BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS141F07

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11144.1|  unnamed protein product                                270   3e-80   Coffea canephora [robusta coffee]
ref|XP_007034285.1|  Sucrose phosphate synthase 3F isoform 5            265   2e-79   
gb|EYU31461.1|  hypothetical protein MIMGU_mgv1a000579mg                266   4e-79   Erythranthe guttata [common monkey flower]
ref|XP_007034281.1|  Sucrose phosphate synthase 3F isoform 1            266   5e-79   
ref|XP_007034283.1|  Sucrose phosphate synthase 3F isoform 3            265   6e-79   
ref|XP_007034284.1|  Sucrose phosphate synthase 3F isoform 4            265   6e-79   
ref|XP_007034282.1|  Sucrose phosphate synthase 3F isoform 2            266   7e-79   
ref|XP_002518055.1|  sucrose phosphate syntase, putative                262   1e-77   Ricinus communis
ref|XP_011101558.1|  PREDICTED: probable sucrose-phosphate syntha...    260   7e-77   Sesamum indicum [beniseed]
ref|XP_009618538.1|  PREDICTED: probable sucrose-phosphate syntha...    259   9e-77   Nicotiana tomentosiformis
ref|XP_009777937.1|  PREDICTED: probable sucrose-phosphate syntha...    259   1e-76   Nicotiana sylvestris
gb|KDP39346.1|  hypothetical protein JCGZ_01103                         258   4e-76   Jatropha curcas
gb|KDO39033.1|  hypothetical protein CISIN_1g001492mg                   256   1e-75   Citrus sinensis [apfelsine]
ref|XP_006420963.1|  hypothetical protein CICLE_v10004221mg             256   1e-75   Citrus clementina [clementine]
ref|XP_008222839.1|  PREDICTED: probable sucrose-phosphate syntha...    256   1e-75   Prunus mume [ume]
ref|XP_007225402.1|  hypothetical protein PRUPE_ppa000622mg             256   2e-75   Prunus persica
ref|XP_004296966.1|  PREDICTED: probable sucrose-phosphate syntha...    256   2e-75   Fragaria vesca subsp. vesca
emb|CBI17227.3|  unnamed protein product                                255   3e-75   Vitis vinifera
ref|XP_010264121.1|  PREDICTED: probable sucrose-phosphate syntha...    255   3e-75   Nelumbo nucifera [Indian lotus]
emb|CAN78805.1|  hypothetical protein VITISV_017581                     255   4e-75   Vitis vinifera
ref|XP_010264118.1|  PREDICTED: probable sucrose-phosphate syntha...    255   4e-75   Nelumbo nucifera [Indian lotus]
ref|XP_002271398.1|  PREDICTED: probable sucrose-phosphate syntha...    255   4e-75   Vitis vinifera
ref|XP_008380516.1|  PREDICTED: probable sucrose-phosphate syntha...    255   4e-75   Malus domestica [apple tree]
ref|XP_011041945.1|  PREDICTED: probable sucrose-phosphate syntha...    255   5e-75   Populus euphratica
ref|XP_006494166.1|  PREDICTED: probable sucrose-phosphate syntha...    254   5e-75   Citrus sinensis [apfelsine]
ref|XP_006373074.1|  sucrose-phosphate synthase family protein          250   3e-73   Populus trichocarpa [western balsam poplar]
ref|XP_002298684.1|  hypothetical protein POPTR_0001s32500g             249   5e-73   Populus trichocarpa [western balsam poplar]
ref|NP_001266150.1|  sucrose-phosphate synthase B                       249   6e-73   Solanum lycopersicum
ref|XP_010247961.1|  PREDICTED: probable sucrose-phosphate syntha...    249   6e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010927691.1|  PREDICTED: probable sucrose-phosphate syntha...    249   6e-73   Elaeis guineensis
gb|ABA64521.1|  sucrose-phosphate synthase isoform B                    248   1e-72   Nicotiana tabacum [American tobacco]
ref|XP_011045619.1|  PREDICTED: probable sucrose-phosphate syntha...    248   2e-72   Populus euphratica
sp|O04933.1|SPSA2_CRAPL  RecName: Full=Probable sucrose-phosphate...    248   2e-72   Craterostigma plantagineum
ref|XP_006360944.1|  PREDICTED: probable sucrose-phosphate syntha...    247   3e-72   Solanum tuberosum [potatoes]
gb|AJG44459.1|  sucrose phosphate synthase                              245   1e-71   Lilium davidii var. unicolor
ref|XP_010069011.1|  PREDICTED: probable sucrose-phosphate syntha...    244   3e-71   Eucalyptus grandis [rose gum]
ref|XP_007146334.1|  hypothetical protein PHAVU_006G031700g             244   4e-71   Phaseolus vulgaris [French bean]
ref|XP_008794597.1|  PREDICTED: probable sucrose-phosphate syntha...    243   1e-70   Phoenix dactylifera
gb|KJB72051.1|  hypothetical protein B456_011G155900                    239   8e-70   Gossypium raimondii
gb|KJB72049.1|  hypothetical protein B456_011G155900                    240   9e-70   Gossypium raimondii
gb|KHG20806.1|  putative sucrose-phosphate synthase 3 -like protein     239   1e-69   Gossypium arboreum [tree cotton]
ref|XP_004499982.1|  PREDICTED: probable sucrose-phosphate syntha...    239   2e-69   Cicer arietinum [garbanzo]
ref|XP_008457154.1|  PREDICTED: probable sucrose-phosphate syntha...    239   2e-69   Cucumis melo [Oriental melon]
ref|XP_002892252.1|  ATSPS3F                                            239   2e-69   
ref|XP_004138938.1|  PREDICTED: probable sucrose-phosphate syntha...    239   2e-69   
gb|AES70069.2|  sucrose-phosphate synthase family protein               238   3e-69   Medicago truncatula
gb|ADT64795.4|  sucrose phosphate synthase                              238   4e-69   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009396792.1|  PREDICTED: sucrose-phosphate synthase              238   5e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010522391.1|  PREDICTED: probable sucrose-phosphate syntha...    238   6e-69   Tarenaya hassleriana [spider flower]
ref|XP_010522392.1|  PREDICTED: probable sucrose-phosphate syntha...    238   6e-69   Tarenaya hassleriana [spider flower]
ref|XP_006857652.1|  hypothetical protein AMTR_s00061p00145220          238   8e-69   Amborella trichopoda
ref|NP_171984.2|  sucrose-phosphate synthase                            237   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAF40445.1|AC004809_3  Strong similarity to the sucrose-phosph...    237   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AGE43981.1|  sucrose phosphate synthase 1                            237   1e-68   Cucumis sativus [cucumbers]
ref|XP_006418081.1|  hypothetical protein EUTSA_v10006639mg             234   2e-67   Eutrema salsugineum [saltwater cress]
gb|KHN18081.1|  Putative sucrose-phosphate synthase 3                   233   2e-67   Glycine soja [wild soybean]
ref|XP_003553129.1|  PREDICTED: probable sucrose-phosphate syntha...    233   2e-67   Glycine max [soybeans]
ref|XP_003545147.1|  PREDICTED: probable sucrose-phosphate syntha...    233   3e-67   Glycine max [soybeans]
gb|KHN11970.1|  Putative sucrose-phosphate synthase 3                   233   3e-67   Glycine soja [wild soybean]
ref|XP_006306646.1|  hypothetical protein CARUB_v10008160mg             231   9e-67   Capsella rubella
ref|XP_004166159.1|  PREDICTED: probable sucrose-phosphate syntha...    231   1e-66   
gb|ABW89596.1|  sucrose phosphate synthase B                            227   2e-66   Medicago sativa [alfalfa]
emb|CDX89776.1|  BnaA10g03060D                                          230   3e-66   
ref|XP_010484393.1|  PREDICTED: probable sucrose-phosphate syntha...    229   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010457558.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    229   8e-66   
emb|CDY18270.1|  BnaC05g02930D                                          228   1e-65   Brassica napus [oilseed rape]
ref|XP_003617418.1|  Sucrose-phosphate synthase                         228   1e-65   Medicago truncatula
ref|XP_003532093.1|  PREDICTED: probable sucrose-phosphate syntha...    228   1e-65   Glycine max [soybeans]
gb|KHM99635.1|  Putative sucrose-phosphate synthase 3                   228   2e-65   Glycine soja [wild soybean]
ref|XP_010475162.1|  PREDICTED: probable sucrose-phosphate syntha...    228   2e-65   
ref|XP_003599818.1|  Sucrose-phosphate synthase                         227   5e-65   
ref|XP_009119233.1|  PREDICTED: probable sucrose-phosphate syntha...    225   2e-64   Brassica rapa
ref|XP_010929745.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    223   2e-63   Elaeis guineensis
gb|KFK42840.1|  hypothetical protein AALP_AA1G045800                    222   2e-63   Arabis alpina [alpine rockcress]
gb|AEO46461.1|  sucrose phosphate synthase B                            219   3e-62   Saccharum hybrid cultivar ROC22
ref|NP_001105694.1|  sucrose-phosphate synthase                         215   1e-60   Zea mays [maize]
gb|AAR84220.1|  sucrose-phosphate synthase                              199   1e-60   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006645236.1|  PREDICTED: probable sucrose-phosphate syntha...    211   2e-59   
ref|XP_008674664.1|  PREDICTED: sucrose-phosphate synthase-like         211   3e-59   Zea mays [maize]
ref|XP_008794976.1|  PREDICTED: probable sucrose-phosphate syntha...    211   5e-59   Phoenix dactylifera
ref|XP_004491325.1|  PREDICTED: probable sucrose-phosphate syntha...    210   6e-59   Cicer arietinum [garbanzo]
ref|XP_002458991.1|  hypothetical protein SORBIDRAFT_03g043900          210   8e-59   Sorghum bicolor [broomcorn]
ref|XP_003564935.1|  PREDICTED: sucrose-phosphate synthase              207   5e-58   Brachypodium distachyon [annual false brome]
emb|CDM85683.1|  unnamed protein product                                206   2e-57   Triticum aestivum [Canadian hard winter wheat]
gb|AAC49379.1|  sucrose phosphate synthase                              201   1e-55   Oryza sativa Indica Group [Indian rice]
gb|ADG01610.1|  sucrose phosphate synthase                              196   6e-54   Xerophyta humilis
sp|A2WYE9.2|SPSA1_ORYSI  RecName: Full=Probable sucrose-phosphate...    194   3e-53   Oryza sativa Indica Group [Indian rice]
dbj|BAA08304.1|  sucrose phosphate synthase                             194   5e-53   Oryza sativa Japonica Group [Japonica rice]
emb|CAC81823.1|  sucrose-phosphate synthase                             176   2e-51   Beta vulgaris [beet]
tpg|DAA56138.1|  TPA: putative sucrose-phosphate synthase family ...    189   3e-51   
dbj|BAA19241.1|  Sucrose-Phosphate Synthase                             184   1e-49   Saccharum officinarum [noble cane]
gb|EEE55897.1|  hypothetical protein OsJ_04561                          183   3e-49   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72045.1|  hypothetical protein OsI_04951                          183   4e-49   Oryza sativa Indica Group [Indian rice]
sp|P31928.1|SPSA_SPIOL  RecName: Full=Sucrose-phosphate synthase;...    180   2e-48   Spinacia oleracea
gb|KJB65850.1|  hypothetical protein B456_010G116100                    177   2e-47   Gossypium raimondii
