BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS142A08

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAA34099.1|  plasma membrane H+ ATPase                               255   8e-80   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                260   4e-77   Sesamum indicum [beniseed]
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               253   4e-76   Erythranthe guttata [common monkey flower]
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          256   7e-76   Amborella trichopoda
ref|NP_001234775.1|  plasma membrane ATPase 1                           256   8e-76   Solanum lycopersicum
emb|CDP14881.1|  unnamed protein product                                256   8e-76   Coffea canephora [robusta coffee]
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         256   1e-75   Cucumis melo [Oriental melon]
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    256   2e-75   Pyrus x bretschneideri [bai li]
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    256   2e-75   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           255   2e-75   Solanum tuberosum [potatoes]
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                255   2e-75   Nicotiana tomentosiformis
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         255   2e-75   Prunus mume [ume]
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         255   2e-75   
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         255   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    255   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    255   3e-75   Nelumbo nucifera [Indian lotus]
ref|NP_001234477.1|  plasma membrane H+-ATPase                          255   3e-75   Solanum lycopersicum
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    254   3e-75   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     254   3e-75   Vitis vinifera
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             254   3e-75   Prunus persica
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                254   4e-75   Nicotiana sylvestris
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           254   5e-75   Solanum tuberosum [potatoes]
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    254   7e-75   
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   249   7e-75   Citrus sinensis [apfelsine]
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   249   8e-75   Citrus sinensis [apfelsine]
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         253   9e-75   Fragaria vesca subsp. vesca
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     253   1e-74   Eucalyptus grandis [rose gum]
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                253   1e-74   Nicotiana sylvestris
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     253   2e-74   Eucalyptus grandis [rose gum]
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         253   2e-74   Eucalyptus grandis [rose gum]
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    252   2e-74   Populus euphratica
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      252   3e-74   Solanum tuberosum [potatoes]
gb|AAA34052.1|  H+-translocating ATPase                                 252   4e-74   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    251   5e-74   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    249   6e-74   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                251   6e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                251   6e-74   
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         251   9e-74   Tarenaya hassleriana [spider flower]
gb|AFC88896.1|  plasma membrane H+-ATPase                               250   1e-73   Melastoma malabathricum
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                250   1e-73   Nicotiana tomentosiformis
gb|AAQ55291.1|  plasma membrane H+-ATPase                               250   1e-73   Juglans regia
dbj|BAD16689.1|  plasma membrane H+-ATPase                              250   1e-73   Daucus carota [carrots]
gb|KJB19307.1|  hypothetical protein B456_003G094300                    249   2e-73   Gossypium raimondii
dbj|BAC77532.1|  plasma membrane H+-ATPase                              249   3e-73   Sesbania rostrata
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                249   3e-73   Nicotiana sylvestris
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    249   3e-73   Citrus sinensis [apfelsine]
gb|KJB19302.1|  hypothetical protein B456_003G094300                    249   3e-73   Gossypium raimondii
gb|KJB19303.1|  hypothetical protein B456_003G094300                    249   4e-73   Gossypium raimondii
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             249   4e-73   Citrus clementina [clementine]
gb|KJB19306.1|  hypothetical protein B456_003G094300                    249   4e-73   Gossypium raimondii
gb|KJB19305.1|  hypothetical protein B456_003G094300                    249   5e-73   Gossypium raimondii
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         248   7e-73   Jatropha curcas
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    251   8e-73   
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    247   2e-72   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         247   2e-72   Populus euphratica
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type          247   2e-72   Vitis vinifera
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    246   3e-72   
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like     246   3e-72   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             246   3e-72   Phaseolus vulgaris [French bean]
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    246   5e-72   
gb|KEH31901.1|  plasma membrane H+-ATPase                               246   5e-72   Medicago truncatula
dbj|BAD16686.1|  plasma membrane H+-ATPase                              245   7e-72   Daucus carota [carrots]
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    245   7e-72   Glycine max [soybeans]
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         245   7e-72   Glycine soja [wild soybean]
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    245   1e-71   Glycine max [soybeans]
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                245   1e-71   Cucumis melo [Oriental melon]
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    244   1e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             244   2e-71   Capsella rubella
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    243   3e-71   
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         243   4e-71   Phoenix dactylifera
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             242   4e-71   Phaseolus vulgaris [French bean]
ref|XP_002864812.1|  AHA11-ATPASE 11                                    243   4e-71   Arabidopsis lyrata subsp. lyrata
ref|NP_201073.1|  H(+)-ATPase 11                                        243   6e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66977.1|  hypothetical protein M569_07799                         242   7e-71   Genlisea aurea
emb|CAB41144.1|  H+-transporting ATPase-like protein                    243   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             243   7e-71   
ref|NP_190378.2|  H(+)-ATPase 4                                         243   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           242   8e-71   Elaeis guineensis
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    242   1e-70   Brassica rapa
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    242   1e-70   Brassica rapa
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             242   1e-70   Phaseolus vulgaris [French bean]
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    242   1e-70   Brassica rapa
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           241   2e-70   Oryza brachyantha
ref|NP_001067382.1|  Os12g0638700                                       241   2e-70   
emb|CAC29435.1|  P-type H+-ATPase                                       241   2e-70   Vicia faba [broad bean]
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    241   3e-70   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    241   3e-70   
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    240   5e-70   Cicer arietinum [garbanzo]
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              239   5e-70   
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    240   5e-70   Glycine max [soybeans]
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     240   5e-70   Phoenix dactylifera
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           240   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          240   6e-70   Sorghum bicolor [broomcorn]
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    239   8e-70   Glycine max [soybeans]
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           239   8e-70   Setaria italica
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    239   9e-70   
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    239   9e-70   
emb|CDY45757.1|  BnaC02g42250D                                          239   1e-69   Brassica napus [oilseed rape]
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    238   2e-69   
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    238   2e-69   Cucumis sativus [cucumbers]
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             238   2e-69   Capsella rubella
gb|KHN13245.1|  Plasma membrane ATPase 1                                238   2e-69   Glycine soja [wild soybean]
gb|KJB33644.1|  hypothetical protein B456_006G023600                    237   2e-69   Gossypium raimondii
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like           238   3e-69   Brachypodium distachyon [annual false brome]
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     238   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                237   5e-69   Elaeis guineensis
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           237   6e-69   Setaria italica
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     237   6e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB33642.1|  hypothetical protein B456_006G023600                    236   1e-68   Gossypium raimondii
gb|KJB33641.1|  hypothetical protein B456_006G023600                    236   1e-68   Gossypium raimondii
gb|KEH24965.1|  plasma membrane H+-ATPase                               236   1e-68   Medicago truncatula
gb|KJB33643.1|  hypothetical protein B456_006G023600                    236   1e-68   Gossypium raimondii
gb|KEH24964.1|  plasma membrane H+-ATPase                               236   1e-68   Medicago truncatula
gb|KDP45466.1|  hypothetical protein JCGZ_09715                         236   2e-68   Jatropha curcas
gb|KHN34200.1|  ATPase 11, plasma membrane-type                         235   2e-68   Glycine soja [wild soybean]
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           235   2e-68   Glycine max [soybeans]
ref|XP_007032427.1|  H(+)-ATPase 4 isoform 1                            235   3e-68   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    235   3e-68   Cucumis melo [Oriental melon]
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    235   3e-68   Sesamum indicum [beniseed]
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           235   3e-68   Citrus sinensis [apfelsine]
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                            235   4e-68   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    235   4e-68   Eucalyptus grandis [rose gum]
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     235   4e-68   Eucalyptus grandis [rose gum]
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  234   5e-68   Citrus sinensis [apfelsine]
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  234   5e-68   Citrus sinensis [apfelsine]
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             234   6e-68   Citrus clementina [clementine]
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    234   6e-68   
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g             234   9e-68   Phaseolus vulgaris [French bean]
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                233   1e-67   Brachypodium distachyon [annual false brome]
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           233   2e-67   Oryza brachyantha
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             233   2e-67   
ref|NP_001059093.1|  Os07g0191200                                       233   3e-67   
gb|EEC81667.1|  hypothetical protein OsI_25220                          232   3e-67   Oryza sativa Indica Group [Indian rice]
dbj|BAA06629.1|  plasma membrane H+-ATPase                              232   4e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like           232   5e-67   Prunus mume [ume]
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    231   6e-67   Brachypodium distachyon [annual false brome]
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    231   7e-67   Brachypodium distachyon [annual false brome]
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                     231   7e-67   Eucalyptus grandis [rose gum]
gb|EMT26085.1|  Plasma membrane ATPase 1                                231   7e-67   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           231   8e-67   
gb|AEQ27823.1|  PM H+-ATPase L                                          231   8e-67   Eichhornia crassipes
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type         231   9e-67   Eucalyptus grandis [rose gum]
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                     231   9e-67   Eucalyptus grandis [rose gum]
gb|EMS45119.1|  Plasma membrane ATPase 1                                230   2e-66   Triticum urartu
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                230   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           230   2e-66   Sesamum indicum [beniseed]
emb|CDP02191.1|  unnamed protein product                                230   2e-66   Coffea canephora [robusta coffee]
ref|XP_011466246.1|  PREDICTED: plasma membrane ATPase 1-like iso...    230   2e-66   Fragaria vesca subsp. vesca
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           229   3e-66   Setaria italica
ref|XP_004302360.1|  PREDICTED: plasma membrane ATPase 1-like iso...    229   3e-66   Fragaria vesca subsp. vesca
gb|KDP28822.1|  hypothetical protein JCGZ_14593                         229   3e-66   Jatropha curcas
dbj|BAK04567.1|  predicted protein                                      229   4e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    229   5e-66   
dbj|BAJ92653.1|  predicted protein                                      229   5e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP09440.1|  unnamed protein product                                228   1e-65   Coffea canephora [robusta coffee]
gb|EEC75974.1|  hypothetical protein OsI_13084                          228   1e-65   Oryza sativa Indica Group [Indian rice]
dbj|BAA01058.1|  H-ATPase                                               228   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050947.1|  Os03g0689300                                       228   2e-65   
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          227   2e-65   Sorghum bicolor [broomcorn]
ref|XP_006837363.1|  hypothetical protein AMTR_s00111p00107570          228   2e-65   
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     226   3e-65   Tarenaya hassleriana [spider flower]
tpg|DAA50741.1|  TPA: hypothetical protein ZEAMMB73_722190              227   6e-65   
gb|ABR26203.1|  plasma membrane atpase 1                                212   2e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_011031934.1|  PREDICTED: plasma membrane ATPase 1                224   2e-64   Populus euphratica
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           223   4e-64   
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           223   7e-64   Pyrus x bretschneideri [bai li]
gb|EPS65442.1|  hypothetical protein M569_09334                         222   1e-63   Genlisea aurea
dbj|BAM20990.1|  plasma membrane H+-ATPase                              221   2e-63   Marchantia polymorpha
gb|EPS73574.1|  hypothetical protein M569_01174                         219   5e-63   Genlisea aurea
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          220   5e-63   Vitis vinifera
ref|XP_006375124.1|  H+-ATPase family protein                           220   6e-63   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                220   7e-63   Erythranthe guttata [common monkey flower]
ref|XP_010430916.1|  PREDICTED: ATPase 8, plasma membrane-type-like     209   8e-63   Camelina sativa [gold-of-pleasure]
ref|NP_001105360.1|  membrane H(+)-ATPase1                              219   9e-63   Zea mays [maize]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  219   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA42486.1|  TPA: H(+)-transporting ATPase                          219   1e-62   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              219   1e-62   Marchantia polymorpha
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                219   2e-62   Phoenix dactylifera
ref|XP_001782121.1|  predicted protein                                  212   2e-62   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                218   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_010496530.1|  PREDICTED: ATPase 8, plasma membrane-type-like     210   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010529048.1|  PREDICTED: ATPase 7, plasma membrane-type          218   3e-62   Tarenaya hassleriana [spider flower]
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  218   3e-62   Elaeis guineensis
emb|CAN64375.1|  hypothetical protein VITISV_014422                     218   3e-62   Vitis vinifera
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                218   3e-62   Vitis vinifera
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                218   4e-62   Erythranthe guttata [common monkey flower]
ref|XP_010545150.1|  PREDICTED: ATPase 7, plasma membrane-type          219   4e-62   Tarenaya hassleriana [spider flower]
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     218   4e-62   Nicotiana tomentosiformis
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             218   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006440236.1|  hypothetical protein CICLE_v10018727mg             218   4e-62   
ref|XP_006477127.1|  PREDICTED: ATPase 11, plasma membrane-type-like    218   5e-62   Citrus sinensis [apfelsine]
gb|KDO61318.1|  hypothetical protein CISIN_1g002151mg                   218   5e-62   Citrus sinensis [apfelsine]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           218   5e-62   Elaeis guineensis
emb|CBI16656.3|  unnamed protein product                                218   6e-62   Vitis vinifera
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    218   6e-62   Phoenix dactylifera
ref|XP_003633895.1|  PREDICTED: plasma membrane ATPase 1                218   6e-62   Vitis vinifera
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    218   6e-62   Phoenix dactylifera
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             217   7e-62   Elaeis guineensis
ref|XP_007134481.1|  hypothetical protein PHAVU_010G050900g             217   7e-62   Phaseolus vulgaris [French bean]
ref|XP_007023381.1|  H(+)-ATPase 9                                      217   9e-62   
emb|CDY67606.1|  BnaAnng24780D                                          211   1e-61   Brassica napus [oilseed rape]
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           216   1e-61   
emb|CDY69631.1|  BnaCnng64550D                                          211   1e-61   Brassica napus [oilseed rape]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    216   1e-61   Populus euphratica
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       216   1e-61   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     216   1e-61   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       216   1e-61   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           216   2e-61   Cucumis melo [Oriental melon]
gb|AAV49159.1|  plasma membrane proton ATPase 5                         216   2e-61   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           216   2e-61   Phoenix dactylifera
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    216   2e-61   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           216   2e-61   
gb|KJB66333.1|  hypothetical protein B456_010G136300                    216   2e-61   Gossypium raimondii
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          215   3e-61   Medicago truncatula
gb|KJB82762.1|  hypothetical protein B456_013G212200                    214   3e-61   Gossypium raimondii
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          215   4e-61   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          215   4e-61   Sorghum bicolor [broomcorn]
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     215   4e-61   Sesamum indicum [beniseed]
ref|XP_002511598.1|  H(\+)-transporting atpase plant/fungi plasma...    215   4e-61   
dbj|BAD19091.1|  putative H+-exporting ATPase                           215   4e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007204519.1|  hypothetical protein PRUPE_ppa018171mg             215   4e-61   Prunus persica
gb|KJB82864.1|  hypothetical protein B456_013G217900                    214   5e-61   Gossypium raimondii
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          214   5e-61   
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           214   5e-61   Elaeis guineensis
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             214   5e-61   Elaeis guineensis
gb|AAK31799.2|  plasma membrane H+ ATPase                               214   6e-61   Lilium longiflorum [Easter lily]
gb|KJB82763.1|  hypothetical protein B456_013G212200                    214   6e-61   Gossypium raimondii
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     214   6e-61   Nicotiana sylvestris
