP ++LLTGV FF 
Sbjct  2    QYPNANEYSEFMGNFSFWTGVVSVIVMLFIGGNVIRKFGWLTGALVTPVMVLLTGVFFFV  61

Query  223  LILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVK  402
            L++F    +  +A FG TPL+ AV VGA+QNI SKS KY+LFD  KEMAYIPLD++ KVK
Sbjct  62   LVIFRDQASGIVAMFGTTPLMLAVMVGAVQNILSKSTKYALFDATKEMAYIPLDQEQKVK  121

Query  403  GKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIVLAWLSAAKSLDVQF  582
            GKAAIDVV    GKSGG+LIQQ +++  GS+   TPYL   L VI+  WL +A  L+  F
Sbjct  122  GKAAIDVVAARFGKSGGSLIQQGLLVVCGSIGAMTPYLAIALFVIIAIWLVSATKLNKLF  181



>ref|WP_018576123.1| hypothetical protein [Legionella shakespearei]
Length=529

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 136/199 (68%), Gaps = 6/199 (3%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINL+EV WK  LK Q+P+PN+Y++FMG FS  TGI T T++++ + +  K+GW   A +
Sbjct  302  SINLIEVIWKGMLKEQYPNPNDYNAFMGAFSVTTGIVTMTLIMMFKGIVRKFGWFTGAIM  361

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VLL+TG  F++ +LF   + P  A FG T L  AV +GA+QN+ SK+ KYSLFDP K
Sbjct  362  TPAVLLITGGFFYAFVLFEGHMQPVAAFFGTTTLFMAVILGAIQNVASKATKYSLFDPTK  421

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVIV  540
            EM+YIPLD++ KVKGKAA+DV+ N  GK+GG +I  F+++   + A+S   +   L+ IV
Sbjct  422  EMSYIPLDQELKVKGKAAVDVIGNSFGKAGGGMISGFILVI--TAASSVVMIAHFLVFIV  479

Query  541  LA----WLSAAKSLDVQFT  585
            +A    W+ A K+L V + 
Sbjct  480  IATTLSWMYAVKNLSVLYN  498



>ref|WP_038460622.1| ATPase AAA [Candidatus Caedibacter acanthamoebae]
 gb|AIL13243.1| ATPase AAA [Candidatus Caedibacter acanthamoebae]
Length=508

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 1/200 (1%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            SINL+EV WK +LK  FP+PN+Y +FMG FS ATGI T  ++  ++ +  K+GW   A +
Sbjct  305  SINLIEVVWKDQLKQAFPNPNDYGAFMGKFSRATGIVTMLLIWFTKGIVRKFGWFTGAIV  364

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPCK  360
            TP VL++TG  FF+ +LF   L P +A FG+T  L A Y+GA+QNI SK  KYS FDP K
Sbjct  365  TPAVLIITGALFFAFVLFKDELTPLVAGFGLTATLMATYIGAIQNILSKGTKYSNFDPTK  424

Query  361  EMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQ-FMILTFGSLANSTPYLGGVLLVI  537
            EMAYIPLD++ KVKGKAA+DV+   LGK+GG  +QQ  +I T G +    PYL GV+ V+
Sbjct  425  EMAYIPLDQELKVKGKAAVDVIGGRLGKAGGGYVQQGLLIATAGDIMTIAPYLAGVVGVV  484

Query  538  VLAWLSAAKSLDVQFTALRR  597
            V AW+ A K L  ++ AL +
Sbjct  485  VGAWVIAVKGLSKKYNALIK  504



>ref|WP_013182747.1| ATPase AAA [Waddlia chondrophila]
 gb|ADI39043.1| putative ADP/ATP translocase [Waddlia chondrophila WSU 86-1044]
Length=531

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 128/198 (65%), Gaps = 2/198 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGI-ATFTMMLLSQWVFDKYGWGVAAKI  180
            INLVEV WKS+L+  +PSPN+Y+ ++   ST  GI AT   + +S     K+GW   A +
Sbjct  301  INLVEVVWKSQLRELYPSPNDYNLYINQVSTIIGIVATIAALFVSGNSLRKFGWTTTAML  360