ref|XP_010696531.1|  PREDICTED: sucrose-phosphate synthase              177   4e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007011815.1|  Sucrose phosphate synthase 1F                      177   4e-47   Theobroma cacao [chocolate]
gb|ACN89831.2|  sucrose phosphate synthase B3                           173   5e-47   Medicago sativa [alfalfa]
ref|XP_008443934.1|  PREDICTED: probable sucrose-phosphate syntha...    177   5e-47   Cucumis melo [Oriental melon]
ref|XP_006478341.1|  PREDICTED: probable sucrose-phosphate syntha...    176   5e-47   Citrus sinensis [apfelsine]
gb|KDO42450.1|  hypothetical protein CISIN_1g001705mg                   176   6e-47   Citrus sinensis [apfelsine]
gb|AAC23914.1|  sucrose-phosphate synthase                              172   7e-47   Musa acuminata AAA Group [Cavendish banana]
gb|EPS71734.1|  sucrose-phosphate synthase 1                            176   8e-47   Genlisea aurea
ref|XP_006836877.1|  hypothetical protein AMTR_s00099p00104230          175   1e-46   Amborella trichopoda
gb|ABG67969.1|  putative sucrose phosphate synthase                     172   2e-46   Gossypium hirsutum [American cotton]
ref|XP_002324874.1|  sucrose-phosphate synthase family protein          175   2e-46   
ref|NP_197528.1|  sucrose phosphate synthase 1F                         174   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873988.1|  ATSPS1F                                            174   3e-46   
ref|XP_006450383.1|  hypothetical protein CICLE_v10007312mg             173   6e-46   Citrus clementina [clementine]
ref|XP_006483396.1|  PREDICTED: probable sucrose-phosphate syntha...    173   8e-46   Citrus sinensis [apfelsine]
gb|AHE93347.1|  sucrose phosphate synthase 1                            173   9e-46   Camellia sinensis [black tea]
ref|XP_011036585.1|  PREDICTED: probable sucrose-phosphate syntha...    173   1e-45   Populus euphratica
gb|KJB27353.1|  hypothetical protein B456_004G292800                    172   1e-45   Gossypium raimondii
ref|XP_002515487.1|  sucrose phosphate syntase, putative                172   1e-45   
gb|KJB27352.1|  hypothetical protein B456_004G292800                    172   1e-45   Gossypium raimondii
gb|KHG17450.1|  Solanesyl diphosphate synthase 1                        172   1e-45   Gossypium arboreum [tree cotton]
gb|KHG17451.1|  Solanesyl diphosphate synthase 1                        172   1e-45   Gossypium arboreum [tree cotton]
gb|AFM46031.1|  sucrose phosphate synthase                              172   1e-45   Gossypium hirsutum [American cotton]
gb|AAF06792.1|AF194022_1  sucrose-6-phosphate synthase A                172   1e-45   Nicotiana tabacum [American tobacco]
gb|AAC60545.2|  sucrose-phosphate synthase                              172   2e-45   Spinacia oleracea
ref|XP_008795846.1|  PREDICTED: probable sucrose-phosphate syntha...    172   2e-45   Phoenix dactylifera
ref|XP_004292975.1|  PREDICTED: probable sucrose-phosphate syntha...    171   3e-45   Fragaria vesca subsp. vesca
ref|XP_009774296.1|  PREDICTED: probable sucrose-phosphate synthase     171   4e-45   Nicotiana sylvestris
gb|AGA82513.1|  sucrose phosphate synthase                              170   1e-44   Camellia sinensis [black tea]
ref|XP_002521744.1|  sucrose phosphate syntase, putative                170   1e-44   Ricinus communis
ref|XP_010048168.1|  PREDICTED: probable sucrose-phosphate syntha...    170   1e-44   Eucalyptus grandis [rose gum]
ref|XP_010520567.1|  PREDICTED: sucrose-phosphate synthase 1            170   1e-44   Tarenaya hassleriana [spider flower]
emb|CBI21066.3|  unnamed protein product                                169   1e-44   Vitis vinifera
ref|XP_007019751.1|  Sucrose-phosphate synthase family protein is...    169   1e-44   
ref|XP_002282808.1|  PREDICTED: probable sucrose-phosphate syntha...    169   2e-44   Vitis vinifera
ref|XP_007019750.1|  Sucrose-phosphate synthase family protein is...    169   2e-44   
dbj|BAP47500.1|  sucrose phosphate synthase                             169   2e-44   Gentiana triflora
gb|KDP31602.1|  hypothetical protein JCGZ_14827                         169   2e-44   Jatropha curcas
ref|XP_002319320.2|  sucrose-phosphate synthase family protein          168   4e-44   Populus trichocarpa [western balsam poplar]
gb|KDP33569.1|  hypothetical protein JCGZ_07140                         168   5e-44   Jatropha curcas
emb|CDY45096.1|  BnaA02g04800D                                          167   7e-44   Brassica napus [oilseed rape]
ref|XP_011011070.1|  PREDICTED: probable sucrose-phosphate syntha...    167   8e-44   Populus euphratica
gb|ADG01611.1|  sucrose phosphate synthase                              167   1e-43   Xerophyta humilis
ref|XP_010252403.1|  PREDICTED: probable sucrose-phosphate syntha...    167   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010099850.1|  putative sucrose-phosphate synthase 1              166   2e-43   
ref|XP_010062352.1|  PREDICTED: probable sucrose-phosphate syntha...    165   5e-43   Eucalyptus grandis [rose gum]
gb|AJG44460.1|  sucrose phosphate synthase                              154   5e-43   Lilium davidii var. unicolor
ref|XP_009348252.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    162   9e-43   
gb|AAN11294.1|  sucrose phosphate synthase                              164   1e-42   Oncidium hybrid cultivar
ref|XP_002871456.1|  ATSPS2F                                            164   1e-42   
ref|XP_010241591.1|  PREDICTED: probable sucrose-phosphate syntha...    164   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010456485.1|  PREDICTED: probable sucrose-phosphate syntha...    163   2e-42   Camelina sativa [gold-of-pleasure]
gb|KFK25382.1|  hypothetical protein AALP_AA8G106300                    164   2e-42   Arabis alpina [alpine rockcress]
ref|XP_010419666.1|  PREDICTED: probable sucrose-phosphate syntha...    163   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010491806.1|  PREDICTED: probable sucrose-phosphate syntha...    163   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008381670.1|  PREDICTED: probable sucrose-phosphate syntha...    162   4e-42   
ref|NP_001289997.1|  probable sucrose-phosphate synthase                162   6e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001267857.1|  sucrose-phosphate synthase 1                       162   7e-42   Vitis vinifera
gb|AAG01888.1|  sucrose phosphate synthase                              152   9e-42   Ipomoea batatas [batate]
ref|XP_008348712.1|  PREDICTED: probable sucrose-phosphate syntha...    161   1e-41   
emb|CDX94270.1|  BnaC02g29300D                                          157   1e-41   
gb|AEG78833.1|  sucrose phosphate synthase                              161   1e-41   Dendrobium officinale
ref|XP_009340653.1|  PREDICTED: probable sucrose-phosphate syntha...    161   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_011093228.1|  PREDICTED: probable sucrose-phosphate syntha...    161   1e-41   Sesamum indicum [beniseed]
ref|XP_006582436.1|  PREDICTED: probable sucrose-phosphate syntha...    158   2e-41   
ref|XP_010250236.1|  PREDICTED: probable sucrose-phosphate syntha...    161   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010250237.1|  PREDICTED: probable sucrose-phosphate syntha...    160   2e-41   
ref|XP_009418507.1|  PREDICTED: probable sucrose-phosphate syntha...    160   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418508.1|  PREDICTED: probable sucrose-phosphate syntha...    160   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786458.1|  PREDICTED: probable sucrose-phosphate syntha...    160   3e-41   Phoenix dactylifera
gb|EYU32355.1|  hypothetical protein MIMGU_mgv1a000596mg                160   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_009404836.1|  PREDICTED: probable sucrose-phosphate syntha...    160   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP94624.1|  sucrose phosphate synthase                              159   5e-41   Viscum album subsp. album
ref|XP_008336979.1|  PREDICTED: probable sucrose-phosphate syntha...    159   5e-41   
ref|XP_009358563.1|  PREDICTED: probable sucrose-phosphate syntha...    159   5e-41   Pyrus x bretschneideri [bai li]
emb|CDY41124.1|  BnaA02g23460D                                          159   7e-41   Brassica napus [oilseed rape]
ref|XP_006399612.1|  hypothetical protein EUTSA_v10012643mg             158   7e-41   
ref|XP_009128722.1|  PREDICTED: probable sucrose-phosphate syntha...    159   8e-41   Brassica rapa
emb|CDX78411.1|  BnaA03g03230D                                          159   8e-41   
ref|XP_006659287.1|  PREDICTED: probable sucrose-phosphate syntha...    159   8e-41   Oryza brachyantha
ref|XP_009131196.1|  PREDICTED: probable sucrose-phosphate syntha...    159   9e-41   Brassica rapa
ref|XP_007199693.1|  hypothetical protein PRUPE_ppa000716mg             159   1e-40   
sp|O22060.1|SPSA1_CITUN  RecName: Full=Probable sucrose-phosphate...    159   1e-40   Citrus unshiu [satsuma mandarin]
ref|XP_006397097.1|  hypothetical protein EUTSA_v10028384mg             159   1e-40   Eutrema salsugineum [saltwater cress]
ref|XP_006453095.1|  hypothetical protein CICLE_v10007311mg             159   1e-40   Citrus clementina [clementine]
gb|KDO73470.1|  hypothetical protein CISIN_1g001541mg                   159   1e-40   Citrus sinensis [apfelsine]
ref|XP_002972277.1|  sucrose phosphate synthase                         159   1e-40   
gb|KHG18731.1|  putative sucrose-phosphate synthase 4                   158   1e-40   Gossypium arboreum [tree cotton]
gb|KHG18729.1|  putative sucrose-phosphate synthase 4                   159   1e-40   Gossypium arboreum [tree cotton]
emb|CBI17025.3|  unnamed protein product                                158   1e-40   Vitis vinifera
ref|XP_011020206.1|  PREDICTED: probable sucrose-phosphate syntha...    158   1e-40   Populus euphratica
ref|XP_006286964.1|  hypothetical protein CARUB_v10000113mg             158   1e-40   Capsella rubella
ref|XP_003526395.1|  PREDICTED: probable sucrose-phosphate syntha...    158   1e-40   Glycine max [soybeans]
dbj|BAM37540.1|  sucrose phosphate synthase                             158   1e-40   Mangifera indica
dbj|BAM68535.1|  sucrose phosphate synthase                             158   1e-40   Mangifera indica
dbj|BAM68530.1|  sucrose phosphate synthase                             157   3e-40   Mangifera indica
ref|XP_008385228.1|  PREDICTED: probable sucrose-phosphate syntha...    157   3e-40   
dbj|BAM68537.1|  sucrose phosphate synthase                             157   3e-40   Mangifera indica
ref|XP_008237831.1|  PREDICTED: probable sucrose-phosphate syntha...    157   3e-40   Prunus mume [ume]