ref|XP_010094202.1|  Plasma membrane ATPase 4                           214   6e-61   Morus notabilis
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          214   6e-61   Sesamum indicum [beniseed]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          214   7e-61   Amborella trichopoda
ref|XP_009348377.1|  PREDICTED: plasma membrane ATPase 1-like           214   7e-61   Pyrus x bretschneideri [bai li]
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             214   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     214   7e-61   Tarenaya hassleriana [spider flower]
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     214   8e-61   Sesamum indicum [beniseed]
emb|CAD29312.1|  plasma membrane H+-ATPase                              214   8e-61   Oryza sativa Japonica Group [Japonica rice]
gb|AEQ27822.1|  PM H+-ATPase R                                          214   8e-61   Eichhornia crassipes
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          214   9e-61   Cucumis melo [Oriental melon]
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  214   1e-60   
gb|ACL54575.1|  unknown                                                 214   1e-60   Zea mays [maize]
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             214   1e-60   Phoenix dactylifera
ref|NP_001048395.2|  Os02g0797300                                       214   1e-60   
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     214   1e-60   Sesamum indicum [beniseed]
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           214   1e-60   
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     213   1e-60   Eucalyptus grandis [rose gum]
ref|XP_002307856.1|  ATPase 6 family protein                            213   1e-60   Populus trichocarpa [western balsam poplar]
dbj|BAL41366.1|  plasma membrane H+-ATPase                              213   1e-60   Aeluropus littoralis
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           213   2e-60   Sesamum indicum [beniseed]
gb|EMT26270.1|  Plasma membrane ATPase                                  213   2e-60   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    213   2e-60   Triticum aestivum [Canadian hard winter wheat]
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   211   2e-60   Citrus sinensis [apfelsine]
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                213   2e-60   Erythranthe guttata [common monkey flower]
gb|AEO22063.1|  plasma membrane H+-ATPase                               213   2e-60   Aeluropus littoralis
gb|EMS60594.1|  Plasma membrane ATPase                                  213   2e-60   Triticum urartu
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   2e-60   Populus euphratica
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                213   2e-60   Eucalyptus grandis [rose gum]
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           213   2e-60   Cicer arietinum [garbanzo]
gb|KJB70727.1|  hypothetical protein B456_011G089100                    213   2e-60   Gossypium raimondii
gb|AFM52333.1|  plasma membrane H+-ATPase                               213   2e-60   Malus baccata var. xiaojinensis
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             213   2e-60   Capsella rubella
ref|XP_002324564.1|  ATPase 6 family protein                            213   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  213   3e-60   Phoenix dactylifera
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             213   3e-60   Setaria italica
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          213   3e-60   Nicotiana tomentosiformis
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    213   3e-60   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                213   3e-60   Eucalyptus grandis [rose gum]
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                213   3e-60   Cucumis melo [Oriental melon]
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                213   3e-60   Vitis vinifera
gb|EAZ06139.1|  hypothetical protein OsI_28373                          213   3e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_008378468.1|  PREDICTED: plasma membrane ATPase 1-like           213   3e-60   
emb|CAB85494.1|  H+-ATPase                                              213   3e-60   Medicago truncatula
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                213   3e-60   Elaeis guineensis
gb|AAV71150.1|  plasma membrane H+-ATPase                               213   3e-60   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           213   3e-60   Cicer arietinum [garbanzo]
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                213   4e-60   Erythranthe guttata [common monkey flower]
gb|KEH17835.1|  plasma membrane H+-ATPase                               213   4e-60   Medicago truncatula
emb|CAB85495.1|  H+-ATPase                                              213   4e-60   Medicago truncatula
dbj|BAD16684.1|  plasma membrane H+-ATPase                              212   4e-60   Daucus carota [carrots]
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     212   4e-60   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     212   4e-60   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      212   4e-60   
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             212   4e-60   
gb|AAB84202.2|  plasma membrane proton ATPase                           212   4e-60   
dbj|BAD16685.1|  plasma membrane H+-ATPase                              212   4e-60   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          212   4e-60   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           212   4e-60   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             212   4e-60   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           212   4e-60   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          212   4e-60   
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    212   5e-60   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     212   5e-60   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          212   5e-60   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         212   5e-60   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                212   5e-60   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     211   5e-60   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   212   6e-60   
gb|EMS59303.1|  Plasma membrane ATPase                                  213   6e-60   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              212   6e-60   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          211   6e-60   
gb|AAB17186.1|  plasma membrane H+-ATPase                               212   6e-60   
gb|EMT31912.1|  Plasma membrane ATPase 1                                212   6e-60   
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    212   6e-60   
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                212   6e-60   
ref|XP_007039741.1|  H(\\+)-transporting atpase plant/fungi plasm...    211   7e-60   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    210   7e-60   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     211   7e-60   
ref|NP_001054118.1|  Os04g0656100                                       211   7e-60   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             211   7e-60   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                211   7e-60   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             211   7e-60   
gb|ABA18112.1|  putative plasma membrane ATPase                         211   7e-60   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     211   8e-60   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                211   8e-60   
ref|XP_007039740.1|  H(+)-ATPase 11 isoform 1                           211   8e-60   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    211   8e-60   
gb|AFW04239.1|  plasma membrane H+-ATPase                               211   8e-60   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     211   8e-60   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    211   8e-60   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        211   8e-60   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    211   8e-60   
ref|XP_002309321.1|  ATPase 6 family protein                            211   8e-60   
ref|XP_007012006.1|  H(+)-ATPase 8                                      211   9e-60   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     211   9e-60   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     211   9e-60   
gb|AAY42948.1|  plasma membrane H+ ATPase                               211   1e-59   
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   211   1e-59   
gb|ABA18090.1|  putative plasma membrane ATPase                         211   1e-59   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             211   1e-59   
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                211   1e-59   
emb|CDY67153.1|  BnaAnng23670D                                          211   1e-59   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           211   1e-59   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             211   1e-59   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             211   1e-59   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     211   1e-59   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             211   1e-59   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                211   1e-59   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                211   1e-59   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     211   1e-59   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    211   1e-59   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     211   1e-59   
ref|XP_002324397.1|  H+-ATPase family protein                           211   1e-59   
dbj|BAM20991.1|  plasma membrane H+-ATPase                              211   1e-59   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          211   1e-59   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    211   1e-59   
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             211   1e-59   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             211   1e-59   
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         211   1e-59   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          211   1e-59   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          211   1e-59   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         211   1e-59   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          211   1e-59   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    210   1e-59   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    211   1e-59   
emb|CAB69823.1|  plasma membrane H+ ATPase                              211   2e-59   
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     210   2e-59   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    211   2e-59   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             211   2e-59   
gb|AAY42950.1|  plasma membrane H+ ATPase                               211   2e-59   
emb|CDX72217.1|  BnaC07g42390D                                          210   2e-59   
gb|ABR18001.1|  unknown                                                 211   2e-59   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    211   2e-59   
ref|XP_008352252.1|  PREDICTED: plasma membrane ATPase 1-like           202   2e-59   
emb|CDY51650.1|  BnaAnng10900D                                          210   2e-59   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     211   2e-59   
dbj|BAA37150.1|  p-type H+-ATPase                                       210   2e-59   
ref|XP_008363797.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    209   2e-59   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                210   2e-59   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             210   2e-59   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   210   2e-59   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           210   2e-59   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             210   2e-59   
ref|XP_006480483.1|  PREDICTED: ATPase 4, plasma membrane-type-li...    210   2e-59   
ref|XP_003529039.1|  PREDICTED: plasma membrane ATPase 1-like iso...    210   2e-59   
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   210   2e-59   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     210   2e-59   
emb|CDX72218.1|  BnaC07g42400D                                          210   2e-59   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          210   2e-59   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    210   2e-59   
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          210   2e-59   
ref|XP_006480487.1|  PREDICTED: ATPase 4, plasma membrane-type-li...    210   2e-59   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           210   2e-59   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     210   2e-59   
ref|XP_008238415.1|  PREDICTED: ATPase 11, plasma membrane-type-like    210   2e-59   
emb|CDX82608.1|  BnaC07g02580D                                          210   2e-59   
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             210   2e-59   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    210   2e-59   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   210   3e-59   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             210   3e-59   
gb|ACE77057.1|  plasma membrane proton pump                             210   3e-59   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          210   3e-59   
ref|XP_007210973.1|  hypothetical protein PRUPE_ppa021822mg             210   3e-59   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     210   3e-59   
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          210   3e-59   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     210   3e-59   
gb|EPS57651.1|  hypothetical protein M569_17165                         210   3e-59   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     210   3e-59   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     210   3e-59   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     210   3e-59   
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             210   3e-59   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             210   3e-59   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             210   3e-59   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              210   3e-59   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           210   3e-59   
dbj|BAJ33915.1|  unnamed protein product                                210   3e-59   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          210   3e-59   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  210   3e-59   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     210   3e-59   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          210   3e-59   
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    210   3e-59   
emb|CDY64741.1|  BnaCnng44750D                                          209   3e-59   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             210   3e-59   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             209   3e-59   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     210   3e-59   
gb|KEH39623.1|  plasma membrane H+-ATPase                               209   3e-59   
ref|XP_011089588.1|  PREDICTED: plasma membrane ATPase 1                210   3e-59   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    209   3e-59   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    209   3e-59   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     210   4e-59   
ref|XP_002304716.2|  H+-ATPase family protein                           210   4e-59   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    209   4e-59   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          209   4e-59   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     209   4e-59   
gb|KHN17608.1|  Plasma membrane ATPase 4                                209   4e-59   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     209   4e-59   
ref|XP_010512349.1|  PREDICTED: ATPase 7, plasma membrane-type-like     209   4e-59   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           209   4e-59   
gb|KJB55190.1|  hypothetical protein B456_009G068100                    209   4e-59   
gb|KJB55189.1|  hypothetical protein B456_009G068100                    209   4e-59   
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    209   4e-59   
ref|XP_006402592.1|  hypothetical protein EUTSA_v10005774mg             209   4e-59   
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    209   4e-59   
ref|XP_010413571.1|  PREDICTED: ATPase 7, plasma membrane-type          209   4e-59   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                209   4e-59   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    209   4e-59   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             209   5e-59   
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    209   5e-59   
gb|KEH37844.1|  plasma membrane H+-ATPase                               209   5e-59   
ref|XP_010469197.1|  PREDICTED: ATPase 7, plasma membrane-type-like     209   5e-59   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          209   5e-59   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     209   5e-59   
ref|XP_010313836.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    209   5e-59   
ref|XP_006290558.1|  hypothetical protein CARUB_v10016644mg             209   5e-59   
ref|XP_010111939.1|  Plasma membrane ATPase 4                           209   5e-59   
ref|XP_009333704.1|  PREDICTED: ATPase 11, plasma membrane-type-like    209   5e-59   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    209   6e-59   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     209   6e-59   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     209   6e-59   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    209   6e-59   
gb|AHK23067.1|  plasma membrane ATPase 4                                209   6e-59   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  209   6e-59   
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    209   6e-59   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 209   6e-59   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          209   6e-59   
emb|CBW30173.1|  Plasma membrane ATPase 4                               209   7e-59   
gb|KJB65971.1|  hypothetical protein B456_010G123000                    209   7e-59   
emb|CBW30211.1|  Plasma membrane ATPase                                 209   7e-59   
dbj|BAJ34124.1|  unnamed protein product                                209   7e-59   
ref|NP_194748.1|  H(+)-ATPase 2                                         209   7e-59   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       209   7e-59   
ref|XP_009799962.1|  PREDICTED: plasma membrane ATPase 1-like           209   7e-59   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     209   7e-59   
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    208   8e-59   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       209   8e-59   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             209   8e-59   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 208   8e-59   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          209   8e-59   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          209   8e-59   
gb|KHN22686.1|  Plasma membrane ATPase 4                                209   8e-59   
gb|AAD46187.1|  plasma membrane proton ATPase                           209   8e-59   
ref|NP_001190870.1|  H(+)-ATPase 2                                      209   8e-59   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     209   8e-59   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          210   9e-59   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             208   9e-59   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       207   9e-59   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           208   1e-58   
ref|NP_200545.1|  H(+)-ATPase 3                                         208   1e-58   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      208   1e-58   
ref|XP_006382164.1|  H+-ATPase family protein                           208   1e-58   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     208   1e-58   
ref|XP_010053511.1|  PREDICTED: ATPase 11, plasma membrane-type-like    208   1e-58   
gb|KHN44553.1|  Plasma membrane ATPase 1                                208   1e-58   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          208   1e-58   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     208   1e-58   
dbj|BAK05828.1|  predicted protein                                      208   1e-58   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             208   1e-58   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          208   1e-58   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    208   1e-58   
gb|KHN34527.1|  Plasma membrane ATPase 1                                208   1e-58   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    208   1e-58   
ref|XP_004245804.1|  PREDICTED: plasma membrane ATPase 1-like           208   1e-58   
ref|XP_006428677.1|  hypothetical protein CICLE_v10011010mg             208   1e-58   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           208   1e-58   
gb|ABW25091.1|  plasma membrane proton pump                             208   1e-58   
ref|XP_003521073.2|  PREDICTED: plasma membrane ATPase 1-like iso...    208   1e-58   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           208   1e-58   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    208   1e-58   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             208   2e-58   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 208   2e-58   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    207   2e-58   