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTL-ATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            TP  LL+T + FF L  F   L     A FGM+PL   V  G++QNI  + AKY++FD  
Sbjct  361  TPLTLLVTSILFFGLFFFKDNLEGVAWALFGMSPLALVVLAGSVQNILCRGAKYTVFDAT  420

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMA++PL ++ KVKGKAAID VCN LGKSGG++I Q ++L F + + S PY+  VLLVI
Sbjct  421  KEMAFVPLSDEYKVKGKAAIDGVCNRLGKSGGSMIHQSLLLYFVTFSASAPYVAAVLLVI  480

Query  538  VLAWLSAAKSLDVQFTAL  591
            +  W  A K L ++F AL
Sbjct  481  ISCWSVAVKFLGIEFNAL  498



>ref|WP_013950719.1| ATPase AAA [Candidatus Midichloria mitochondrii]
 gb|AEI88503.1| ATP/ADP translocase class 1 [Candidatus Midichloria mitochondrii 
IricVA]
Length=497

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 133/200 (67%), Gaps = 3/200 (2%)
 Frame = +1

Query  1    SINLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGIATFTMMLLSQWVFDKYGWGVAAKI  180
            +INLVE  WK+K++  +P+ NEY+ FMG+F   TGI T   M+L   +     W  AA I
Sbjct  293  TINLVEGPWKAKIRELYPTQNEYAHFMGEFIQWTGIVTILFMILGSNILKNVRWFTAAII  352

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATF-GMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            TP ++L+TG GFF+ ++F   LAP +  F  M+P++ AV++GA+QN+ SK+ KY++FD  
Sbjct  353  TPLMILITGGGFFAFVIFEKELAPWMEDFMKMSPIVIAVFLGALQNVLSKATKYTMFDAT  412

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQ--FMILTFGSLANSTPYLGGVLL  531
            KEMA+IPLD++ K KGKAA+DVV   L KSGGA+IQ   FM+    + +  TP L G+ L
Sbjct  413  KEMAFIPLDDELKSKGKAAVDVVGGRLAKSGGAIIQSSIFMLFPMATFSTITPTLTGIFL  472

Query  532  VIVLAWLSAAKSLDVQFTAL  591
             +++ W+ A + L+  +T L
Sbjct  473  FLMICWILAVRGLNKDYTLL  492



>emb|CCB92155.1| ADP,ATP carrier protein 1 [Waddlia chondrophila 2032/99]
Length=540

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 128/198 (65%), Gaps = 2/198 (1%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGI-ATFTMMLLSQWVFDKYGWGVAAKI  180
            INLVEV WKS+L+  +PSPN+Y+ ++   ST  GI AT   + +S     K+GW   A +
Sbjct  310  INLVEVVWKSQLRELYPSPNDYNLYINQVSTIIGIVATIAALFVSGNSLRKFGWTTTAML  369

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTL-ATFGMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            TP  LL+T + FF L  F   L     A FGM+PL   V  G++QNI  + AKY++FD  
Sbjct  370  TPLTLLVTSILFFGLFFFKDNLEGVAWALFGMSPLALVVLAGSVQNILCRGAKYTVFDAT  429

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMA++PL ++ KVKGKAAID VCN LGKSGG++I Q ++L F + + S PY+  VLLVI
Sbjct  430  KEMAFVPLSDEYKVKGKAAIDGVCNRLGKSGGSMIHQSLLLYFVTFSASAPYVAAVLLVI  489

Query  538  VLAWLSAAKSLDVQFTAL  591
            +  W  A K L ++F AL
Sbjct  490  ISCWSVAVKFLGIEFNAL  507



>gb|KIC76343.1| ADP,ATP carrier protein 1 [Neochlamydia sp. EPS4]
Length=530

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 132/200 (66%), Gaps = 3/200 (2%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGI-ATFTMMLLSQWVFDKYGWGVAAKI  180
            INLVEV WK +L+  + SP +Y++++ + ++  G+ +TF  + +++++  ++GW   A +
Sbjct  303  INLVEVVWKDQLRYLYSSPKDYNTYINNLTSIQGVVSTFAALFMAKFI-SRFGWTCTALV  361