ref|XP_008242829.1|  PREDICTED: probable sucrose-phosphate syntha...    157   4e-40   Prunus mume [ume]
gb|EYU18237.1|  hypothetical protein MIMGU_mgv1a000621mg                157   4e-40   Erythranthe guttata [common monkey flower]
ref|XP_007204296.1|  hypothetical protein PRUPE_ppa000639mg             157   4e-40   Prunus persica
gb|ABV32551.1|  sucrose phosphate synthase protein 1                    157   4e-40   Prunus persica
ref|XP_011078416.1|  PREDICTED: probable sucrose-phosphate syntha...    157   4e-40   Sesamum indicum [beniseed]
ref|XP_011078414.1|  PREDICTED: probable sucrose-phosphate syntha...    157   4e-40   
gb|AAL34531.1|AF439861_1  sucrose-phosphate synthase                    157   5e-40   Ipomoea batatas [batate]
gb|AFW61932.1|  putative sucrose-phosphate synthase family protein      147   5e-40   
gb|ABK29437.1|  sucrose phosphate synthase                              157   5e-40   Coffea canephora [robusta coffee]
emb|CDP10465.1|  unnamed protein product                                156   5e-40   Coffea canephora [robusta coffee]
gb|KJB59576.1|  hypothetical protein B456_009G262100                    156   6e-40   Gossypium raimondii
emb|CDX70382.1|  BnaC03g04660D                                          156   8e-40   
gb|KJB59577.1|  hypothetical protein B456_009G262100                    156   8e-40   Gossypium raimondii
ref|XP_009363963.1|  PREDICTED: probable sucrose-phosphate syntha...    156   9e-40   Pyrus x bretschneideri [bai li]
ref|XP_006381105.1|  sucrose-phosphate synthase family protein          155   1e-39   
ref|XP_006852870.1|  hypothetical protein AMTR_s00033p00204130          155   1e-39   
gb|KDP30238.1|  hypothetical protein JCGZ_17020                         155   1e-39   Jatropha curcas
ref|XP_011084090.1|  PREDICTED: probable sucrose-phosphate syntha...    155   1e-39   Sesamum indicum [beniseed]
emb|CDX80498.1|  BnaC07g29460D                                          155   1e-39   
emb|CDX88168.1|  BnaA06g27590D                                          155   2e-39   
gb|EMT02687.1|  Sucrose-phosphate synthase 1                            155   2e-39   
ref|XP_010928318.1|  PREDICTED: probable sucrose-phosphate syntha...    155   2e-39   Elaeis guineensis
ref|XP_002969539.1|  sucrose phosphate synthase                         155   2e-39   
dbj|BAD94390.1|  sucrose-phosphate synthase - like protein              155   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AFP23360.1|  sucrose phosphate synthase                              155   2e-39   Litchi chinensis [litchi]
gb|ABI17900.1|  sucrose phosphate synthase                              155   2e-39   Coffea canephora [robusta coffee]
emb|CAB39764.1|  sucrose-phosphate synthase-like protein                155   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192750.2|  probable sucrose-phosphate synthase 4                 155   2e-39   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43701.1|  sucrose-phosphate synthase - like protein              155   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150653.1|  PREDICTED: probable sucrose-phosphate syntha...    155   2e-39   
ref|XP_009151050.1|  PREDICTED: probable sucrose-phosphate syntha...    155   2e-39   Brassica rapa
ref|XP_004167243.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    154   2e-39   
ref|XP_009395490.1|  PREDICTED: probable sucrose-phosphate syntha...    154   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437512.1|  PREDICTED: probable sucrose-phosphate syntha...    154   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010455412.1|  PREDICTED: probable sucrose-phosphate syntha...    154   3e-39   Camelina sativa [gold-of-pleasure]
emb|CDP11522.1|  unnamed protein product                                154   3e-39   Coffea canephora [robusta coffee]
ref|XP_004250761.1|  PREDICTED: probable sucrose-phosphate syntha...    154   3e-39   Solanum lycopersicum
ref|XP_006352069.1|  PREDICTED: probable sucrose-phosphate syntha...    154   3e-39   Solanum tuberosum [potatoes]
ref|XP_010555013.1|  PREDICTED: probable sucrose-phosphate syntha...    154   3e-39   Tarenaya hassleriana [spider flower]
sp|O04932.1|SPSA1_CRAPL  RecName: Full=Probable sucrose-phosphate...    154   4e-39   Craterostigma plantagineum
ref|XP_002872492.1|  ATSPS4F                                            154   5e-39   
ref|XP_007148633.1|  hypothetical protein PHAVU_005G002600g             154   5e-39   Phaseolus vulgaris [French bean]
ref|XP_006286963.1|  hypothetical protein CARUB_v10000112mg             154   5e-39   
ref|XP_003573681.1|  PREDICTED: probable sucrose-phosphate syntha...    154   5e-39   Brachypodium distachyon [annual false brome]
ref|XP_010057603.1|  PREDICTED: probable sucrose-phosphate syntha...    154   5e-39   Eucalyptus grandis [rose gum]
gb|AAC39434.1|  sucrose-phosphate synthase                              150   8e-39   Actinidia deliciosa [Chinese gooseberry]
ref|NP_001275243.1|  probable sucrose-phosphate synthase                153   8e-39   Solanum tuberosum [potatoes]
ref|XP_010913331.1|  PREDICTED: probable sucrose-phosphate syntha...    153   9e-39   Elaeis guineensis
emb|CBI25540.3|  unnamed protein product                                153   9e-39   Vitis vinifera
ref|XP_002265473.1|  PREDICTED: probable sucrose-phosphate syntha...    153   1e-38   Vitis vinifera
ref|XP_006400595.1|  hypothetical protein EUTSA_v10012540mg             153   1e-38   Eutrema salsugineum [saltwater cress]
gb|ABX59534.1|  sucrose phosphate synthase II                           153   1e-38   Saccharum officinarum [noble cane]
gb|EPS69735.1|  hypothetical protein M569_05029                         152   1e-38   Genlisea aurea
gb|AHH86105.1|  sucrose-phosphate synthase                              152   1e-38   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_011017846.1|  PREDICTED: probable sucrose-phosphate syntha...    152   1e-38   Populus euphratica
ref|XP_010454335.1|  PREDICTED: sucrose-phosphate synthase 1            152   1e-38   Camelina sativa [gold-of-pleasure]
gb|KFK26237.1|  hypothetical protein AALP_AA8G221000                    152   1e-38   Arabis alpina [alpine rockcress]
ref|XP_010493137.1|  PREDICTED: sucrose-phosphate synthase 1-like       152   1e-38   Camelina sativa [gold-of-pleasure]
gb|KJB83218.1|  hypothetical protein B456_013G235900                    152   2e-38   Gossypium raimondii
ref|XP_010420869.1|  PREDICTED: sucrose-phosphate synthase 1-like       152   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_004290259.1|  PREDICTED: probable sucrose-phosphate syntha...    152   2e-38   Fragaria vesca subsp. vesca
emb|CDM80277.1|  unnamed protein product                                152   2e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004287272.1|  PREDICTED: probable sucrose-phosphate syntha...    152   3e-38   Fragaria vesca subsp. vesca
ref|XP_010421935.1|  PREDICTED: probable sucrose-phosphate syntha...    152   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006389442.1|  hypothetical protein POPTR_0025s00740g             152   3e-38   
ref|XP_009126436.1|  PREDICTED: sucrose-phosphate synthase 1-like       151   4e-38   Brassica rapa
ref|XP_010910717.1|  PREDICTED: probable sucrose-phosphate syntha...    147   4e-38   Elaeis guineensis
sp|Q43845.1|SPSA_SOLTU  RecName: Full=Probable sucrose-phosphate ...    151   5e-38   Solanum tuberosum [potatoes]
gb|ADL70859.1|  sucrose phosphate synthase A                            151   5e-38   Saccharum hybrid cultivar ROC22
gb|AGE43982.1|  sucrose phosphate synthase 2                            150   6e-38   Cucumis sativus [cucumbers]
ref|XP_008788819.1|  PREDICTED: probable sucrose-phosphate syntha...    150   6e-38   
gb|ABF47344.1|  sucrose phosphate synthase                              150   8e-38   Cucumis melo [Oriental melon]
ref|XP_002441522.1|  hypothetical protein SORBIDRAFT_09g028570          150   8e-38   Sorghum bicolor [broomcorn]
gb|ABC96184.1|  sucrose phosphate synthase                              150   8e-38   Cucumis melo [Oriental melon]
gb|AFW61934.1|  putative sucrose-phosphate synthase family protein      147   9e-38   
ref|NP_001170108.1|  putative sucrose-phosphate synthase family p...    147   9e-38   
gb|AAL86360.1|  sucrose phosphate synthase                              150   1e-37   Actinidia chinensis
ref|XP_008219524.1|  PREDICTED: probable sucrose-phosphate syntha...    150   1e-37   Prunus mume [ume]
ref|XP_007013574.1|  Sucrose phosphate synthase 1F                      150   1e-37   
ref|XP_009120820.1|  PREDICTED: sucrose-phosphate synthase 1            149   2e-37   Brassica rapa
dbj|BAI39704.1|  putative sucrose-phosphate synthase                    149   2e-37   Oryza sativa Indica Group [Indian rice]
emb|CDX92473.1|  BnaA10g15120D                                          149   2e-37   
ref|XP_002449293.1|  hypothetical protein SORBIDRAFT_05g007310          149   2e-37   
ref|NP_001233920.1|  sucrose-phosphate synthase                         149   2e-37   
ref|NP_001061495.1|  Os08g0301500                                       149   2e-37   
gb|AAQ56529.1|  putative sucrosephosphate synthase                      149   2e-37   
ref|XP_007225404.1|  hypothetical protein PRUPE_ppa000636mg             149   3e-37   
gb|ABV32550.1|  sucrose phosphate synthase protein 2                    149   3e-37   
ref|NP_001234839.1|  sucrose phosphate synthase                         149   3e-37   
gb|EYU22701.1|  hypothetical protein MIMGU_mgv1a000604mg                148   4e-37   
dbj|BAJ90127.1|  predicted protein                                      148   4e-37   
gb|ACI23258.1|  sucrose phosphate synthase                              136   5e-37   
gb|EMS59564.1|  hypothetical protein TRIUR3_20316                       139   6e-37   
ref|XP_009607707.1|  PREDICTED: probable sucrose-phosphate syntha...    147   9e-37   
ref|XP_008678023.1|  PREDICTED: probable sucrose-phosphate syntha...    147   1e-36   
ref|XP_008677664.1|  PREDICTED: uncharacterized protein LOC100384...    147   1e-36   
emb|CDY35815.1|  BnaC09g37470D                                          147   1e-36   
dbj|BAJ88991.1|  predicted protein                                      144   1e-36   
ref|NP_001281029.1|  probable sucrose-phosphate synthase 1              146   2e-36   
ref|XP_009355773.1|  PREDICTED: probable sucrose-phosphate syntha...    146   2e-36   
ref|XP_009346170.1|  PREDICTED: probable sucrose-phosphate syntha...    146   3e-36   
ref|XP_007155064.1|  hypothetical protein PHAVU_003G170100g             146   3e-36   
ref|XP_009802041.1|  PREDICTED: probable sucrose-phosphate syntha...    146   3e-36   