>gb|AAA34099.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia]
Length=388

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTAAAQERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEE+ASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|EYU35893.1| hypothetical protein MIMGU_mgv1a0008591mg, partial [Erythranthe 
guttata]
Length=689

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EKPEVLDAVLKETVDLENIPI+EVFENLRCT++GLTS+AA+ERL IFGHNKLEEK+ESKF
Sbjct  4    EKPEVLDAVLKETVDLENIPIDEVFENLRCTREGLTSEAAEERLAIFGHNKLEEKRESKF  63

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAK+LRDGRW+EEDA++LVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQ
Sbjct  124  NAAAALMARLAPKAKILRDGRWNEEDAAMLVPGDIISIKLGDIIPADSRLLDGDPLKIDQ  183

Query  609  SALT  620
            SALT
Sbjct  184  SALT  187



>ref|XP_006838797.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
 gb|ERN01366.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
Length=956

 Score =   256 bits (655),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 175/186 (94%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK EVL+AVLKE VDLENIPIEEVFENLRCTK+GLTS AAQERL IFGHNKLEEKKES
Sbjct  1    MGEKAEVLEAVLKEAVDLENIPIEEVFENLRCTKEGLTSDAAQERLGIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEEDAS+LVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEDASVLVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersicum]
 sp|P22180.1|PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Solanum lycopersicum]
 gb|AAA34173.1| H+-ATPase [Solanum lycopersicum]
 prf||1803518A H ATPase
Length=956

 Score =   256 bits (655),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTATAAQERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWDEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>emb|CDP14881.1| unnamed protein product [Coffea canephora]
Length=950

 Score =   256 bits (654),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+KPEVL+AV+KETVDLENIPIEEVFENLRCTK+GLTS+ AQERL IFG+NKLEEKKES
Sbjct  1    MADKPEVLEAVVKETVDLENIPIEEVFENLRCTKEGLTSEGAQERLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LK+LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KLLKYLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEEDA++LVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEDAAVLVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008437674.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis melo]
Length=956

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEAAEERLKIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSE+DASILVPGD+ISVKLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEQDASILVPGDVISVKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009343433.1| PREDICTED: ATPase 11, plasma membrane-type-like [Pyrus x bretschneideri]
Length=956

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIMTLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; AltName: Full=Proton 
pump 3 [Nicotiana plumbaginifolia]
 gb|AAA34098.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KF KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFSKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTTAAQERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWDEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009626987.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana tomentosiformis]
Length=956

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008239652.1| PREDICTED: ATPase 11, plasma membrane-type [Prunus mume]
Length=956

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E++A++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQEAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008374513.1| PREDICTED: ATPase 11, plasma membrane-type [Malus domestica]
Length=956

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009369365.1| PREDICTED: ATPase 11, plasma membrane-type [Pyrus x bretschneideri]
Length=956

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010256132.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Nelumbo 
nucifera]
Length=956

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K E+L+AVLKE VDLENIPIEEVFENLRC+KDGLT++AAQERL IFGHNKLEEKKES
Sbjct  1    MGDKAEILEAVLKEAVDLENIPIEEVFENLRCSKDGLTTEAAQERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEEDASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010256122.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Nelumbo 
nucifera]
Length=970

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K E+L+AVLKE VDLENIPIEEVFENLRC+KDGLT++AAQERL IFGHNKLEEKKES
Sbjct  1    MGDKAEILEAVLKEAVDLENIPIEEVFENLRCSKDGLTTEAAQERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEEDASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum]
 gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum]
 gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum]
Length=956

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWNEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_004152442.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004157811.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+ A+ERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEGAEERLKIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSE+DASILVPGD+ISVKLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEQDASILVPGDVISVKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_002270344.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Vitis vinifera]
 ref|XP_010663416.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Vitis vinifera]
 emb|CBI15286.3| unnamed protein product [Vitis vinifera]
Length=956

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+KPEVL+AVLKETVDLENIPIEEVFENLRC+++GLTS+AAQERL IFG+N+LEEKKES
Sbjct  1    MADKPEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAQERLAIFGYNRLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_007210395.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
 emb|CAB69824.1| plasma membrane H+ ATPase [Prunus persica]
 gb|EMJ11594.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
Length=956

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E++A +LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQEAGVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009799220.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana sylvestris]
Length=956

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIP+EEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPVEEVFENLRCTKEGLTAAAAQERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWMEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWNEEDAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_002322127.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF06254.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=967

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK EVL+AVLKETVDLENIPIEEVFENLRC+++GLTSQAA+ERL IFGHNKLEEKKE 
Sbjct  1    MGEKAEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLSIFGHNKLEEKKER  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSE+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KDO76029.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=673

 Score =   249 bits (637),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KDO76027.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
 gb|KDO76028.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=672

 Score =   249 bits (637),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=957

 Score =   253 bits (647),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 183/184 (99%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GLTS+AA+ERL IFGHNKLEEK+ESKF
Sbjct  4    EKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLTSEAAEERLTIFGHNKLEEKQESKF  63

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            +KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64   IKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  124  NAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  183

Query  609  SALT  620
            SALT
Sbjct  184  SALT  187



>gb|KCW49372.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=920

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1    MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ LVPGDI+SVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAADLVPGDIVSVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009793289.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana sylvestris]
Length=956

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGPAAQERLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWDEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KCW49373.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=925

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1    MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ LVPGDI+SVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAADLVPGDIVSVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010037634.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW49371.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=956

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1    MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ LVPGDI+SVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAADLVPGDIVSVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_011028703.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
 ref|XP_011028704.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
Length=956

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK EVL+AVLKETVDLENIPIEEVFENLRC+++GLTSQAA+ERL IFGHNKLEEKKE 
Sbjct  1    MGEKAEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLAIFGHNKLEEKKER  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W+E+DAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWNEQDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum]
 emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=956

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDI+PAD RLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWNEEDAAVLVPGDIISIKLGDIVPADRRLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GL+  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLSGPAAQERLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWDEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>sp|Q08435.1|PMA1_NICPL RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Nicotiana plumbaginifolia]
 gb|AAA34094.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=957

 Score =   251 bits (642),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKK+SK 
Sbjct  4    EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTATAAQERLAIFGYNKLEEKKDSKL  63

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENNAG  123

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLRDGRW EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  124  NAAAALMARLAPKAKVLRDGRWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQ  183

Query  609  SALT  620
            SALT
Sbjct  184  SALT  187



>ref|XP_002511508.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF52110.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=801

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGEKGEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAK+LRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKILRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010678593.1| PREDICTED: plasma membrane ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=963

 Score =   251 bits (641),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK EVL+AVLKE VDLENIP+EEVFENLRC+K+GLTS AAQERL IFG NKLEEKKES
Sbjct  1    MAEKSEVLEAVLKEAVDLENIPLEEVFENLRCSKEGLTSDAAQERLAIFGPNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPKAK+LRDGRWSEEDA++LVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMASLAPKAKILRDGRWSEEDAAVLVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009610426.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana tomentosiformis]
Length=956

 Score =   251 bits (641),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GL+  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLSGPAAQERLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWDEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010550649.1| PREDICTED: ATPase 11, plasma membrane-type [Tarenaya hassleriana]
Length=956

 Score =   251 bits (640),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKE VDLEN+PIEEVFENLRC+KDGLT+QAA ERL +FGHNKLEEKKES
Sbjct  1    MGDKTEVLEAVLKEAVDLENVPIEEVFENLRCSKDGLTTQAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|AFC88896.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=956

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVL+AVLKE VDLENIPIEEVFENLRC+K+GLT+Q+A+ERL IFG NKLEEKKES
Sbjct  1    MGEKPEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTTQSAEERLAIFGQNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009607762.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana tomentosiformis]
Length=957

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKESKF
Sbjct  4    EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTVTAAQERLAIFGYNKLEEKKESKF  63

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENNAG  123

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLRDGRW EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  124  NAAAALMARLAPKAKVLRDGRWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQ  183

Query  609  SALT  620
            SALT
Sbjct  184  SALT  187



>gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia]
Length=956

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEKPEVLDAVLKE VDLENIPIEEVFENLRC+K+GLT+ AA+ERL IFGHNKLEEKK+S
Sbjct  1    MAEKPEVLDAVLKEVVDLENIPIEEVFENLRCSKEGLTTVAAEERLAIFGHNKLEEKKDS  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIVLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+WSE DA++LVPGDI+S+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWSEYDAAVLVPGDIVSIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +KPEVL+AVLKETVDLE+IPIEEVFENLRC+KDGLTS  A ERL IFGHNKLEE KE 
Sbjct  1    MEDKPEVLEAVLKETVDLESIPIEEVFENLRCSKDGLTSSGAAERLTIFGHNKLEEVKER  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W+EEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWNEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KJB19307.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=879

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=956

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPEVL+AVLKETVDLENIPIEEVFENLRC+++GLTS+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAEERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009798932.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana sylvestris]
Length=957

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 171/184 (93%), Positives = 179/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT  AA+ERL IFG+NKLEEKK+SKF
Sbjct  4    EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTVTAAEERLAIFGYNKLEEKKDSKF  63

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLRDGRW EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  124  NAAAALMARLAPKAKVLRDGRWKEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQ  183

Query  609  SALT  620
            SALT
Sbjct  184  SALT  187



>ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=954

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KJB19302.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KJB19303.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
 gb|KJB19304.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=925

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
 gb|ESR52905.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
Length=954

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKGKVLRDGRWNEQDASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KJB19306.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=987

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KJB19305.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KDP31195.1| hypothetical protein JCGZ_11571 [Jatropha curcas]
Length=956

 Score =   248 bits (633),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKE VDLENIPIEEVFENLRC+K+GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGDKSEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTTEAAEERLAIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEQDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_007037195.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
 gb|EOY21696.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
Length=1607

 Score =   251 bits (641),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVLDAVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLDAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLVIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLK+LGFMWNPLSWVME+AAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKYLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSE+DA+ILVPGD+IS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEQDAAILVPGDVISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_002318614.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEE96834.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=966

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEV ENLRC+++GLT+QAA+ERL IFGHNKLEEKKE 
Sbjct  1    MGDKGEVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKER  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_011042618.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
 ref|XP_011042619.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
Length=956

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLENIPIEEV ENLRC+++GLT+QAA+ERL IFGHNKLEEKKE 
Sbjct  1    MGDKGEVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKER  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W+E+DAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWNEQDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_002282263.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 ref|XP_010661009.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 emb|CBI35033.3| unnamed protein product [Vitis vinifera]
Length=955

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+KPEVL+AVLKE VDLENIPIEEVF+NLRC  +GL+++AA ERL IFGHNKLEEK+ES
Sbjct  1    MADKPEVLEAVLKEAVDLENIPIEEVFQNLRCNANGLSTEAANERLAIFGHNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+WSEEDA+ILVPGDIIS+KLGDI+PADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWSEEDAAILVPGDIISIKLGDILPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_004171391.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 4, plasma membrane-type-like 
[Cucumis sativus]
Length=959

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK 
Sbjct  6    EKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESKV  65

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNAG
Sbjct  66   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEENNAG  125

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMA LAP+AK+LRDGRWS +DAS+LVPGDIIS+KLGDIIPADARLLDGDPLKIDQ
Sbjct  126  NAAAALMASLAPQAKILRDGRWSVQDASVLVPGDIISIKLGDIIPADARLLDGDPLKIDQ  185

Query  609  SALT  620
            SALT
Sbjct  186  SALT  189



>ref|XP_004138147.1| PREDICTED: ATPase 4, plasma membrane-type-like [Cucumis sativus]
Length=959

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +3

Query  66   AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  245
             EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK
Sbjct  5    GEKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESK  64

Query  246  flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnna  425
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNA
Sbjct  65   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEENNA  124

Query  426  gnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKID  605
            GNAAAALMA LAP+AK+LRDGRWS +DAS+LVPGDIIS+KLGDIIPADARLLDGDPLKID
Sbjct  125  GNAAAALMASLAPQAKILRDGRWSVQDASVLVPGDIISIKLGDIIPADARLLDGDPLKID  184

Query  606  QSALT  620
            QSALT
Sbjct  185  QSALT  189



>ref|XP_007138219.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
 gb|ESW10213.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
Length=956

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K +VL+AVLKETVDLENIP+EEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKE 
Sbjct  1    MGDKSQVLEAVLKETVDLENIPVEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKER  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSE+DA++LVPGDI+S+KLGDIIPAD+RLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEQDAAVLVPGDIVSIKLGDIIPADSRLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010112580.1| ATPase 11, plasma membrane-type [Morus notabilis]
 gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis]
Length=950

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EKPE L+AVLKETVDLENIPIEEVFENLRC+K+GLT++AA++RL IFG+NKLEEKKES
Sbjct  1    MGEKPEALEAVLKETVDLENIPIEEVFENLRCSKEGLTTEAAEQRLTIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSE+DA++LVPGDIIS+KLGDI+ ADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEQDAAVLVPGDIISIKLGDIVAADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KEH31901.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   246 bits (627),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EKPE L+AVLKETVDLENIPIEEVFENLRC+++GLTS+AA++RL IFGHNKLEEK+ESKF
Sbjct  5    EKPETLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAEQRLTIFGHNKLEEKRESKF  64

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125  NAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  609  SALT  620
            SALT
Sbjct  185  SALT  188