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATF-GMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            TP  +L+T  GFF  + F   L+ T+    G TPL  AV+ G+ QN  SK+AKYS FD  
Sbjct  362  TPLTMLVTSAGFFCFMFFQNHLSDTVIMLTGTTPLAIAVFFGSAQNCLSKAAKYSFFDTT  421

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMA+IPL  + K+KGKAAID V + LGKSGG+LI Q +++ FG+L  S PY+  +LLV+
Sbjct  422  KEMAFIPLSHECKLKGKAAIDGVGSRLGKSGGSLIHQGLLMFFGNLVMSAPYVASILLVV  481

Query  538  VLAWLSAAKSLDVQFTALRR  597
            ++ W  A +SL  QF  L R
Sbjct  482  IIFWFVACRSLGRQFNDLVR  501



>ref|WP_042241994.1| ATPase AAA [Neochlamydia sp. S13]
Length=522

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 132/200 (66%), Gaps = 3/200 (2%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATGI-ATFTMMLLSQWVFDKYGWGVAAKI  180
            INLVEV WK +L+  + SP +Y++++ + ++  G+ +TF  + +++++  ++GW   A +
Sbjct  295  INLVEVVWKDQLRYLYSSPKDYNTYINNLTSIQGVVSTFAALFMAKFI-SRFGWTCTALV  353

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTLATF-GMTPLLAAVYVGAMQNIFSKSAKYSLFDPC  357
            TP  +L+T  GFF  + F   L+ T+    G TPL  AV+ G+ QN  SK+AKYS FD  
Sbjct  354  TPLTMLVTSAGFFCFMFFQNHLSDTVIMLTGTTPLAIAVFFGSAQNCLSKAAKYSFFDTT  413

Query  358  KEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVLLVI  537
            KEMA+IPL  + K+KGKAAID V + LGKSGG+LI Q +++ FG+L  S PY+  +LLV+
Sbjct  414  KEMAFIPLSHECKLKGKAAIDGVGSRLGKSGGSLIHQGLLMFFGNLVMSAPYVASILLVV  473

Query  538  VLAWLSAAKSLDVQFTALRR  597
            ++ W  A +SL  QF  L R
Sbjct  474  IIFWFVACRSLGRQFNDLVR  493



>ref|WP_013944554.1| ATPase AAA [Simkania negevensis]
 emb|CCB90088.1| ADP,ATP carrier protein 1 [Simkania negevensis Z]
Length=526

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 133/201 (66%), Gaps = 7/201 (3%)
 Frame = +1

Query  4    INLVEVTWKSKLKAQFPSPNEYSSFMGDFSTATG-IATFTMMLLSQWVFDKYGWGVAAKI  180
            IN+VE+ WK ++K  +P+PN++  +MG   +A G +ATF  + LS  +  + GW V+A I
Sbjct  303  INMVEIIWKDQIKELYPNPNDFIVYMGKVMSAIGWVATFVGLFLSSNLIRRLGWTVSALI  362

Query  181  TPTVLLLTGVGFFSLILFGAPLAPTL----ATFGMTPLLAAVYVGAMQNIFSKSAKYSLF  348
            TP  LL+TGV FF  ILF     PTL    A  G TPL   V  G +QN+ S++ KY+LF
Sbjct  363  TPVALLVTGVFFFGFILFKN--NPTLVGWTAAIGFTPLALGVLFGTIQNVMSRACKYTLF  420

Query  349  DPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALIQQFMILTFGSLANSTPYLGGVL  528
            D  KE+A+IPL  ++K+KGKAAID V + +GKSGG+++   +++ FGS++ S PY+G +L
Sbjct  421  DSTKEIAFIPLSPESKLKGKAAIDGVGSRVGKSGGSIVHGGLLMLFGSVSLSAPYVGLIL  480

Query  529  LVIVLAWLSAAKSLDVQFTAL  591
            L +V  W+ AA+SL  QF  L
Sbjct  481  LAVVFGWIGAARSLGRQFNLL  501



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510