gb|ABA64520.1|  sucrose-phosphate synthase isoform C                    146   3e-36   
ref|XP_009613348.1|  PREDICTED: probable sucrose-phosphate syntha...    146   3e-36   
dbj|BAG30918.1|  sucrose phosphate synthase                             145   3e-36   
ref|XP_006345631.1|  PREDICTED: probable sucrose-phosphate syntha...    145   3e-36   
ref|NP_001266250.1|  sucrose-phosphate synthase A2                      145   4e-36   
ref|XP_004971065.1|  PREDICTED: probable sucrose-phosphate syntha...    135   7e-36   
gb|KHG14876.1|  Sucrose-phosphate synthase                              139   7e-36   
gb|AAK09427.2|AF322116_1  sucrose-phosphate synthase                    144   1e-35   
ref|XP_006646988.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    144   1e-35   
ref|XP_003609431.1|  Sucrose-phosphate synthase                         144   1e-35   
ref|XP_008441196.1|  PREDICTED: probable sucrose-phosphate syntha...    144   1e-35   
gb|AAQ14552.1|AF310160_1  sucrose-phosphate synthase                    144   1e-35   
ref|XP_009786823.1|  PREDICTED: probable sucrose-phosphate syntha...    144   2e-35   
ref|XP_004508449.1|  PREDICTED: probable sucrose-phosphate syntha...    143   2e-35   
gb|AAC24872.3|  sucrose-phosphate synthase                              143   2e-35   
ref|XP_003549735.1|  PREDICTED: probable sucrose-phosphate syntha...    143   2e-35   
gb|KHN15044.1|  Putative sucrose-phosphate synthase                     143   2e-35   
sp|Q43876.1|SPSA_VICFA  RecName: Full=Probable sucrose-phosphate ...    143   3e-35   
ref|XP_001764226.1|  predicted protein                                  143   3e-35   
gb|AAZ85400.1|  sucrose-phosphate synthase 2                            143   3e-35   
ref|XP_004973187.1|  PREDICTED: probable sucrose-phosphate syntha...    142   6e-35   
ref|XP_006389443.1|  sucrose-phosphate synthase family protein          142   8e-35   
gb|EEC67927.1|  hypothetical protein OsI_35637                          142   8e-35   
ref|XP_004138659.1|  PREDICTED: probable sucrose-phosphate syntha...    142   9e-35   
ref|XP_002451675.1|  hypothetical protein SORBIDRAFT_04g005720          141   9e-35   
gb|AFW70480.1|  putative sucrose-phosphate synthase family protein      141   9e-35   
gb|ACX94229.1|  sucrose phosphate synthase                              141   9e-35   
gb|ABX80100.1|  sucrose phosphate synthase III                          141   1e-34   
gb|AEN84000.1|  sucrose-phosphate synthase                              141   1e-34   
gb|ADM63847.1|  sucrose phosphate synthase                              141   1e-34   
gb|AAR16190.1|  sucrose-phosphate synthase                              141   1e-34   
dbj|BAE80113.1|  sucrose phosphate synthase                             141   1e-34   
ref|XP_003542649.1|  PREDICTED: probable sucrose-phosphate synthase     140   2e-34   
ref|XP_008645337.1|  PREDICTED: probable sucrose-phosphate syntha...    140   2e-34   
ref|XP_010110858.1|  hypothetical protein L484_005397                   130   2e-34   
ref|XP_010324849.1|  PREDICTED: sucrose-phosphate synthase A2 iso...    140   3e-34   
ref|XP_004951663.1|  PREDICTED: probable sucrose-phosphate syntha...    139   4e-34   
ref|NP_196672.3|  sucrose phosphate synthase 2F                         140   4e-34   
ref|XP_001770952.1|  predicted protein                                  140   4e-34   
gb|ABX80099.1|  sucrose phosphate synthase III                          139   5e-34   
gb|ABV90637.1|  sucrose-phosphate synthase                              139   5e-34   
ref|XP_003570834.1|  PREDICTED: probable sucrose-phosphate syntha...    139   9e-34   
dbj|BAJ97760.1|  predicted protein                                      137   2e-33   
ref|NP_001046108.2|  Os02g0184400                                       137   2e-33   
gb|EMT16959.1|  Sucrose-phosphate synthase                              137   2e-33   
sp|B7F7B9.2|SPSA2_ORYSJ  RecName: Full=Probable sucrose-phosphate...    137   3e-33   
gb|AAQ10452.1|  sucrose-phosphate synthase 9                            137   3e-33   
ref|XP_010111723.1|  hypothetical protein L484_006594                   126   4e-33   
ref|XP_010112056.1|  putative sucrose-phosphate synthase 4              137   5e-33   
gb|EEC72629.1|  hypothetical protein OsI_06131                          135   8e-33   
gb|EAZ06480.1|  hypothetical protein OsI_28718                          136   8e-33   
gb|EPS59759.1|  sucrose-phosphate synthase 1                            133   1e-32   
ref|XP_003563303.1|  PREDICTED: probable sucrose-phosphate syntha...    134   4e-32   
ref|XP_011095234.1|  PREDICTED: probable sucrose-phosphate syntha...    133   7e-32   
ref|XP_011095228.1|  PREDICTED: probable sucrose-phosphate syntha...    133   7e-32   
gb|EMS63629.1|  Sucrose-phosphate synthase 1                            133   8e-32   
ref|XP_003577676.1|  PREDICTED: probable sucrose-phosphate syntha...    133   9e-32   
dbj|BAK00548.1|  predicted protein                                      130   5e-31   
dbj|BAA19242.1|  sucrose-phosphate synthase                             129   2e-30   
ref|XP_008648202.1|  PREDICTED: uncharacterized protein LOC100384...    129   2e-30   
gb|EMT03664.1|  Sucrose-phosphate synthase 1                            129   2e-30   
ref|XP_008648203.1|  PREDICTED: uncharacterized protein LOC100384...    129   2e-30   
gb|AFW61931.1|  putative sucrose-phosphate synthase family protein      118   5e-30   
gb|KCW74793.1|  hypothetical protein EUGRSUZ_E03528                     126   2e-29   
gb|AEA03003.1|  sucrose phosphate synthase B3                           120   3e-29   
sp|Q67WN8.1|SPSA3_ORYSJ  RecName: Full=Probable sucrose-phosphate...    124   1e-28   
ref|XP_004173723.1|  PREDICTED: probable sucrose-phosphate syntha...    114   2e-28   
ref|XP_004965756.1|  PREDICTED: probable sucrose-phosphate syntha...    122   4e-28   
gb|AGT16394.1|  sucrose-phosphate synthase                              121   8e-28   
ref|XP_002531942.1|  sucrose phosphate syntase, putative                120   2e-27   
gb|AGT17176.1|  sucrose phosphate synthase III                          119   4e-27   
gb|AGT17001.1|  sucrose-phosphate synthase                              119   7e-27   
ref|XP_002438738.1|  hypothetical protein SORBIDRAFT_10g025240          118   1e-26   
gb|EAZ42258.1|  hypothetical protein OsJ_26822                          117   2e-26   
gb|AAX95197.1|  Similar to sucrose phosphate synthase                   111   2e-26   
gb|EEE66101.1|  hypothetical protein OsJ_22133                          116   5e-26   
gb|AGK07273.1|  sucrose phosphate synthase III                          106   9e-26   
gb|AGT15920.1|  sucrose-phosphate synthase                              114   2e-25   
gb|AFW87299.1|  putative sucrose-phosphate synthase family protein      113   6e-25   
gb|KHN47105.1|  Putative sucrose-phosphate synthase                     112   1e-24   
ref|NP_001045210.1|  Os01g0919400                                       103   2e-24   
gb|AGT16224.1|  sucrose phosphate synthase                              111   2e-24   
ref|XP_006663318.1|  PREDICTED: probable sucrose-phosphate syntha...    109   1e-23   
ref|XP_004965757.1|  PREDICTED: probable sucrose-phosphate syntha...    107   8e-23   
ref|XP_008380517.1|  PREDICTED: probable sucrose-phosphate syntha...  93.6    1e-22   
gb|EEE51891.1|  hypothetical protein OsJ_33470                          100   2e-22   
ref|XP_006441780.1|  hypothetical protein CICLE_v100186551mg            103   1e-21   
gb|EMT08378.1|  hypothetical protein F775_11023                       98.6    5e-20   
ref|XP_002964041.1|  sucrose phosphate synthase                       97.8    1e-19   
gb|KHN20554.1|  Putative sucrose-phosphate synthase 4                 95.9    8e-19   
gb|AAQ15106.1|AF347064_1  sucrose-phosphate synthase 2                94.7    1e-18   
gb|EMS67679.1|  Sucrose-phosphate synthase                            94.0    3e-18   
emb|CAD44259.1|  putative sucrose-phosphate synthase                  91.3    3e-18   
gb|KHG18730.1|  putative sucrose-phosphate synthase 4                 91.7    2e-17   
emb|CAN84060.1|  hypothetical protein VITISV_036457                   80.9    6e-16   
gb|EMT21205.1|  hypothetical protein F775_44071                       80.1    9e-16   
gb|ADD92152.1|  sucrose phosphate synthase                            81.6    2e-15   
ref|XP_006441779.1|  hypothetical protein CICLE_v100186552mg          78.2    2e-15   
emb|CAD44260.1|  putative sucrose-phosphate synthase                  77.8    2e-13   
gb|KJB72052.1|  hypothetical protein B456_011G155900                  78.2    5e-13   
emb|CAD44257.1|  putative sucrose-phosphate synthase                  74.7    2e-12   
gb|EMT16825.1|  Sucrose-phosphate synthase                            75.5    3e-12   
ref|XP_010324850.1|  PREDICTED: sucrose-phosphate synthase A2 iso...  73.6    1e-11   
tpg|DAA55891.1|  TPA: putative calmodulin-binding family protein      71.2    2e-11   
gb|EMS46175.1|  hypothetical protein TRIUR3_32151                     67.8    5e-11   
ref|XP_008466432.1|  PREDICTED: probable sucrose-phosphate syntha...  66.2    6e-11   
ref|XP_008466433.1|  PREDICTED: probable sucrose-phosphate syntha...  65.9    8e-11   
ref|XP_009366869.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...  70.5    1e-10   
emb|CAD44258.1|  putative sucrose-phosphate synthase                  68.9    2e-10   
ref|NP_001142854.1|  uncharacterized protein LOC100275248             65.1    3e-10   
ref|XP_004971066.1|  PREDICTED: sucrose-phosphate synthase-like       69.3    3e-10   
gb|AFW87300.1|  putative sucrose-phosphate synthase family protein    64.3    6e-10   
ref|XP_006656289.1|  PREDICTED: probable sucrose-phosphate syntha...  68.2    7e-10   
gb|EMS48701.1|  Sucrose-phosphate synthase 1                          66.2    3e-09   
gb|AFW55926.1|  hypothetical protein ZEAMMB73_963178                  62.4    6e-08   
gb|KGN61432.1|  hypothetical protein Csa_2G121970                     60.1    3e-07   
ref|XP_010650291.1|  PREDICTED: probable sucrose-phosphate syntha...  57.4    2e-06   
gb|ACH72047.1|  sucrose phosphate synthase                            55.1    3e-06   
ref|XP_008664270.1|  PREDICTED: uncharacterized protein LOC103642882  55.8    4e-06   
gb|AFD61543.1|  sucrose phosphate synthase                            52.0    3e-05   
gb|AFW62326.1|  hypothetical protein ZEAMMB73_604560                  53.1    4e-05   
ref|XP_010324852.1|  PREDICTED: sucrose-phosphate synthase A2 iso...  53.5    5e-05   
ref|XP_009600365.1|  PREDICTED: probable sucrose-phosphate synthase   50.1    6e-04   