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   245 bits (626),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLE+IPIEEVFENLRC+KDGLTS  A ERL IFGHNKLEEKKES
Sbjct  1    MEDKSEVLEAVLKETVDLESIPIEEVFENLRCSKDGLTSSGALERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWNEEDAAVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_003527056.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=956

 Score =   245 bits (626),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DAS+LVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDASVLVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KHN19372.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   245 bits (626),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DAS+LVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDASVLVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_003523043.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN08862.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DAS+LVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDASVLVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008453171.1| PREDICTED: plasma membrane ATPase 3 [Cucumis melo]
Length=959

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = +3

Query  66   AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  245
             EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK
Sbjct  5    GEKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESK  64

Query  246  flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnna  425
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNA
Sbjct  65   ILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEENNA  124

Query  426  gnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKID  605
            GNAAAALMA LAP+AK+LRDGRWS +DAS+LVPGDIIS+KLGDIIPADARLL+GDPLKID
Sbjct  125  GNAAAALMASLAPQAKILRDGRWSVQDASVLVPGDIISIKLGDIIPADARLLEGDPLKID  184

Query  606  QSALT  620
            QSALT
Sbjct  185  QSALT  189



>ref|XP_010272214.1| PREDICTED: ATPase 11, plasma membrane-type-like [Nelumbo nucifera]
Length=955

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K  +L+AVLKE VDLENIPIEEVFENLRC K+GLT++AAQERL IFGHNKLEEK+ES
Sbjct  1    MGDKATILEAVLKEAVDLENIPIEEVFENLRCNKEGLTTEAAQERLVIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPK KVLRDG+WSEE+ASILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKGKVLRDGKWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_006279959.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
 gb|EOA12857.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
Length=956

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_010459221.1| PREDICTED: ATPase 11, plasma membrane-type-like [Camelina sativa]
Length=956

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLTS+AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTSEAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_008807875.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807876.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807878.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807879.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
Length=956

 Score =   243 bits (621),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   LDAVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEK+ES
Sbjct  1    MGDKAATLDAVLKEAVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEE+++ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEESAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_007155352.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27346.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=810

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K +VL+AVLKETVDLENIPIEEV ENLRC+++GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGDKSQVLEAVLKETVDLENIPIEEVLENLRCSREGLSSEAAEERLTIFGHNKLEEKRES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_002864812.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41071.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
Length=956

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+A+LKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAILKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDI+S+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIVSIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|NP_201073.1| H(+)-ATPase 11 [Arabidopsis thaliana]
 sp|Q9LV11.1|PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type; AltName: Full=Proton 
pump 11 [Arabidopsis thaliana]
 dbj|BAA97214.1| plasma membrane proton ATPase-like [Arabidopsis thaliana]
 gb|AAM78085.1| AT5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AAR23718.1| At5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AED97641.1| H(+)-ATPase 11 [Arabidopsis thaliana]
Length=956

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>gb|EPS66977.1| hypothetical protein M569_07799, partial [Genlisea aurea]
Length=922

 Score =   242 bits (618),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = +3

Query  72   KPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskfl  251
            KPEVLDAVLKETVDLENIPI+EV ENLRC+++GL+S++AQERL IFGHNKLEEKKESKFL
Sbjct  1    KPEVLDAVLKETVDLENIPIDEVLENLRCSREGLSSESAQERLAIFGHNKLEEKKESKFL  60

Query  252  kflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagn  431
            KFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAGN
Sbjct  61   KFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLMINSTISFIEENNAGN  120

Query  432  aaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQS  611
            AAAALMARLAPKAKVLRDG+WSEE+ASILVPGDIIS+KLGDIIPAD+RLL+GDPLKIDQS
Sbjct  121  AAAALMARLAPKAKVLRDGKWSEEEASILVPGDIISIKLGDIIPADSRLLEGDPLKIDQS  180

Query  612  ALT  620
            ALT
Sbjct  181  ALT  183



>emb|CAB41144.1| H+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=960

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  78   EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  257
            EVL+AVLKE VDLEN+PIEEVFENLRC+K+GLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  10   EVLEAVLKEAVDLENVPIEEVFENLRCSKEGLTTQAADERLALFGHNKLEEKKESKFLKF  69

Query  258  lgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaa  437
            LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA
Sbjct  70   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA  129

Query  438  aalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSAL  617
            AALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSAL
Sbjct  130  AALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  189

Query  618  T  620
            T
Sbjct  190  T  190



>ref|XP_006394361.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
 dbj|BAJ34039.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31647.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
Length=956

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|NP_190378.2| H(+)-ATPase 4 [Arabidopsis thaliana]
 sp|Q9SU58.2|PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type; AltName: Full=Proton 
pump 4 [Arabidopsis thaliana]
 dbj|BAC42716.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE78350.1| H(+)-ATPase 4 [Arabidopsis thaliana]
Length=960

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +3

Query  78   EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  257
            EVL+AVLKE VDLEN+PIEEVFENLRC+K+GLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  10   EVLEAVLKEAVDLENVPIEEVFENLRCSKEGLTTQAADERLALFGHNKLEEKKESKFLKF  69

Query  258  lgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaa  437
            LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA
Sbjct  70   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA  129

Query  438  aalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSAL  617
            AALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSAL
Sbjct  130  AALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  189

Query  618  T  620
            T
Sbjct  190  T  190



>ref|XP_010923303.1| PREDICTED: plasma membrane ATPase 3-like [Elaeis guineensis]
Length=956

 Score =   242 bits (618),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   L+AVLKE VDLENIP+EEVFENLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1    MGDKAATLEAVLKEAVDLENIPLEEVFENLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009130230.1| PREDICTED: ATPase 11, plasma membrane-type isoform X3 [Brassica 
rapa]
Length=939

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_009130228.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Brassica 
rapa]
Length=979

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_007155353.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27347.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=955

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K +VL+AVLKETVDLENIPIEEV ENLRC+++GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGDKSQVLEAVLKETVDLENIPIEEVLENLRCSREGLSSEAAEERLTIFGHNKLEEKRES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009130229.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Brassica 
rapa]
Length=956

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_006664787.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=956

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|NP_001067382.1| Os12g0638700 [Oryza sativa Japonica Group]
 emb|CAD29296.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|ABA99607.1| Plasma membrane ATPase 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30401.1| Os12g0638700 [Oryza sativa Japonica Group]
Length=956

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>emb|CAC29435.1| P-type H+-ATPase [Vicia faba]
Length=958

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            +KPE L AVLKETVDLENIPI+EVFENLRC+++GLTS+AA++RL IFGHNKLEEK+ESK 
Sbjct  5    QKPETLQAVLKETVDLENIPIDEVFENLRCSREGLTSEAAEQRLTIFGHNKLEEKRESKL  64

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAA IMAIALANGG K PDWQDFVGIITLL+INSTISFI++NNAG
Sbjct  65   LKFLGFMWNPLSWVMEAARIMAIALANGGNKAPDWQDFVGIITLLIINSTISFIDQNNAG  124

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMA LAPKAKVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125  NAAAALMASLAPKAKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  609  SALT  620
            SALT
Sbjct  185  SALT  188



>ref|XP_010444120.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=959

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PI+EVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIDEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_010444121.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=956

 Score =   241 bits (614),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+PI+EVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIDEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X3 [Cicer 
arietinum]
Length=958

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5    DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125  NAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  609  SALT  620
            SALT
Sbjct  185  SALT  188



>tpg|DAA54787.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=812

 Score =   239 bits (609),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL+++ AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTEQAQQRLEIFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EEDA+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEDAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_003525017.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN48653.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K +VL+AVLKETVDLENIPIEEV ENLRC ++GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKETVDLENIPIEEVLENLRCGREGLSSEAAEERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008796652.1| PREDICTED: plasma membrane ATPase 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008796653.1| PREDICTED: plasma membrane ATPase 3 isoform X2 [Phoenix dactylifera]
Length=956

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   L+AVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1    MGDKAATLEAVLKEAVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW EE+A+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWKEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009398402.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73   FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAKVLRDGRW+EE+A+ILVPGDIIS+KLGDIIPADARLLDGDPLKIDQSALT
Sbjct  133  LMARLAPKAKVLRDGRWNEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALT  191



>ref|XP_002442618.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
 gb|EES16456.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
Length=956

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL++Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTQQAQQRLEIFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EEDA+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEDAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_003549657.1| PREDICTED: ATPase 11, plasma membrane-type-like [Glycine max]
 gb|KHN18516.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   239 bits (611),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K +VL+AVLKETVDLENIPIEEV ENLRC ++GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKETVDLENIPIEEVLENLRCGREGLSSEAAEERLTIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_004963335.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   239 bits (611),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GL++Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLSTQQAQQRLEIFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGD++S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDVVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_004508787.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=979

 Score =   239 bits (611),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5    DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125  NAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  609  SALT  620
            SALT
Sbjct  185  SALT  188



>ref|XP_004508788.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=960

 Score =   239 bits (611),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 181/184 (98%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5    DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLRDGRW+E+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQ
Sbjct  125  NAAAALMARLAPKAKVLRDGRWNEQDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQ  184

Query  609  SALT  620
            SALT
Sbjct  185  SALT  188



>emb|CDY45757.1| BnaC02g42250D [Brassica napus]
Length=962

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AVLKETVDLEN+ IEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVAIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_008673350.1| PREDICTED: uncharacterized protein LOC100502231 isoform X1 [Zea 
mays]
 tpg|DAA54786.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=956

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL+++ AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTEQAQQRLEIFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EEDA+ILVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEDAAILVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_004148685.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004162585.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFGHNKLEEKKES
Sbjct  1    MGDKDEVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPKAKVLRDG+W EE+AS+LVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMAHLAPKAKVLRDGKWVEEEASVLVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_006290560.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
 gb|EOA23458.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
Length=956

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +  EVL+AVLKE VDLEN+PIEEVFE LRC+K+GLT+QAA +RL +FGHNKLEEKKES
Sbjct  1    MEDNNEVLEAVLKEAVDLENVPIEEVFETLRCSKEGLTTQAADDRLALFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+E+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWNEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS LT
Sbjct  181  DQSTLT  186



>gb|KHN13245.1| Plasma membrane ATPase 1 [Glycine soja]
Length=956

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK E + AVLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1    MAEKEEAMHAVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLVIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIM+IALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMSIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAK LRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKFLRDGKWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KJB33644.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=811

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDG+WSEE+ASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVFRDGKWSEEEASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_003561110.1| PREDICTED: plasma membrane ATPase 1-like [Brachypodium distachyon]
Length=956

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+K   LDAVLKE VDLENIP++EVFENLRC ++GLTSQ AQ+RL IFG NKLEEK+ES
Sbjct  1    MADKEGNLDAVLKEVVDLENIPVDEVFENLRCGREGLTSQQAQQRLQIFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEEAAVLVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009398400.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score =   238 bits (606),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73   FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAKVLRDGRW EE+++ILVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQSALT
Sbjct  133  LMARLAPKAKVLRDGRWKEEESAILVPGDIISIKLGDIIPADSRLLDGDPLKIDQSALT  191



>ref|XP_010933786.1| PREDICTED: plasma membrane ATPase 3 [Elaeis guineensis]
Length=956

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   LDAVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1    MGDKATNLDAVLKEVVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW EE+++ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWREEESAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_004982139.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=954

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+K   LDAVLKE VDLENIP+EEVFENLRC+  GLTS+ AQ+RL IFG NKLEEK+ES
Sbjct  1    MADKEGNLDAVLKEAVDLENIPLEEVFENLRCSHGGLTSEQAQQRLQIFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EE+A+ILVPGDI+S+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009398401.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73   FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAKVLRDGRW EE+++ILVPGDIIS+KLGDIIPAD+RLLDGDPLKIDQSALT
Sbjct  133  LMARLAPKAKVLRDGRWKEEESAILVPGDIISIKLGDIIPADSRLLDGDPLKIDQSALT  191



>gb|KJB33642.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=946

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDG+WSEE+ASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVFRDGKWSEEEASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>gb|KJB33641.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=956

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDG+WSEE+ASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVFRDGKWSEEEASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>gb|KEH24965.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+K E + AVL E VDLEN+PIEEVF+ LRC  +GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1    MADKEEAMHAVLTEAVDLENVPIEEVFQTLRCDSNGLTTKAAEERLAIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWVEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KJB33643.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=871

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDG+WSEE+ASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVFRDGKWSEEEASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>gb|KEH24964.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=956

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+K E + AVL E VDLEN+PIEEVF+ LRC  +GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1    MADKEEAMHAVLTEAVDLENVPIEEVFQTLRCDSNGLTTKAAEERLAIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWVEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KDP45466.1| hypothetical protein JCGZ_09715 [Jatropha curcas]
Length=956

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK E L+AVLKE VDLEN+PIEEVF+ LRC  +GLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MVEKAETLEAVLKEVVDLENVPIEEVFQTLRCNSNGLTTEAAEQRLTIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRD RW EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDERWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KHN34200.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK E +  VLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1    MAEKEEAMRVVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAK LRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKFLRDGKWVEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_003554288.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=956

 Score =   235 bits (600),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK E +  VLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1    MAEKEEAMRVVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAK LRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKFLRDGKWVEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_007032427.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY03353.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
Length=994

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M    E LDAVLKE VDLEN+P+EEVF+ LRC KDGLT++AA++RL IFG+NKLEEKKES
Sbjct  1    MENNNETLDAVLKEAVDLENVPLEEVFQTLRCNKDGLTTEAAEQRLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDG+W EEDA+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVFRDGKWIEEDAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008459294.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis melo]
Length=956

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFG NKLEEKKES
Sbjct  1    MGDKDEVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGQNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPKAKVLRDG+W EE+AS+LVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMAHLAPKAKVLRDGKWVEEEASVLVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_011071717.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 3 [Sesamum 
indicum]
Length=952

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 175/186 (94%), Gaps = 4/186 (2%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M E+PEVLDAVLKETVDLENIPIEEVFENLRCT++GLT++AAQERL IFGHNKLEEKKES
Sbjct  1    MGEEPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTEAAQERLAIFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEE+ASILVPGDIISVKLGD         +GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEEASILVPGDIISVKLGD----XXXXXEGDPLKI  176

Query  603  DQSALT  620
            DQSALT
Sbjct  177  DQSALT  182



>ref|XP_006482527.1| PREDICTED: plasma membrane ATPase 1-like [Citrus sinensis]
Length=956

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1    MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPK+KVLRDG+W EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMASLAPKSKVLRDGKWMEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_007032428.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY03354.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
Length=956

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M    E LDAVLKE VDLEN+P+EEVF+ LRC KDGLT++AA++RL IFG+NKLEEKKES
Sbjct  1    MENNNETLDAVLKEAVDLENVPLEEVFQTLRCNKDGLTTEAAEQRLAIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDG+W EEDA+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVFRDGKWIEEDAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010029279.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 ref|XP_010029280.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW56160.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=954

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   L+AVLKE VDLEN+PI EVF+ LRC  +GLTS+AAQERL IFGHNKLEEK+ES
Sbjct  1    MGDKDVTLEAVLKEAVDLENVPIAEVFQTLRCQPNGLTSEAAQERLAIFGHNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIA+ANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIAMANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KCW56159.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=963

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   L+AVLKE VDLEN+PI EVF+ LRC  +GLTS+AAQERL IFGHNKLEEK+ES
Sbjct  1    MGDKDVTLEAVLKEAVDLENVPIAEVFQTLRCQPNGLTSEAAQERLAIFGHNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIA+ANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIAMANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDASILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWIEEDASILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KDO72464.1| hypothetical protein CISIN_1g0021762mg [Citrus sinensis]
Length=875

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1    MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPK+KVLRDG+W EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMASLAPKSKVLRDGKWMEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KDO72462.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
 gb|KDO72463.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
Length=924

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1    MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPK+KVLRDG+W EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMASLAPKSKVLRDGKWMEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_006431062.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
 gb|ESR44302.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
Length=956

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1    MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPK+KVLRDG+W EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMASLAPKSKVLRDGKWMEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008644894.1| PREDICTED: uncharacterized protein LOC100383411 isoform X1 [Zea 
mays]
Length=954

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+    LDAVLKE VDLENIP+EEVFENLRC++ GLTS+ AQ+RL +FG NKLEEK+ES
Sbjct  1    MADNEGTLDAVLKEAVDLENIPLEEVFENLRCSRGGLTSEQAQQRLQLFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGD+IS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWAEEEAAVLVPGDVISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_007151191.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
 gb|ESW23185.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
Length=956

 Score =   234 bits (596),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+K E + AVLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEK+ES
Sbjct  1    MADKEEAMHAVLKEAVDLENVPLEEVFQTLRCDSNGLTTKSAEERLSIFGHNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+W EEDA +LVPGDI+SVKLGDIIPAD+RLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWIEEDACVLVPGDIVSVKLGDIIPADSRLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_003578172.1| PREDICTED: plasma membrane ATPase 1 [Brachypodium distachyon]
Length=959

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+AVLKE+VDLENIP+EEVFENLRC++ GL++Q AQ+RL+IFG NKLEE++ESKFLKFLG
Sbjct  11   LEAVLKESVDLENIPLEEVFENLRCSRQGLSAQQAQQRLEIFGPNKLEEEEESKFLKFLG  70

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  71   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  130

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAK+LRDGRW+EEDA+ILVPGD++S+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  131  LMARLAPKAKILRDGRWTEEDAAILVPGDVVSIKLGDIIPADARLLEGDPLKIDQSALT  189



>ref|XP_006658357.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=957

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1    MAEKADNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRWSEE+A+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_007214948.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
 gb|EMJ16147.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
Length=956

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K E LDAVLKE VDLEN+P+EEVF  LRC + GLTS+AA++RL IFG+NKLEEKKES
Sbjct  1    MDGKSETLDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPKAKV R GRW EEDASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMAHLAPKAKVFRGGRWIEEDASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|NP_001059093.1| Os07g0191200 [Oryza sativa Japonica Group]
 emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAC83861.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAF21007.1| Os07g0191200 [Oryza sativa Japonica Group]
Length=957

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1    MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRWSEE+A+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|EEC81667.1| hypothetical protein OsI_25220 [Oryza sativa Indica Group]
 gb|EEE66722.1| hypothetical protein OsJ_23404 [Oryza sativa Japonica Group]
Length=951

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1    MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRWSEE+A+ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>dbj|BAA06629.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=957

 Score =   232 bits (591),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1    MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGLNRLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRWSEE+A+ILVPGDIISVK GDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWSEEEAAILVPGDIISVKRGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008230721.1| PREDICTED: plasma membrane ATPase 1-like [Prunus mume]
Length=959

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 173/189 (92%), Gaps = 3/189 (2%)
 Frame = +3

Query  63   MAE---KPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleek  233
            MAE   K   LDAVLKE VDLEN+P+EEVF  LRC + GLTS+AA++RL IFG+NKLEEK
Sbjct  1    MAEMDGKSGALDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEK  60

Query  234  keskflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIE  413
            KESK LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIE
Sbjct  61   KESKVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIE  120

Query  414  EnnagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDP  593
            ENNAGNAAAALMA LAPKAKV RDGRW E+DASILVPGDIIS+KLGDIIPADARLLDGDP
Sbjct  121  ENNAGNAAAALMAHLAPKAKVFRDGRWIEQDASILVPGDIISIKLGDIIPADARLLDGDP  180

Query  594  LKIDQSALT  620
            LKIDQSALT
Sbjct  181  LKIDQSALT  189



>ref|XP_010228253.1| PREDICTED: plasma membrane ATPase 3-like isoform X1 [Brachypodium 
distachyon]
Length=991

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK   LDAVLKE+VDLENIP+EEVFENLRC+++GL+S  A++RL IFG NKLEEKKES
Sbjct  1    MDEKASNLDAVLKESVDLENIPLEEVFENLRCSREGLSSTQAEQRLAIFGPNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWNEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_010228254.1| PREDICTED: plasma membrane ATPase 3-like isoform X2 [Brachypodium 
distachyon]
Length=956

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK   LDAVLKE+VDLENIP+EEVFENLRC+++GL+S  A++RL IFG NKLEEKKES
Sbjct  1    MDEKASNLDAVLKESVDLENIPLEEVFENLRCSREGLSSTQAEQRLAIFGPNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWNEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>gb|KCW83495.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=924

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1    MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61   KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|EMT26085.1| Plasma membrane ATPase 1 [Aegilops tauschii]
Length=969

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 177/187 (95%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            MA + E  LDAVLKE VDLE+IPI+EVFENLRC+  GLTS+ AQ+RL IFG NKLEEK+E
Sbjct  1    MASRQEGNLDAVLKEAVDLEHIPIDEVFENLRCSHQGLTSEQAQQRLQIFGPNKLEEKEE  60

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEEN
Sbjct  61   SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEEN  120

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGDI+S+KLGDIIPADARLLDGDPLK
Sbjct  121  NAGNAAAALMARLAPKAKVLRDGRWTEEEAAVLVPGDIVSIKLGDIIPADARLLDGDPLK  180

Query  600  IDQSALT  620
            IDQSALT
Sbjct  181  IDQSALT  187



>ref|XP_009417143.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=955

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+K   ++AVLKE VDLENIP+EEVFENLRC ++GLT++ AQ+RL+IFG NKLEEKKES
Sbjct  1    MADKSVDMEAVLKEAVDLENIPLEEVFENLRCGREGLTAEQAQQRLEIFGPNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR G+WSEE+A+ILVPGDIIS+KLGDIIPADARLL GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRGGKWSEEEAAILVPGDIISIKLGDIIPADARLLGGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|AEQ27823.1| PM H+-ATPase L [Eichhornia crassipes]
Length=956

 Score =   231 bits (589),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK   ++AVLKE VDLENI +EEVF+NLRC ++GLTSQ AQERL IFG NKLEEKKES
Sbjct  1    MGEKAVEMEAVLKEVVDLENISLEEVFDNLRCNREGLTSQQAQERLTIFGQNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIIALLMINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEE+A+ILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010028675.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW83493.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=955

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1    MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61   KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|KCW83494.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=954

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1    MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61   KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRW E+DASILVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWGEQDASILVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|EMS45119.1| Plasma membrane ATPase 1 [Triticum urartu]
Length=973

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 177/187 (95%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MAEKPE-VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            MA + E  LDAVLKE VDLE+IPI+EVFENLRC+ +GLTS+ AQ+RL IFG NKLEEK+E
Sbjct  3    MASRQEGSLDAVLKEAVDLEHIPIDEVFENLRCSHEGLTSEQAQQRLQIFGPNKLEEKEE  62

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKP DWQDFVGIITLL+INSTISFIEEN
Sbjct  63   SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPSDWQDFVGIITLLLINSTISFIEEN  122

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGDIIS+KLGDIIPADARLLDGDPLK
Sbjct  123  NAGNAAAALMARLAPKAKVLRDGRWTEEEAAVLVPGDIISIKLGDIIPADARLLDGDPLK  182

Query  600  IDQSALT  620
            IDQSALT
Sbjct  183  IDQSALT  189



>gb|EYU34115.1| hypothetical protein MIMGU_mgv1a000867mg [Erythranthe guttata]
Length=955

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA   E ++A+ +E VDLENIPIEEVF+NLRCTK+GL+S+ A  RL+IFG+NKLEEK+ES
Sbjct  1    MAANDEAMEALKREAVDLENIPIEEVFDNLRCTKEGLSSEDAIRRLEIFGYNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG W+EEDA++LVPGD++S+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGHWNEEDAAVLVPGDVVSIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_011098566.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
 ref|XP_011098567.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
Length=955

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA K E ++A+ +E VDLEN+P+EEVFENLRCT++GL+S+ A  RL+IFG NKLEEK+ES
Sbjct  1    MAAKDEAMEALKREAVDLENVPLEEVFENLRCTREGLSSEDANRRLEIFGQNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG W+EEDA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGHWNEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>emb|CDP02191.1| unnamed protein product [Coffea canephora]
Length=967

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA + E ++A+ KE VDLENIP+EEVFENLRCTK+GL+S+ AQ RL IFG+NKLEEK+ES
Sbjct  1    MAAQDEAMEALKKEAVDLENIPLEEVFENLRCTKEGLSSEDAQRRLQIFGYNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGI  LL+INS+ISF EENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGITILLLINSSISFYEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARL+PKAKVLRDG WSE+DASILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLSPKAKVLRDGSWSEQDASILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_011466246.1| PREDICTED: plasma membrane ATPase 1-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=966

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK E L+ V+KE VDLE++PIEEVF  LRC + GLTS+AAQ+RL +FG+NKLEEKKES
Sbjct  1    MDEKAEGLEVVVKEAVDLEHVPIEEVFLTLRCDEHGLTSEAAQQRLALFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAP AKVLRDG+W EEDASILVPGDIIS+KLGDI+PADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPTAKVLRDGKWIEEDASILVPGDIISIKLGDILPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>ref|XP_004955721.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   LDAVLKE VDLENIPIEEVFENLRC+  GL+++ A++RL IFG NKLEEK+ES
Sbjct  1    MEDKAANLDAVLKEAVDLENIPIEEVFENLRCSPQGLSTEQAEQRLAIFGPNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWTEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_004302360.1| PREDICTED: plasma membrane ATPase 1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=956

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK E L+ V+KE VDLE++PIEEVF  LRC + GLTS+AAQ+RL +FG+NKLEEKKES
Sbjct  1    MDEKAEGLEVVVKEAVDLEHVPIEEVFLTLRCDEHGLTSEAAQQRLALFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAP AKVLRDG+W EEDASILVPGDIIS+KLGDI+PADARLLDGDPLKI
Sbjct  121  AGNAAAALMARLAPTAKVLRDGKWIEEDASILVPGDIISIKLGDILPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQS+LT
Sbjct  181  DQSSLT  186



>gb|KDP28822.1| hypothetical protein JCGZ_14593 [Jatropha curcas]
Length=966

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M ++   LDAV+KE VDLENIP+EEVF++L+CTK+GL+S A QERLD+FGHNKLEEKKES
Sbjct  1    MVDESVALDAVIKEAVDLENIPLEEVFDHLKCTKNGLSSDAVQERLDLFGHNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGK PD+ DFVGI+ LLVINSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKSPDYHDFVGIVILLVINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>dbj|BAK04567.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9    LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAK+LRDGRW+EEDA+ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  129  LMARLAPKAKILRDGRWTEEDAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALT  187



>ref|XP_008650970.1| PREDICTED: uncharacterized protein LOC100216710 isoform X1 [Zea 
mays]
 tpg|DAA59903.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=956

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   LDAVLKE VDLENIPIEEVFENLRC+  GLT++ A++RL IFG NKLEEK+ES
Sbjct  1    MEDKASNLDAVLKEAVDLENIPIEEVFENLRCSPQGLTTEQAEQRLAIFGPNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWTEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>dbj|BAJ92653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   229 bits (583),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9    LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAK+LRDGRW+EEDA+ILVPGD+IS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  129  LMARLAPKAKILRDGRWTEEDAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSALT  187



>emb|CDP09440.1| unnamed protein product [Coffea canephora]
Length=966

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK   LDAV+KE VDLENIP+EEVF+NL+CT+ GL+S A +ERLD+FG NKLEEKKES
Sbjct  1    MYEKSVALDAVIKEAVDLENIPLEEVFDNLKCTRKGLSSDAVKERLDLFGFNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIM+IALANGGGK PD QDFVGI+ LL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMSIALANGGGKGPDIQDFVGILLLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|EEC75974.1| hypothetical protein OsI_13084 [Oryza sativa Indica Group]
 gb|EEE59727.1| hypothetical protein OsJ_12166 [Oryza sativa Japonica Group]
Length=966