>emb|CDP11144.1| unnamed protein product [Coffea canephora]
Length=1065

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AI+ E+K     + GE+ HFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAID-ENKAISSVNLGERSHFNPTKYFVEEVVTGVDETDLH  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLELE +QRLA RRWEREQGRKDVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLELEDIQRLAKRRWEREQGRKDVTE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD LGE +SL+SPRKKFQRN SNLE
Sbjct  120  DMSEDLSEGEKGDVLGEAVSLDSPRKKFQRNFSNLE  155



>ref|XP_007034285.1| Sucrose phosphate synthase 3F isoform 5 [Theobroma cacao]
 gb|EOY05211.1| Sucrose phosphate synthase 3F isoform 5 [Theobroma cacao]
Length=823

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SEDLSEGEKGDALGE +  E+PRK FQRN SNLE
Sbjct  119  DLSEDLSEGEKGDALGELVQAETPRKTFQRNLSNLE  154



>gb|EYU31461.1| hypothetical protein MIMGU_mgv1a000579mg [Erythranthe guttata]
Length=1061

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGASAI+ E+K AV     ++GHFNPTKYFVEEVV+GVDE+DLH
Sbjct  1    MAGNEWINGYLEAILDSGASAID-ENKAAVAVRVKDRGHFNPTKYFVEEVVTGVDESDLH  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQRL  RRWEREQGRKDVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRLTDRRWEREQGRKDVTE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD LGE ++L+SPRKKFQRN SNLE
Sbjct  120  DMSEDLSEGEKGDVLGEAVTLDSPRKKFQRNFSNLE  155