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1    MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+G W+EE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGSWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>dbj|BAA01058.1| H-ATPase [Oryza sativa Japonica Group]
 prf||1906387A H ATPase
Length=956

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1    MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+G W+EE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGSWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|NP_001050947.1| Os03g0689300 [Oryza sativa Japonica Group]
 emb|CAD29294.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|AAT81733.1| H-ATPase [Oryza sativa Japonica Group]
 gb|ABF98274.1| Plasma membrane ATPase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12861.1| Os03g0689300 [Oryza sativa Japonica Group]
Length=956

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1    MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+G W+EE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGSWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_002459489.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
 gb|EER96010.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
Length=956

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   LDAVLKE VDLENIPIEEVFENLRC+  GL+++ A++RL IFG NKLEEK+ES
Sbjct  1    MEDKASNLDAVLKEAVDLENIPIEEVFENLRCSPQGLSTEQAEQRLAIFGPNKLEEKQES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K  KFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KIFKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRNGRWTEEESAILVPGDIISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_006837363.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
 gb|ERN00217.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
Length=1007

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK   LDAV KE VDLENIPIEEVFE+L CT++GLTS+A QERL++FG+NKLEEKKES
Sbjct  45   MDEKSIALDAVNKEAVDLENIPIEEVFESLECTQEGLTSEAVQERLELFGYNKLEEKKES  104

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVME+AAIMAIALANGGGK PD+ DF GI+ LLVINSTISFIEENN
Sbjct  105  KLLKFLGFMWNPLSWVMESAAIMAIALANGGGKDPDYIDFCGIVILLVINSTISFIEENN  164

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEEDAS+LVPGDIIS+KLGDI+PADARLL+GDPLKI
Sbjct  165  AGNAAAALMARLAPKAKVLRDGRWSEEDASVLVPGDIISIKLGDIVPADARLLEGDPLKI  224

Query  603  DQSALT  620
            DQSALT
Sbjct  225  DQSALT  230



>ref|XP_010531800.1| PREDICTED: ATPase 4, plasma membrane-type-like [Tarenaya hassleriana]
Length=954

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            +DAVLKE VDLEN+P+ EVFE LRC  +GL+++AA++RL IFGHNKLEEK+ESKFLKFLG
Sbjct  7    MDAVLKEAVDLENVPMAEVFETLRCDTNGLSTKAAEQRLAIFGHNKLEEKQESKFLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+W EEDASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  127  LMAHLAPKTKVLRDGKWIEEDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  185



>tpg|DAA50741.1| TPA: hypothetical protein ZEAMMB73_722190 [Zea mays]
Length=1149

 Score =   227 bits (579),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 7/193 (4%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleek---  233
            MA+    LDAVLKE VDLENIP+EEVFENLRC++ GLTS+ AQ+RL +FG NKLEEK   
Sbjct  195  MADNEGTLDAVLKEAVDLENIPLEEVFENLRCSRGGLTSEQAQQRLQLFGPNKLEEKELN  254

Query  234  ----keskflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTI  401
                +ESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTI
Sbjct  255  WPWLQESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTI  314

Query  402  SFIEEnnagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLL  581
            SFIEENNAGNAAAALMARLAPKAKVLRDGRW+EE+A++LVPGD+IS+KLGDIIPADARLL
Sbjct  315  SFIEENNAGNAAAALMARLAPKAKVLRDGRWAEEEAAVLVPGDVISIKLGDIIPADARLL  374

Query  582  DGDPLKIDQSALT  620
            DGDPLKIDQS+LT
Sbjct  375  DGDPLKIDQSSLT  387



>gb|ABR26203.1| plasma membrane atpase 1 [Oryza sativa Indica Group]
Length=279

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 164/166 (99%), Gaps = 0/166 (0%)
 Frame = +3

Query  123  IPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMWNPLSWVMEaa  302
            IP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ESKFLKFLGFMWNPLSWVMEAA
Sbjct  1    IPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEESKFLKFLGFMWNPLSWVMEAA  60

Query  303  aimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  482
            AIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  61   AIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR  120

Query  483  DGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            DGRW+EE+A+ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  121  DGRWTEEEAAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALT  166



>ref|XP_011031934.1| PREDICTED: plasma membrane ATPase 1 [Populus euphratica]
Length=965

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M E    LDA+ KE VDLENIP+EEVFENLRCT++GLT+   +ERLD+FG+NKLEE+KE+
Sbjct  1    MVENSTALDAINKEAVDLENIPLEEVFENLRCTREGLTANEVRERLDLFGYNKLEEQKEN  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAI LA+GG K  D+ DFVGIITLL+INSTISFIEENN
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIGLAHGGNKSADYHDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEE+AS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEEASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_008341531.1| PREDICTED: plasma membrane ATPase 1-like [Malus domestica]
Length=956

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK   LDAVLKE VDLE++P+EEVF  LRC K GLTS+A ++RL IFG NKLEEKKES
Sbjct  1    MDEKAVDLDAVLKEAVDLEHVPLEEVFVTLRCNKHGLTSEAVEQRLAIFGFNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPL+WVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLAWVMEAAAIMAIALANGGGKPPDWQDFIGIIALLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDGRW EEDAS+LVPGD+IS+KLGDIIPADARLLDGD LKI
Sbjct  121  AGNAAAALMARLAPKAKVFRDGRWIEEDASVLVPGDVISIKLGDIIPADARLLDGDALKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_009335819.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=956

 Score =   223 bits (567),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M EK   LDAVLKE VDLE++P+EEV+  LRC K GLTS+A ++RL IFG NKLEEKKES
Sbjct  1    MDEKAVDLDAVLKEAVDLEHVPLEEVYVTLRCNKHGLTSEAVEQRLAIFGFNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPL+WVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLAWVMEAAAIMAIALANGGGKPPDWQDFIGIIALLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDGRW EEDAS+LVPGDIIS+KLGDIIPADARLLDGD LKI
Sbjct  121  AGNAAAALMARLAPKAKVFRDGRWIEEDASVLVPGDIISIKLGDIIPADARLLDGDALKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 170/187 (91%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            MAEK  + L+ +  ETVDLE IPIEEVFENLRCT++GL+S+  + RL IFG NKLEEKKE
Sbjct  1    MAEKASISLEEIKNETVDLEKIPIEEVFENLRCTREGLSSEEGETRLQIFGPNKLEEKKE  60

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            SK LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLLINSTISFIEEN  120

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GD LK
Sbjct  121  NAGNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDSLK  180

Query  600  IDQSALT  620
            +DQSALT
Sbjct  181  VDQSALT  187



>dbj|BAM20990.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=954

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EK    +++  ETVDLE+IP+EEVFE LRCT+ GLTS   +ERL IFGHNKLEEK ESK 
Sbjct  5    EKMSKFESINNETVDLEHIPLEEVFEQLRCTRQGLTSAEGEERLVIFGHNKLEEKSESKV  64

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIITLLVINSTISFIEENNAG  124

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPK+KVLRDG W+E+DA ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQ
Sbjct  125  NAAAALMARLAPKSKVLRDGVWAEQDAVILVPGDIVSIKLGDIIPADARLLEGDPLKIDQ  184

Query  609  SALT  620
            SALT
Sbjct  185  SALT  188



>gb|EPS73574.1| hypothetical protein M569_01174, partial [Genlisea aurea]
Length=743

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 170/187 (91%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            MAEK  + L+ +  ETVDLE +PIEEVFE LRCT++GL+S+  + RL IFG NKLEEKKE
Sbjct  1    MAEKESISLEEIKNETVDLEKVPIEEVFEKLRCTREGLSSEEGETRLHIFGPNKLEEKKE  60

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            SK LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFMGIICLLIINSTISFIEEN  120

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMA LAPK KVLRDGRWSE++A+ILVPGDI+S+KLGDIIPADARLL+GDPLK
Sbjct  121  NAGNAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLK  180

Query  600  IDQSALT  620
            +DQSALT
Sbjct  181  VDQSALT  187



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E+VDLE IPIEEVFE L+CTKDGLTS+  + RL IFGHNKLEEKKESK LKFLG
Sbjct  7    LEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEHRLQIFGHNKLEEKKESKILKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI  LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE++A+ILVPGD+IS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  127  LMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALT  185



>ref|XP_006375124.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP52921.1| H+-ATPase family protein [Populus trichocarpa]
Length=965

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M E    LDA+ KE VDLENIP+EEVF+NL+CT++GLT+   +ERLD+FG+NKLEEKKES
Sbjct  1    MVENSIALDAINKEAVDLENIPLEEVFDNLKCTREGLTANEVRERLDLFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAI LA+GG K  D+ DFVGIITLL+INSTISFIEENN
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIGLAHGGNKSADYHDFVGIITLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDGRWSEE+AS+LVPGDI+S+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGRWSEEEASVLVPGDIVSIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   220 bits (560),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+A+  ET+DLE++PIEEVF  L+CT++GLTS+   +RLDIFG NKLEEK+ESKFLKFLG
Sbjct  7    LEAIKNETIDLEHMPIEEVFAELKCTREGLTSEEGAKRLDIFGPNKLEEKQESKFLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGILVLLIINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALT
Sbjct  127  LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALT  185



>ref|XP_010430916.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
Length=334

 Score =   209 bits (533),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +3

Query  87   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  266
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  267  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  446
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAAL  127

Query  447  marlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            MA LAPK KVLRDG+W E++A+ILVPGD+IS+KLGDI+PADARLL GDPLKIDQSALT
Sbjct  128  MANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALT  185



>ref|NP_001105360.1| membrane H(+)-ATPase1 [Zea mays]
 gb|AAB60276.1| H(+)-transporting ATPase [Zea mays]
Length=949

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            +K   LDAVLKE VDLENI I+EVFE+LRC+  GL+++ A++RL IFG NKLEEK+ESKF
Sbjct  6    DKASNLDAVLKEAVDLENIAIQEVFESLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKF  65

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  66   LKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENNAG  125

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQ
Sbjct  126  NAAAALMARLAPKAKVLRNGRWAEEESAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  185

Query  609  SALT  620
            SALT
Sbjct  186  SALT  189



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLE +PIEEVFE L+CT++GLTSQ    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNENVDLERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESKVLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AA+MAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  187



>tpg|DAA42486.1| TPA: H(+)-transporting ATPase [Zea mays]
Length=949

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            +K   LDAVLKE VDLENI I+EVFE+LRC+  GL+++ A++RL IFG NKLEEK+ESKF
Sbjct  6    DKASNLDAVLKEAVDLENIAIQEVFESLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKF  65

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  66   LKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENNAG  125

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMARLAPKAKVLR+GRW+EE+++ILVPGDIISVKLGDIIPADARLL+GDPLKIDQ
Sbjct  126  NAAAALMARLAPKAKVLRNGRWAEEESAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  185

Query  609  SALT  620
            SALT
Sbjct  186  SALT  189



>dbj|BAM20989.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=957

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
             +++  ETVDLE IPIEEVF  LRCTK+GLTS   + RL IFG NKLEEK ESK LKFLG
Sbjct  11   FESLTDETVDLERIPIEEVFAQLRCTKEGLTSTEGETRLQIFGFNKLEEKSESKILKFLG  70

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDF+GIITLLVINSTISFIEENNAGNAAA+
Sbjct  71   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFIGIITLLVINSTISFIEENNAGNAAAS  130

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPK KVLRDG+WSE+DA ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  131  LMARLAPKTKVLRDGKWSEQDAVILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  189



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVFE L+CTK+GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME+AA+MAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMESAAVMAIALANGSGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  187



>ref|XP_001782121.1| predicted protein [Physcomitrella patens]
 gb|EDQ53065.1| predicted protein, partial [Physcomitrella patens]
Length=465

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  78   EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  257
            E L A+  ETVDLE+IP+EEVFE LRCT+ GLT    ++R+ I G NKLEEK ESK LKF
Sbjct  2    EALQALNNETVDLEHIPVEEVFEQLRCTRQGLTDAEGEQRIKICGPNKLEEKSESKILKF  61

Query  258  lgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaa  437
            LGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LL+INSTISFIEENNAG AA
Sbjct  62   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLIINSTISFIEENNAGQAA  121

Query  438  aalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSAL  617
            A+LMARLAP+ KVLRDG W+E DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSAL
Sbjct  122  ASLMARLAPQTKVLRDGAWAERDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  181

Query  618  T  620
            T
Sbjct  182  T  182



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E+VDLE IPIEEVFE L+CTK+GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNESVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKLLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DASILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALT  187



>ref|XP_010496530.1| PREDICTED: ATPase 8, plasma membrane-type-like, partial [Camelina 
sativa]
Length=400

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +3

Query  87   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  266
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  267  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  446
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAAL  127

Query  447  marlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            MA LAPK KVLRDG+W E++A+ILVPGD+IS+KLGDI+PADARLL GDPLKIDQSALT
Sbjct  128  MANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSALT  185



>ref|XP_010529048.1| PREDICTED: ATPase 7, plasma membrane-type [Tarenaya hassleriana]
Length=960

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK E L A+ KE++DLEN+P+EEVF++L+CT++GL+S  AQERL +FG+NKLEEK+ES
Sbjct  1    MAEKSETLQAISKESIDLENVPLEEVFDHLKCTREGLSSNEAQERLSLFGYNKLEEKRES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGKPPD+ DFVGI+ LL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKPPDYHDFVGIVILLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDG W E DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVSRDGTWDEIDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVFE L+CT++GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  187



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVFE L+CTK+GLTSQ  + RL IFG NKLEEKKESKFLKFLG
Sbjct  9    LEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALT  187



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVFE L+CTK+GLTSQ  + RL IFG NKLEEKKESKFLKFLG
Sbjct  9    LEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALT  187



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVF  L+C+K+GLTS    +RL+IFG NKLEEKKESKFLKFLG
Sbjct  5    LEDIRNETVDLETIPIEEVFTQLKCSKEGLTSDEGAKRLEIFGPNKLEEKKESKFLKFLG  64

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGI+TLLVINSTISFIEENNAGNAAAA
Sbjct  65   FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIMTLLVINSTISFIEENNAGNAAAA  124

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALT
Sbjct  125  LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALT  183



>ref|XP_010545150.1| PREDICTED: ATPase 7, plasma membrane-type [Tarenaya hassleriana]
Length=1175

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MAEK E L A+ KE++DLEN+P+EEVF++L+CT++GL+S  AQERL +FG+NKLEEK+ES
Sbjct  1    MAEKSETLQAISKESIDLENVPLEEVFDHLKCTREGLSSNEAQERLSLFGYNKLEEKRES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGKPPD+ DFVGI+ LL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKPPDYHDFVGIVILLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKV RDG W E DA++LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVSRDGTWDEIDAAVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  471  KVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            + L DG W E DA++LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  658  RYLFDGTWDEIDAAVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  707



>ref|XP_009610942.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana tomentosiformis]
Length=926

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA    +L+ +  E VDLENIP+EEVF+ L+C+++GLT++  Q RL IFGHNKLEEKKE+
Sbjct  1    MASNLSLLEDIRNEQVDLENIPVEEVFQCLKCSREGLTNEEGQNRLQIFGHNKLEEKKEN  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAA+M+IALANGGGKPPDW DFVGI+ LL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAVMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPK K+LRDG+WSEE+ASILVPGD+ISVKLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMANLAPKTKILRDGKWSEEEASILVPGDMISVKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQ+ALT
Sbjct  181  DQAALT  186



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IP++EVFE L+CT++GL+S     RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AA+MAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSEEDA+ILVPGDIIS+KLGDI+PADARLLDGDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALT  187



>ref|XP_006440236.1| hypothetical protein CICLE_v10018727mg [Citrus clementina]
 gb|ESR53476.1| hypothetical protein CICLE_v10018727mg [Citrus clementina]
Length=959

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  68   FMWNPLSWVMEAAALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAA  127

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  128  LMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  186



>ref|XP_006477127.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=958

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  68   FMWNPLSWVMEAAALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAA  127

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  128  LMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  186



>gb|KDO61318.1| hypothetical protein CISIN_1g002151mg [Citrus sinensis]
Length=959

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  68   FMWNPLSWVMEAAALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAA  127

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  128  LMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  186



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKFLG  65

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  126  LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  184



>emb|CBI16656.3| unnamed protein product [Vitis vinifera]
Length=958

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 173/187 (93%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MAEKPEVLD-AVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            M EK   LD A+ KE VDLENIP+EEVFE+L+CT++GL+ +A Q+RLD+FG+NKLEE KE
Sbjct  1    MDEKSIALDEAINKEAVDLENIPLEEVFEHLKCTREGLSHEAFQQRLDLFGYNKLEEIKE  60

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            +K LKFLGFMWNPLSWVMEAAA+MAIALA+GGGKP D+ DFVGII LL++NSTISF+EEN
Sbjct  61   NKILKFLGFMWNPLSWVMEAAAVMAIALAHGGGKPTDYHDFVGIIILLIVNSTISFVEEN  120

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMARLAPKAKVLRDG+WSEEDA++LVPGDIIS+KLGDIIPADARLL+GDPLK
Sbjct  121  NAGNAAAALMARLAPKAKVLRDGKWSEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLK  180

Query  600  IDQSALT  620
            IDQSALT
Sbjct  181  IDQSALT  187



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKE K LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLG  65

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  126  LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  184



>ref|XP_003633895.1| PREDICTED: plasma membrane ATPase 1 [Vitis vinifera]
Length=968

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 173/187 (93%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MAEKPEVLD-AVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            M EK   LD A+ KE VDLENIP+EEVFE+L+CT++GL+ +A Q+RLD+FG+NKLEE KE
Sbjct  1    MDEKSIALDEAINKEAVDLENIPLEEVFEHLKCTREGLSHEAFQQRLDLFGYNKLEEIKE  60

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            +K LKFLGFMWNPLSWVMEAAA+MAIALA+GGGKP D+ DFVGII LL++NSTISF+EEN
Sbjct  61   NKILKFLGFMWNPLSWVMEAAAVMAIALAHGGGKPTDYHDFVGIIILLIVNSTISFVEEN  120

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMARLAPKAKVLRDG+WSEEDA++LVPGDIIS+KLGDIIPADARLL+GDPLK
Sbjct  121  NAGNAAAALMARLAPKAKVLRDGKWSEEDAAVLVPGDIISIKLGDIIPADARLLEGDPLK  180

Query  600  IDQSALT  620
            IDQSALT
Sbjct  181  IDQSALT  187



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKE K LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLG  65

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  126  LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  184



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLENIPIEEVF+ L+CT++GLTS     RL +FG NKLEEKKESKFLKFLG
Sbjct  9    LEEIKNETVDLENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME+AAIMAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW EE+A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  187



>ref|XP_007134481.1| hypothetical protein PHAVU_010G050900g [Phaseolus vulgaris]
 gb|ESW06475.1| hypothetical protein PHAVU_010G050900g [Phaseolus vulgaris]
Length=960

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M E    LDA++KE VDLENIP+EEVF+NL+CT++GL+S+  QERLD+FG+NKLEEKKES
Sbjct  1    MGEGSVELDAIIKEAVDLENIPLEEVFDNLKCTREGLSSEKVQERLDLFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAI +A+GG +  D+QDFVGI+ LL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIGMAHGGNERGDYQDFVGIVLLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   L  +  E VDLE IPIEEVFE L+CTK+GLTS+   +RL IFG NKLEEKKES
Sbjct  1    MVDKENSLQEIKSENVDLERIPIEEVFEQLKCTKEGLTSEEGHKRLQIFGPNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVME AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEIAAIMAICLANGGGKPPDWQDFLGIVVLLLINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPK KVLRDG+W E++A+ILVPGDIIS+KLGDIIPADARLLDGDPLKI
Sbjct  121  AGNAAAALMAGLAPKTKVLRDGKWCEQEAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>emb|CDY67606.1| BnaAnng24780D, partial [Brassica napus]
Length=507

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = +3

Query  87   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  266
            D +  E VDLE IP+EEVF+ L+CTK+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKNENVDLERIPVEEVFQQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  267  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  446
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAAL  127

Query  447  marlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            MA LAPK KVLRDG+W E+DASILVPGD+ISVKLGDI+PADARLL GDPLKIDQSALT
Sbjct  128  MANLAPKTKVLRDGKWGEQDASILVPGDLISVKLGDIVPADARLLQGDPLKIDQSALT  185



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EK   L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    R+ IFG NKLEEKKESKF
Sbjct  2    EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKF  61

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAG
Sbjct  62   LKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAG  121

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMA LAPK KVLRDG+W+EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQ
Sbjct  122  NAAAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  181

Query  609  SALT  620
            SALT
Sbjct  182  SALT  185



>emb|CDY69631.1| BnaCnng64550D, partial [Brassica napus]
Length=524

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +3

Query  87   DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  266
            D +  E VDLE IP+EEVF+ L+CTK+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKNENVDLERIPVEEVFKQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  267  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  446
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAAL  127

Query  447  marlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            MA LAPK KVLRDG+W E+DASILVPGD+ISVKLGDI+PADARLL+GDPLKIDQSALT
Sbjct  128  MANLAPKTKVLRDGKWGEQDASILVPGDLISVKLGDIVPADARLLEGDPLKIDQSALT  185



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
            EK   L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    R+ IFG NKLEEKKESK 
Sbjct  2    EKATSLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKI  61

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAAIMAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAG
Sbjct  62   LKFLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAG  121

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMA LAPK KVLRDG+W+EEDA+ILVPGDIISVKLGDIIPADARLL+GDPLKIDQ
Sbjct  122  NAAAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQ  181

Query  609  SALT  620
            SALT
Sbjct  182  SALT  185



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALT
Sbjct  124  LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALT  182



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  14   LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  73

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  74   FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  133

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALT
Sbjct  134  LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALT  192



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++A+ILVPGDI+S+KLGDI+PADARLL+GDPLK+DQSALT
Sbjct  124  LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALT  182



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
             K   L+ +  E VDLE+IPIEEVFE L+CT++GLTS+    RL +FG NKLEEKKESK 
Sbjct  5    HKAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKI  64

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAA+MAI LANGGG+PPDWQDFVGII LL INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAG  124

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMA LAPK KVLRDGRWSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  125  NAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQ  184

Query  609  SALT  620
            SALT
Sbjct  185  SALT  188



>gb|AAV49159.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
 gb|AAV49160.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
Length=925

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIP+EEVF+ L+C+++GLT++  Q RL IFGHNKLEEKKE+K LKFLG
Sbjct  7    LEDIRNEQVDLENIPVEEVFQILKCSREGLTNEEGQNRLQIFGHNKLEEKKENKVLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIM+IALANGGGKPPDW DFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMEAAAIMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK K+LRDG+WSEEDASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQ+ALT
Sbjct  127  LMANLAPKTKILRDGKWSEEDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQAALT  185



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVF+ L+CT++GLTS     RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLEKIPIEEVFQQLKCTREGLTSDEGAHRLQIFGPNKLEEKKESKVLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSEE+A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  187



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +3

Query  69   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  248
             K   L+ +  E VDLE+IPIEEVFE L+CT++GLTS+    RL +FG NKLEEKKESK 
Sbjct  5    HKAITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKL  64

Query  249  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  428
            LKFLGFMWNPLSWVMEAAA+MAI LANGGG+PPDWQDFVGII LL INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAG  124

Query  429  naaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQ  608
            NAAAALMA LAPK KVLRDGRWSE++A+ILVPGDIIS+KLGDIIPADARLL+GDPLKIDQ
Sbjct  125  NAAAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQ  184

Query  609  SALT  620
            SALT
Sbjct  185  SALT  188



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E+VDLE IP+EEVFE L+CTK+GLT +    RL +FG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNESVDLERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESKLLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DASILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  187



>gb|KJB66333.1| hypothetical protein B456_010G136300 [Gossypium raimondii]
Length=949

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            MA+K   L+ +  ETVDLE IP+EEVF+ L+CT++GLTS+  Q+RL IFG NKLEEKKE+
Sbjct  1    MADKSISLEEIKNETVDLERIPVEEVFQQLKCTRNGLTSEEGQKRLQIFGPNKLEEKKEN  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVME AAIMAIALANGGGKPPDWQDF+GI++LL INSTISFIEENN
Sbjct  61   KLLKFLGFMWNPLSWVMEFAAIMAIALANGGGKPPDWQDFIGIVSLLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPK KVLRDG+W+E++A+ILVPGDIIS+KLGDI+PADARLL+GD LKI
Sbjct  121  AGNAAAALMAGLAPKTKVLRDGKWNEQEAAILVPGDIISIKLGDIVPADARLLEGDALKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            MAE   + L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKK+
Sbjct  1    MAESKSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKD  60

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            SK LKFLGFMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGII LLVINSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK
Sbjct  121  NAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  600  IDQSALT  620
            IDQSALT
Sbjct  181  IDQSALT  187



>gb|KJB82762.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=758

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            LD +  E+VDLE IPIEEVFE L+CT++GL++Q    RL +FG NKLEEKKESKFLKFLG
Sbjct  9    LDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE++A+ILVPGDII++KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALT  187



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +3

Query  63   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            MAE   + L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKK+
Sbjct  1    MAESKSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKD  60

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            SK LKFLGFMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGII LLVINSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK
Sbjct  121  NAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  600  IDQSALT  620
            IDQSALT
Sbjct  181  IDQSALT  187



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG NKLEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNKLEEKKESKILKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK+DQSALT
Sbjct  124  LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALT  182



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLENIPIEEVF+ L+C++DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDIRNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPD+ DF+GI+ LLVINSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLVINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALT
Sbjct  127  LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALT  185



>ref|XP_002511598.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF50267.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=874

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 169/186 (91%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M  K   LD V+KE VDLENIP+EEVF +L+C ++GL S A QERLD+FG+NKLEEKKES
Sbjct  1    MVNKSVALDDVIKEAVDLENIPLEEVFYHLKCAREGLNSDAVQERLDLFGYNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGK  D+ DFVGI+ LL++NSTISF+EENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKSADYHDFVGILILLLVNSTISFMEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMARLAPKAKVLRDG+WSEEDAS+LVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMARLAPKAKVLRDGKWSEEDASVLVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>dbj|BAD19091.1| putative H+-exporting ATPase [Oryza sativa Japonica Group]
 gb|EAY87868.1| hypothetical protein OsI_09289 [Oryza sativa Indica Group]
 gb|EAZ24947.1| hypothetical protein OsJ_08728 [Oryza sativa Japonica Group]
Length=950

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ V  ETVDLE IP+EEVF++L+C+K GL++   Q RL+IFG NKLEEK ESK LKFLG
Sbjct  6    LEDVRNETVDLETIPVEEVFQHLKCSKQGLSAAEGQNRLNIFGPNKLEEKTESKLLKFLG  65

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAI LANGGG+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  125

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+W E+DASILVPGDIIS+KLGDIIPADARLL+GDPLK+DQ+ALT
Sbjct  126  LMAGLAPKTKVLRDGKWQEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQAALT  184



>ref|XP_007204519.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica]
 gb|EMJ05718.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica]
Length=965

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            LDA++KE VDLEN+P+EEVF++L+CT+DGL+S   QERLD+FG+NKLEEKKESKFLKFLG
Sbjct  8    LDAIIKEAVDLENVPLEEVFDHLKCTRDGLSSDEVQERLDLFGYNKLEEKKESKFLKFLG  67