>ref|XP_007034281.1| Sucrose phosphate synthase 3F isoform 1 [Theobroma cacao]
 gb|EOY05207.1| Sucrose phosphate synthase 3F isoform 1 [Theobroma cacao]
Length=1063

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SEDLSEGEKGDALGE +  E+PRK FQRN SNLE
Sbjct  119  DLSEDLSEGEKGDALGELVQAETPRKTFQRNLSNLE  154



>ref|XP_007034283.1| Sucrose phosphate synthase 3F isoform 3 [Theobroma cacao]
 gb|EOY05209.1| Sucrose phosphate synthase 3F isoform 3 [Theobroma cacao]
Length=991

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SEDLSEGEKGDALGE +  E+PRK FQRN SNLE
Sbjct  119  DLSEDLSEGEKGDALGELVQAETPRKTFQRNLSNLE  154



>ref|XP_007034284.1| Sucrose phosphate synthase 3F isoform 4 [Theobroma cacao]
 gb|EOY05210.1| Sucrose phosphate synthase 3F isoform 4 [Theobroma cacao]
Length=991

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SEDLSEGEKGDALGE +  E+PRK FQRN SNLE
Sbjct  119  DLSEDLSEGEKGDALGELVQAETPRKTFQRNLSNLE  154



>ref|XP_007034282.1| Sucrose phosphate synthase 3F isoform 2 [Theobroma cacao]
 gb|EOY05208.1| Sucrose phosphate synthase 3F isoform 2 [Theobroma cacao]
Length=1049

 Score =   266 bits (679),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SEDLSEGEKGDALGE +  E+PRK FQRN SNLE
Sbjct  119  DLSEDLSEGEKGDALGELVQAETPRKTFQRNLSNLE  154



>ref|XP_002518055.1| sucrose phosphate syntase, putative [Ricinus communis]
 gb|EEF44188.1| sucrose phosphate syntase, putative [Ricinus communis]
Length=1064

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA AIE E KP       ++GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAGAIE-EQKPVQPVDLKDRGHFNPTKYFVEEVVTGVDETDLH  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLEL  LQRLA+RRWEREQGR+D TE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLELGELQRLANRRWEREQGRRDATE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE +  E+PRKKFQRN SNLE
Sbjct  120  DMSEDLSEGEKGDGVGELVQSETPRKKFQRNYSNLE  155



>ref|XP_011101558.1| PREDICTED: probable sucrose-phosphate synthase 2 [Sesamum indicum]
Length=1057

 Score =   260 bits (664),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MA NEWINGYLEAILDSGASAIE       +N R ++GHFNPTKYFVEEVV+GVDE+DLH
Sbjct  1    MAANEWINGYLEAILDSGASAIEENKAGPGVNVR-DRGHFNPTKYFVEEVVTGVDESDLH  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN+ ERSSRLENMCWRIWHL RKKKQLE E LQRLA+RRWEREQGRKDVTE
Sbjct  60   RTWIKVVATRNSRERSSRLENMCWRIWHLARKKKQLEWEDLQRLANRRWEREQGRKDVTE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKG+   E +SL+SPRKKFQRNSSNLE
Sbjct  120  DMSEDLSEGEKGEVSAEAVSLDSPRKKFQRNSSNLE  155



>ref|XP_009618538.1| PREDICTED: probable sucrose-phosphate synthase 2 [Nicotiana tomentosiformis]
Length=1064

 Score =   259 bits (663),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGE-QGHFNPTKYFVEEVVSGVDETDL  335
            MAGNEWINGYLEAIL SGASAIE    P+  +H     GHFNPTKYFVEEVV+GVDETDL
Sbjct  1    MAGNEWINGYLEAILSSGASAIEDNKTPSSTSHVNNLTGHFNPTKYFVEEVVTGVDETDL  60

Query  336  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            HRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR+A+RR EREQGRKDVT
Sbjct  61   HRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRIANRRLEREQGRKDVT  120

Query  516  EDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            EDMSEDLSEGEKGD LGET +++SPRK+FQRN SNLE
Sbjct  121  EDMSEDLSEGEKGDVLGETPTIDSPRKRFQRNFSNLE  157



>ref|XP_009777937.1| PREDICTED: probable sucrose-phosphate synthase 2 [Nicotiana sylvestris]
Length=1064

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGE-QGHFNPTKYFVEEVVSGVDETDL  335
            MAGNEWINGYLEAIL SGASAIE    P+  +H     GHFNPTKYFVEEVV+GVDETDL
Sbjct  1    MAGNEWINGYLEAILSSGASAIEDNKTPSSTSHVNNLTGHFNPTKYFVEEVVTGVDETDL  60

Query  336  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            HRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR+A+RR EREQGRKDVT
Sbjct  61   HRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRIANRRLEREQGRKDVT  120

Query  516  EDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            EDMSEDLSEGEKGD LGET +++SPRK+FQRN SNLE
Sbjct  121  EDMSEDLSEGEKGDVLGETPTIDSPRKRFQRNFSNLE  157



>gb|KDP39346.1| hypothetical protein JCGZ_01103 [Jatropha curcas]
Length=1065

 Score =   258 bits (659),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 135/156 (87%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA AIE E KP    + GEQGHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAGAIE-EQKPTPAVNPGEQGHFNPTKYFVEEVVTGVDETDLH  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE EG QRLA RR EREQGR+DVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEGQQRLASRRLEREQGRRDVTE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD + E L  E+  KKFQRN SNLE
Sbjct  120  DMSEDLSEGEKGDIVAELLPHETTVKKFQRNFSNLE  155



>gb|KDO39033.1| hypothetical protein CISIN_1g001492mg [Citrus sinensis]
Length=1067

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGASAIE + K A +N   ++GHFNPTKYFVEEVV+ VDETDL+
Sbjct  1    MAGNEWINGYLEAILDSGASAIEEQQKQAPVN-LADRGHFNPTKYFVEEVVTSVDETDLY  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RR EREQGR+DVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRLEREQGRRDVTE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE  + ++PRKKFQRN SNLE
Sbjct  120  DMSEDLSEGEKGDGVGEIQTPDTPRKKFQRNFSNLE  155



>ref|XP_006420963.1| hypothetical protein CICLE_v10004221mg [Citrus clementina]
 gb|ESR34203.1| hypothetical protein CICLE_v10004221mg [Citrus clementina]
Length=1067

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGASAIE + K A +N   ++GHFNPTKYFVEEVV+ VDETDL+
Sbjct  1    MAGNEWINGYLEAILDSGASAIEEQQKQAPVN-LADRGHFNPTKYFVEEVVTSVDETDLY  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RR EREQGR+DVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRLEREQGRRDVTE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE  + ++PRKKFQRN SNLE
Sbjct  120  DMSEDLSEGEKGDGVGEIQTPDTPRKKFQRNFSNLE  155



>ref|XP_008222839.1| PREDICTED: probable sucrose-phosphate synthase 3 [Prunus mume]
Length=1066

 Score =   256 bits (655),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSG+SAIE E KP   N R ++G+FNPTKYFVEEVV+GVDE+DL+
Sbjct  1    MAGNEWINGYLEAILDSGSSAIE-EQKPVPENLR-DRGNFNPTKYFVEEVVTGVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ER SRLENMCWRIWHLTRKKKQLE+E  QRLA+RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERGSRLENMCWRIWHLTRKKKQLEIEEHQRLANRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD LGE L  ++PRKKFQRN SNLE
Sbjct  119  DMSEDLSEGEKGDGLGEMLPSDTPRKKFQRNISNLE  154



>ref|XP_007225402.1| hypothetical protein PRUPE_ppa000622mg [Prunus persica]
 gb|EMJ26601.1| hypothetical protein PRUPE_ppa000622mg [Prunus persica]
Length=1066

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSG+SAIE E KP   N R ++G+FNPTKYFVEEVV+GVDE+DL+
Sbjct  1    MAGNEWINGYLEAILDSGSSAIE-EQKPVPENLR-DRGNFNPTKYFVEEVVTGVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ER SRLENMCWRIWHLTRKKKQLE+E  QRLA+RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERGSRLENMCWRIWHLTRKKKQLEIEEHQRLANRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD LGE L  ++PRKKFQRN SNLE
Sbjct  119  DMSEDLSEGEKGDGLGEMLPSDTPRKKFQRNISNLE  154



>ref|XP_004296966.1| PREDICTED: probable sucrose-phosphate synthase 3 [Fragaria vesca 
subsp. vesca]
Length=1066

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILD+GA+AIE E KP  +N   E GHFNPTKYFVEEVV+GVDE+DL+
Sbjct  1    MAGNEWINGYLEAILDTGATAIE-EQKPTPVN-LSEGGHFNPTKYFVEEVVTGVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQR A+RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRSANRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD LGE L  E+PR+KFQR  SNLE
Sbjct  119  DMSEDLSEGEKGDILGEMLQCETPRRKFQRMVSNLE  154



>emb|CBI17227.3| unnamed protein product [Vitis vinifera]
Length=1046

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL SGASAIE +SK   I  R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILVSGASAIE-DSKATPIALR-EGGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE+E  QRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEVEDQQRLAVRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKG+ +GE L  E+P+KKFQRNSSNLE
Sbjct  119  DMSEDLSEGEKGETVGELLPGETPKKKFQRNSSNLE  154



>ref|XP_010264121.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X2 [Nelumbo 
nucifera]
Length=978

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA +IE + KP  ++ R E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAGSIE-DQKPISVDLR-ERGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWI+V ATRNT ERSSRLENMCWRIWHL RKKKQLE E  QRLA+RRWE EQGR DVTE
Sbjct  59   RTWIQVAATRNTRERSSRLENMCWRIWHLARKKKQLEWEDFQRLANRRWEWEQGRMDVTE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE +  E+P+KKFQRNSSN+E
Sbjct  119  DMSEDLSEGEKGDTVGEVIQCETPKKKFQRNSSNIE  154



>emb|CAN78805.1| hypothetical protein VITISV_017581 [Vitis vinifera]
Length=1057

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL SGASAIE +SK   I  R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILVSGASAIE-DSKATPIALR-EGGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE+E  QRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEVEDQQRLAVRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKG+ +GE L  E+P+KKFQRNSSNLE
Sbjct  119  DMSEDLSEGEKGETVGELLPGETPKKKFQRNSSNLE  154



>ref|XP_010264118.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264120.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Nelumbo 
nucifera]
Length=1071

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA +IE + KP  ++ R E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAGSIE-DQKPISVDLR-ERGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWI+V ATRNT ERSSRLENMCWRIWHL RKKKQLE E  QRLA+RRWE EQGR DVTE
Sbjct  59   RTWIQVAATRNTRERSSRLENMCWRIWHLARKKKQLEWEDFQRLANRRWEWEQGRMDVTE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE +  E+P+KKFQRNSSN+E
Sbjct  119  DMSEDLSEGEKGDTVGEVIQCETPKKKFQRNSSNIE  154



>ref|XP_002271398.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Vitis 
vinifera]
 ref|XP_010650290.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Vitis 
vinifera]
 ref|XP_010650292.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Vitis 
vinifera]
Length=1067

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 137/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL SGASAIE +SK   I  R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILVSGASAIE-DSKATPIALR-EGGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE+E  QRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEVEDQQRLAVRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKG+ +GE L  E+P+KKFQRNSSNLE
Sbjct  119  DMSEDLSEGEKGETVGELLPGETPKKKFQRNSSNLE  154



>ref|XP_008380516.1| PREDICTED: probable sucrose-phosphate synthase 2 isoform X1 [Malus 
domestica]
Length=1065

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 138/156 (88%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGASAIE E KP   N R ++GHFNPTKYFVEEVV+GVDE+DL+
Sbjct  1    MAGNEWINGYLEAILDSGASAIE-EQKPVPENLR-DRGHFNPTKYFVEEVVTGVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ER SRLENMCWRIWHLTRKKKQLE+E  QRLA+RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERGSRLENMCWRIWHLTRKKKQLEVEEHQRLANRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD LGE    ++PRK+FQRN SNLE
Sbjct  119  DMSEDLSEGEKGDGLGEMQLGDTPRKRFQRNISNLE  154



>ref|XP_011041945.1| PREDICTED: probable sucrose-phosphate synthase 3 [Populus euphratica]
 ref|XP_011041946.1| PREDICTED: probable sucrose-phosphate synthase 3 [Populus euphratica]
Length=1069

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 137/158 (87%), Gaps = 3/158 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSG--ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            MAGNEWINGYLEAIL+SG  A AIE E KPA   +  E GHFNPTKYFVEEVV+GVDETD
Sbjct  1    MAGNEWINGYLEAILNSGGGAGAIE-EHKPAPTVNLRETGHFNPTKYFVEEVVTGVDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RRWERE GR+D 
Sbjct  60   LHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRWERELGRRDA  119

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            TEDMSEDLSEGEKGD LGE L  E+PRK+FQRN SNLE
Sbjct  120  TEDMSEDLSEGEKGDGLGELLQSETPRKRFQRNLSNLE  157



>ref|XP_006494166.1| PREDICTED: probable sucrose-phosphate synthase 3-like [Citrus 
sinensis]
Length=1067

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGASAIE + K   +N   ++GHFNPTKYFVEEVV+ VDETDL+
Sbjct  1    MAGNEWINGYLEAILDSGASAIEEQQKQTPVN-LADRGHFNPTKYFVEEVVTSVDETDLY  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RR EREQGR+DVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRLEREQGRRDVTE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE  + ++PRKKFQRN SNLE
Sbjct  120  DMSEDLSEGEKGDGVGEIQTPDTPRKKFQRNFSNLE  155



>ref|XP_006373074.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
 gb|ERP50871.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
Length=1069

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 135/158 (85%), Gaps = 3/158 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSG--ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            MAGNEWINGYLEAILDSG  A AIE E KPA   +  + G FNPTKYFVEEVV+GVDETD
Sbjct  1    MAGNEWINGYLEAILDSGGGAGAIE-EHKPAPSMNLRDTGDFNPTKYFVEEVVTGVDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWERE GR+D 
Sbjct  60   LHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLATRRWERELGRRDA  119

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            TEDMSEDLSEGEKGD LGE +  E+PRK+FQRN SNLE
Sbjct  120  TEDMSEDLSEGEKGDGLGELVQSETPRKRFQRNLSNLE  157



>ref|XP_002298684.1| hypothetical protein POPTR_0001s32500g [Populus trichocarpa]
 gb|EEE83489.1| hypothetical protein POPTR_0001s32500g [Populus trichocarpa]
Length=1069

 Score =   249 bits (636),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 134/158 (85%), Gaps = 3/158 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSG--ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            M GNEWINGYLEAIL+SG  A AIE E KPA   +  E GHFNPTKYFVEEVV GVDETD
Sbjct  1    MPGNEWINGYLEAILNSGGGAGAIE-EHKPAPTVNLRETGHFNPTKYFVEEVVRGVDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RRWEREQGR+D 
Sbjct  60   LHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRWEREQGRRDA  119

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            TEDMSEDLSEGEKGD LGE    E+PRKKFQR+ SN E
Sbjct  120  TEDMSEDLSEGEKGDGLGELAQSETPRKKFQRSLSNPE  157



>ref|NP_001266150.1| sucrose-phosphate synthase B [Solanum lycopersicum]
 gb|AFD64638.1| sucrose-phosphate synthase B [Solanum lycopersicum]
Length=1064

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 137/161 (85%), Gaps = 6/161 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVIN-----HRGEQGHFNPTKYFVEEVVSGVD  323
            MAGNEWINGYLEAIL SGASAIE + KP+        +  E+ +FNPTKYFVEEVV+GVD
Sbjct  1    MAGNEWINGYLEAILSSGASAIE-DKKPSSTTTSSHLNLAERANFNPTKYFVEEVVTGVD  59

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR A+RR ERE GR
Sbjct  60   ETDLHRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRSANRRLERELGR  119

Query  504  KDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            KDVTEDMSEDLSEGEKGD LGET +L+SPRK+FQRN SNLE
Sbjct  120  KDVTEDMSEDLSEGEKGDVLGETPTLDSPRKRFQRNFSNLE  160



>ref|XP_010247961.1| PREDICTED: probable sucrose-phosphate synthase 2 [Nelumbo nucifera]
Length=1073

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MA NEWINGYLEAILDSGA++IE E KP+ +N R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAVNEWINGYLEAILDSGAASIE-EQKPSSVNLR-EGGHFNPTKYFVEEVVTGVDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN  ERSSRLENMCWRIWHL RKKKQLE E  QRL +RRWEREQGR D TE
Sbjct  59   RTWIKVVATRNARERSSRLENMCWRIWHLARKKKQLEWEEFQRLTNRRWEREQGRMDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SEDLSEGEKGD +GE +  E+P KK+QRN SNLE
Sbjct  119  DLSEDLSEGEKGDTVGEMIQSEAPMKKYQRNFSNLE  154



>ref|XP_010927691.1| PREDICTED: probable sucrose-phosphate synthase 2 [Elaeis guineensis]
Length=1086

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGASAI  E + +      + GHFNPT+YFVEEVV GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGASAITDEQRGSSPVSVRDTGHFNPTRYFVEEVVMGVDETDLH  60

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN+ ERSSRLENMCWRIWHL RKKKQLE E LQR+A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNSRERSSRLENMCWRIWHLARKKKQLEWEDLQRMANRRWEREQGRRDATE  120

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE +  E+P+KKFQRN S+L+
Sbjct  121  DMSEDLSEGEKGDTVGELVQSETPKKKFQRNISDLQ  156



>gb|ABA64521.1| sucrose-phosphate synthase isoform B [Nicotiana tabacum]
Length=1064

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVIN----HRGEQGHFNPTKYFVEEVVSGVDE  326
            MAGNEWINGYLEAIL SGASAIE ++  +       +  E+ +FNPTKYFVEEVV+GVDE
Sbjct  1    MAGNEWINGYLEAILSSGASAIEDKTPSSSTTSSHLNLAERANFNPTKYFVEEVVTGVDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            TDLHRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E +QR A+RR EREQGRK
Sbjct  61   TDLHRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDVQRSANRRLEREQGRK  120

Query  507  DVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DVTEDMSEDLSEGEKGD LGET +L+SPRK+FQRN SNLE
Sbjct  121  DVTEDMSEDLSEGEKGDVLGETPTLDSPRKRFQRNFSNLE  160