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAI+AIA   GG KP D+ DF GI+ LLVINSTISFIEENNAGNAAAA
Sbjct  68   FMWNPLSWVMEAAAIIAIAFTQGGSKPADYHDFFGILVLLVINSTISFIEENNAGNAAAA  127

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMARLAPKAKVLRDG+W+EEDA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  128  LMARLAPKAKVLRDGKWAEEDAAVLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  186



>gb|KJB82864.1| hypothetical protein B456_013G217900 [Gossypium raimondii]
Length=899

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIP+EEVF+ L+CTK+GLT+   + RL IFGHNKLEEKK++K LKFLG
Sbjct  9    LEQIKNEIVDLENIPVEEVFKLLKCTKEGLTTAEGETRLSIFGHNKLEEKKDNKVLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAI LANGGGKPPDW DFVGI+TLL+INSTISFIEEN+AGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIVLANGGGKPPDWPDFVGIVTLLLINSTISFIEENSAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE++ASILVPGDIISVKLGDIIPADARLL+GDPLKIDQ+ALT
Sbjct  129  LMAGLAPKTKVLRDGKWSEQEASILVPGDIISVKLGDIIPADARLLEGDPLKIDQAALT  187



>ref|NP_001105470.1| plasma-membrane H+ATPase2 [Zea mays]
 emb|CAA59800.1| H(+)-transporting ATPase [Zea mays]
Length=948

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALAN GGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANSGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALT
Sbjct  124  LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALT  182



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLENIP++EVFE L+C+++GLTS   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEQIKNETVDLENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKFLG  65

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  126  LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  184



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  242
            M +K   L+ +  ETVDLE +PIEEVFE L+CT++GL+S+    RL IFG NKLEEKKES
Sbjct  1    MGDKGISLEEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKES  60

Query  243  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  422
            KFLKFLGFMWNPLSWVME AAIMAIALANGGGKPPDW+DFVGI+ LL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVALLFINSTISFIEENN  120

Query  423  agnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKI  602
            AGNAAAALMA LAPK KVLRDGRWSEE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLKI
Sbjct  121  AGNAAAALMASLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  603  DQSALT  620
            DQSALT
Sbjct  181  DQSALT  186



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IP+EEVF  L+CTK+GLT+   ++RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEEIKNETVDLERIPVEEVFTQLKCTKEGLTTAEGEQRLQIFGPNKLEEKKESKFLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIMVLLIINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE++A+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  127  LMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  185



>gb|KJB82763.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=954

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            LD +  E+VDLE IPIEEVFE L+CT++GL++Q    RL +FG NKLEEKKESKFLKFLG
Sbjct  9    LDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE++A+ILVPGDII++KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSALT  187



>ref|XP_009775735.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana sylvestris]
Length=925

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIP+EEVF+ L+C+++GLT++  Q RL IFGHNKLEEKKE+K LKFLG
Sbjct  7    LEDIRNEQVDLENIPVEEVFQILKCSREGLTNEEGQNRLQIFGHNKLEEKKENKVLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIM+IALANGGGKPPDW DFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMEAAAIMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK K+LRDG+WSEE+ASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQ+ALT
Sbjct  127  LMANLAPKTKILRDGKWSEEEASILVPGDLISVKLGDIIPADARLLEGDPLKIDQAALT  185



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVFE L+CT++GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPIEEVFEQLKCTREGLTSEEGASRLQIFGPNKLEEKKESKLLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSEE+A+ILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALT
Sbjct  129  LMAGLAPKTKVLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALT  187



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   214 bits (546),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLENIPIEEVF+ L+C++DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDIKNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPD+ DF+GI+ LLVINSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLVINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALT
Sbjct  127  LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALT  185



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   214 bits (546),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLE+IPIEEVFE L+C+K+GLTS     RL IFG NKLEEKKESK LKFLG
Sbjct  5    LEQIKNEAVDLEHIPIEEVFEQLKCSKEGLTSDEGANRLQIFGPNKLEEKKESKILKFLG  64

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AA+MAI LANG GKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  65   FMWNPLSWVMEMAALMAIVLANGQGKPPDWQDFVGIVALLVINSTISFIEENNAGNAAAA  124

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  125  LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  183



>ref|XP_009348377.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=966

 Score =   214 bits (546),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = +3

Query  60   VMAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  239
            ++  K   LDA++KE VDLEN+P+ EVF++L+CT+DGL+S   QERLD+FG+NKLEEKKE
Sbjct  1    MVVAKSVALDAIIKEAVDLENVPLSEVFDHLKCTRDGLSSDEVQERLDLFGYNKLEEKKE  60

Query  240  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  419
            SK LKFLGFMWNPLSWVMEAAAI+A+A   GG +P D+ DFVGI+ LLVINSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAIIAVAFTQGGSQPADYHDFVGILVLLVINSTISFIEEN  120

Query  420  nagnaaaalmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLK  599
            NAGNAAAALMARLAPKAKVLR+G+W+EEDA++LVPGDIIS+KLGDI+PADARLL+GDPLK
Sbjct  121  NAGNAAAALMARLAPKAKVLRNGKWAEEDAAVLVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  600  IDQSALT  620
            IDQSALT
Sbjct  181  IDQSALT  187



>ref|XP_009398632.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=952

 Score =   214 bits (546),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+A+  ETVDLE +PIEEVFE L+CTKDGLT+    +RL IFG NKLEEKKESK LKFLG
Sbjct  7    LEAIKNETVDLERVPIEEVFEQLKCTKDGLTTGEGDKRLQIFGPNKLEEKKESKVLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANGGG+PPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMEMAAIMAIALANGGGQPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG WSE+DA+ILVPGDIIS+KLGDI+PADARLL+GDPLKIDQS+LT
Sbjct  127  LMAGLAPKTKVLRDGHWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSSLT  185



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   214 bits (546),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVF+ L+C+++GLTSQ  ++R+ IFG NKLEEKKESK LKFLG
Sbjct  4    LEDIKNETVDLEKIPIEEVFQQLKCSREGLTSQEGEDRIQIFGPNKLEEKKESKILKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE++A+ILVPGDIISVKLGDIIPADARLL+GDPLK+DQSALT
Sbjct  124  LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALT  182



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLENIPIEEVF+ L+CT+DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDIRNETVDLENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGPNKLEEKKESKFLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPD+ DF+GI+ LL+INSTISFIEENN+GNAAAA
Sbjct  67   FMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLIINSTISFIEENNSGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE+DASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALT
Sbjct  127  LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALT  185



>emb|CAD29312.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=942

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ V  ETVDLE IP+EEVF++L+C+K GL++   Q RL+IFG NKLEEK ESK LKFLG
Sbjct  6    LEDVRNETVDLETIPVEEVFQHLKCSKQGLSAAEGQNRLNIFGPNKLEEKTESKLLKFLG  65

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAI LANGGG+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  125

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+W E+DASILVPGDIIS+KLGDIIPADARLL+GDPLK+DQ+ALT
Sbjct  126  LMAGLAPKTKVLRDGKWQEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQAALT  184



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IPIEEVFE L+CTK+GLTS+    RL IFG NKLEEKKESK LKFL 
Sbjct  5    LEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLL  64

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANG GKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  65   FMWNPLSWVMEMAAIMAIALANGQGKPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAA  124

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG WSE+DA+ILVPGDIIS+KLGDI+PADARLLDGDPLKIDQSALT
Sbjct  125  LMAGLAPKTKVLRDGSWSEQDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALT  183



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   214 bits (545),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ V  E +DLE IPIEEVFE L+CTK+GLT+   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEDVKNENIDLERIPIEEVFEQLKCTKEGLTTAEGEKRLQIFGPNKLEEKKESKLLKFLG  65

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAA  125

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+W EE+A+ILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALT
Sbjct  126  LMAGLAPKTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSALT  184



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++A+ILVPGDIIS+KLGDI+PADARLL+GD LK+DQSALT
Sbjct  124  LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDALKVDQSALT  182



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++A+ILVPGDIIS+KLGDI+PADARLL+GD LK+DQSALT
Sbjct  124  LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDALKVDQSALT  182



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            LD +  E VDLE IP+EEVFE L+CT++GL++   + RL IFG NKLEEKKESKFLKFLG
Sbjct  9    LDEIKNEAVDLERIPVEEVFEQLKCTREGLSASEGENRLQIFGPNKLEEKKESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG WSE+DASILVPGDIIS+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGVWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  187



>ref|NP_001048395.2| Os02g0797300 [Oryza sativa Japonica Group]
 dbj|BAF10309.2| Os02g0797300, partial [Oryza sativa Japonica Group]
Length=943

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +3

Query  93   VLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMW  272
            V  ETVDLE IP+EEVF++L+C+K GL++   Q RL+IFG NKLEEK ESK LKFLGFMW
Sbjct  2    VRNETVDLETIPVEEVFQHLKCSKQGLSAAEGQNRLNIFGPNKLEEKTESKLLKFLGFMW  61

Query  273  NPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalma  452
            NPLSWVMEAAAIMAI LANGGG+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAALMA
Sbjct  62   NPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAALMA  121

Query  453  rlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
             LAPK KVLRDG+W E+DASILVPGDIIS+KLGDIIPADARLL+GDPLK+DQ+ALT
Sbjct  122  GLAPKTKVLRDGKWQEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQAALT  177



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ V  ETVDLENIPIEEVF+ L+CT+DGLTS    +RL IFG NKLEEKKESKFLKFLG
Sbjct  7    LEDVRNETVDLENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGANKLEEKKESKFLKFLG  66

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAI LANGGGKPPD+ DF+GI+ LL INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLFINSTISFIEENNAGNAAAA  126

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE++ASILVPGD+ISVKLGDIIPADARLL+GDPLKIDQSALT
Sbjct  127  LMAGLAPKTKVLRDGKWSEQEASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALT  185



>ref|XP_006651704.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=997

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 179/227 (79%), Gaps = 41/227 (18%)
 Frame = +3

Query  63   MAEKPEVLDAVLKETVDL-----------------------------------------E  119
            MAEK   LDAVLKE+VDL                                         E
Sbjct  1    MAEKEGGLDAVLKESVDLVTHASSWDGSCRVQCGFQFRVTVSARDDWSPSCAAAVRRILE  60

Query  120  NIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMWNPLSWVMEa  299
            NIPIEEVF+NLRC++ GLTS+ A+ RL++FG NKLEEK+ESKFLKFLGFMWNPLSWVMEA
Sbjct  61   NIPIEEVFQNLRCSRHGLTSEEAKLRLELFGPNKLEEKEESKFLKFLGFMWNPLSWVMEA  120

Query  300  aaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVL  479
            AAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVL
Sbjct  121  AAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVL  180

Query  480  RDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            RDGRW+EE+A+ILVPGDI+S+KLGDIIPADARLL+GDPLKIDQSALT
Sbjct  181  RDGRWTEEEAAILVPGDIVSIKLGDIIPADARLLEGDPLKIDQSALT  227



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  ETVDLE IP+EEVFE L+CT++GL+S     RL +FG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKILKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAIALANGGG+PPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRWSE+DA++LVPGDIIS+KLGDI+PADARLL+GDPLKIDQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWSEQDAAMLVPGDIISIKLGDIVPADARLLEGDPLKIDQSALT  187



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            ++ +  E++DLE IPIEEVFE L+CTK+GL +   +ERL IFG NKLEEKKESK LKFLG
Sbjct  1    MEDIKNESIDLEKIPIEEVFEKLKCTKEGLRTTEGEERLRIFGPNKLEEKKESKILKFLG  60

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAA+
Sbjct  61   FMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAS  120

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDG+WSE+DA+ILVPGDIIS+KLGDIIPADARL+ GDPLKIDQSALT
Sbjct  121  LMAGLAPKTKVLRDGKWSEQDAAILVPGDIISIKLGDIIPADARLMVGDPLKIDQSALT  179



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E+VDLENIP+EEVFE L+CT++GL+S+   +RL +FG NKLEEKKESK LKFLG
Sbjct  4    LEEIKNESVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++A+ILVPGDIIS+KLGDI+PADARLL+GDPLK+DQSALT
Sbjct  124  LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALT  182



>ref|XP_010687728.1| PREDICTED: ATPase 8, plasma membrane-type-like [Beta vulgaris 
subsp. vulgaris]
Length=954

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLE IP++EVF+ LRC+KDGL+S   ++RL IFG NKLEEKKESKFLKFLG
Sbjct  9    LEQIKNENVDLEQIPVDEVFKQLRCSKDGLSSAEGEKRLKIFGPNKLEEKKESKFLKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAI LANGGG+PPDWQDFVGI+ LL+INSTISFIEENNAGNAAA+
Sbjct  69   FMWNPLSWVMEAAAVMAIVLANGGGRPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAS  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KV+RDG+W EEDASILVPGDIIS+KLGDIIPADARLL+GDPLK+DQ+ALT
Sbjct  129  LMANLAPKTKVIRDGKWGEEDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQAALT  187



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLE IP+EEVFE L+CTK+GLTS+  + RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNEAVDLERIPVEEVFEQLKCTKEGLTSEEGENRLKIFGPNKLEEKKESKILKFLG  68

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LL INSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVALLFINSTISFIEENNAGNAAAA  128

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW+E+DASILVPGDIIS+KLGDIIPADARLL+GDPLK+DQSALT
Sbjct  129  LMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALT  187



>gb|EMT26270.1| Plasma membrane ATPase [Aegilops tauschii]
Length=951

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = +3

Query  84   LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  263
            L+ +  E VDLENIPIEEVFE L+CT+ GLTS    +R++IFG NKLEEKKESK LKFLG
Sbjct  4    LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  264  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  443
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  444  lmarlapkaKVLRDGRWSEEDASILVPGDIISVKLGDIIPADARLLDGDPLKIDQSALT  620
            LMA LAPK KVLRDGRW E++ASILVPGDI+S+KLGDI+PADARLL+GDPLKIDQS LT
Sbjct  124  LMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLT  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950