>ref|XP_011045619.1| PREDICTED: probable sucrose-phosphate synthase 3 [Populus euphratica]
Length=1069

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 134/158 (85%), Gaps = 3/158 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSG--ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            M GNEWINGYLEAIL+SG  A AIE E KPA   +  E GHFNPTKYFVEEVV+GVDETD
Sbjct  1    MPGNEWINGYLEAILNSGGGAGAIE-EHKPAPTVNLRETGHFNPTKYFVEEVVTGVDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RRWEREQGR+D 
Sbjct  60   LHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRWEREQGRRDA  119

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            TEDMSEDLSEGEKGD LGE    E+PRKKF R+ SN E
Sbjct  120  TEDMSEDLSEGEKGDGLGELAQSETPRKKFLRSLSNPE  157



>sp|O04933.1|SPSA2_CRAPL RecName: Full=Probable sucrose-phosphate synthase 2; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase 2 [Craterostigma 
plantagineum]
 emb|CAA72491.1| sucrose-phosphate synthase [Craterostigma plantagineum]
Length=1081

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 137/163 (84%), Gaps = 7/163 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES----KPAVINHRGEQGHFNPTKYFVEEVVSGVDE  326
            MAGNEWINGYLEAILD+GASAI+  S      A    R    HFNPTKYFVEEVVSGVDE
Sbjct  1    MAGNEWINGYLEAILDTGASAIDENSGGGKTAAAQKGRHHDHHFNPTKYFVEEVVSGVDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            +DLHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA R+WEREQGRK
Sbjct  61   SDLHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEDLQRLAARKWEREQGRK  120

Query  507  DVTEDMSEDLSEGEKGDALGET-LSLESPR--KKFQRNSSNLE  626
            DVTEDMSEDLSEGEKGD +GET ++L+SPR  KK+ RN SNLE
Sbjct  121  DVTEDMSEDLSEGEKGDVMGETPVALDSPRGNKKYHRNFSNLE  163



>ref|XP_006360944.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Solanum 
tuberosum]
Length=1064

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 137/160 (86%), Gaps = 4/160 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVIN----HRGEQGHFNPTKYFVEEVVSGVDE  326
            MAGNEWINGYLEAIL +GASAIE ++  +       +  E+ +FNPTKYFVEEVV+GVDE
Sbjct  1    MAGNEWINGYLEAILSTGASAIEDKTPSSTTTSSHLNLAERANFNPTKYFVEEVVTGVDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            TDLHRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR A+RR EREQGRK
Sbjct  61   TDLHRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRSANRRLEREQGRK  120

Query  507  DVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DVTEDMSEDLSEGEKGD LGET +L+SPRK+FQRN SNLE
Sbjct  121  DVTEDMSEDLSEGEKGDVLGETPTLDSPRKRFQRNFSNLE  160



>gb|AJG44459.1| sucrose phosphate synthase [Lilium davidii var. unicolor]
Length=1080

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 132/156 (85%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEV-ESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  335
            MAGNEWINGYLEAILDSG SA+   + +P      G  GHFNPT+YFVEEVV+GVDETDL
Sbjct  1    MAGNEWINGYLEAILDSGPSAMAAGDEQPPAGGVLG--GHFNPTRYFVEEVVTGVDETDL  58

Query  336  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            HRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKK+LE E  QRL HRRWEREQGR+D T
Sbjct  59   HRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKKLEWEDFQRLTHRRWEREQGRRDAT  118

Query  516  EDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            EDMSEDLSEGEKGDA+GE +  E+PRKK QRN S++
Sbjct  119  EDMSEDLSEGEKGDAVGEMVQSETPRKKMQRNFSDV  154



>ref|XP_010069011.1| PREDICTED: probable sucrose-phosphate synthase 3 [Eucalyptus 
grandis]
 ref|XP_010069012.1| PREDICTED: probable sucrose-phosphate synthase 3 [Eucalyptus 
grandis]
 gb|KCW57233.1| hypothetical protein EUGRSUZ_H00041 [Eucalyptus grandis]
Length=1071

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSG      ++    +  + E+G FNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGGGGSSEQNVQKEVKMK-ERGDFNPTKYFVEEVVTGVDETDLH  59

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT +RSSRLENMCWRIWHLTRKKKQLE E +QRLA RRWEREQGR+D TE
Sbjct  60   RTWIKVVATRNTRDRSSRLENMCWRIWHLTRKKKQLEWEEMQRLAKRRWEREQGRRDATE  119

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE +  E+PRKKFQRN SNLE
Sbjct  120  DMSEDLSEGEKGDTVGELMLSETPRKKFQRNFSNLE  155



>ref|XP_007146334.1| hypothetical protein PHAVU_006G031700g [Phaseolus vulgaris]
 gb|ESW18328.1| hypothetical protein PHAVU_006G031700g [Phaseolus vulgaris]
Length=1050

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL +GAS IE E KPA +  R + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIE-EQKPAPVTLR-DGGHFNPTKYFVEEVVTSVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E  QR+A+RRWEREQGR++ TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEETQRVANRRWEREQGRREATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE +  E+P+K FQR  SNLE
Sbjct  119  DMSEDLSEGEKGDGIGEMVQSETPKKNFQRQISNLE  154



>ref|XP_008794597.1| PREDICTED: probable sucrose-phosphate synthase 2 [Phoenix dactylifera]
Length=1084

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGASAI  E + +      + GHFNPT YFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGASAITDEQRGSSPVSVRDTGHFNPTTYFVEEVVTGVDETDLH  60

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN+ ERSSRLENMCWRIWHL RKKKQLE E +QR+A+RRWERE GR+D TE
Sbjct  61   RTWIKVVATRNSRERSSRLENMCWRIWHLARKKKQLEWEDVQRMANRRWERELGRRDATE  120

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE +  E+P+KK QRN S+++
Sbjct  121  DMSEDLSEGEKGDTVGEMVQSETPKKKLQRNISDIQ  156



>gb|KJB72051.1| hypothetical protein B456_011G155900 [Gossypium raimondii]
Length=951

 Score =   239 bits (611),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AIE E KP V     E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPMV--DLRERGHFNPTKYFVEEVVTGVDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN  ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWERE  RKD TE
Sbjct  58   RTWIKVVATRNARERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWERELVRKDATE  117

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D++EDLSEGEKGD + E +  E+PR  F  N+S+LE
Sbjct  118  DLAEDLSEGEKGDTVSELIHAETPRVSFHSNASSLE  153



>gb|KJB72049.1| hypothetical protein B456_011G155900 [Gossypium raimondii]
 gb|KJB72050.1| hypothetical protein B456_011G155900 [Gossypium raimondii]
Length=1057

 Score =   240 bits (612),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AIE E KP V     E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPMV--DLRERGHFNPTKYFVEEVVTGVDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN  ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWERE  RKD TE
Sbjct  58   RTWIKVVATRNARERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWERELVRKDATE  117

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D++EDLSEGEKGD + E +  E+PR  F  N+S+LE
Sbjct  118  DLAEDLSEGEKGDTVSELIHAETPRVSFHSNASSLE  153



>gb|KHG20806.1| putative sucrose-phosphate synthase 3 -like protein [Gossypium 
arboreum]
Length=1045

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 131/156 (84%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSGA+AIE E KP V     E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPTV--DLRERGHFNPTKYFVEEVVTGVDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN  ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWERE  RKD TE
Sbjct  58   RTWIKVVATRNARERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWERELVRKDATE  117

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D++EDLSEGEKGD + E +  E+PR  F  N+S+LE
Sbjct  118  DLAEDLSEGEKGDTVSELIHAETPRVSFHINASSLE  153



>ref|XP_004499982.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cicer 
arietinum]
Length=1042

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL +GAS IE E KPA +  R + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIE-EQKPAQVTLR-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E +QR+ +RRWEREQGR++ TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEEVQRVTNRRWEREQGRREATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SEDLSEGEKGD + E +  E+PRKKFQR  SNLE
Sbjct  119  DLSEDLSEGEKGDNIVEMVQSETPRKKFQRQVSNLE  154



>ref|XP_008457154.1| PREDICTED: probable sucrose-phosphate synthase 2 [Cucumis melo]
Length=1062

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 136/159 (86%), Gaps = 4/159 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVIN---HRGEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILD+GA+AIE E KPA      +  ++GHFNPTKYFVEEVVSGVDE+
Sbjct  1    MAGNEWINGYLEAILDTGATAIE-EQKPASAAAAANLTDRGHFNPTKYFVEEVVSGVDES  59

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQR  +RR ERE+GR D
Sbjct  60   DLHRTWLKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRSTNRRLERERGRMD  119

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            VTEDMSEDLSEGEKGDA+ E +  E+P+ +FQR +SNLE
Sbjct  120  VTEDMSEDLSEGEKGDAVSEIVQNETPKVEFQRTTSNLE  158



>ref|XP_002892252.1| ATSPS3F [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68511.1| ATSPS3F [Arabidopsis lyrata subsp. lyrata]
Length=1062

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+  +FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQAAVNLREGDGQYFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
             TED+SEDLSEGEKGD LGE +  E+PRK+ QRN SNLE
Sbjct  121  ATEDLSEDLSEGEKGDGLGEIVPPETPRKQLQRNLSNLE  159



>ref|XP_004138938.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cucumis 
sativus]
Length=1067

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 135/159 (85%), Gaps = 4/159 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVIN---HRGEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILD+GA+AIE E KPA      +  ++GHFNPTKYFVEEVVSGVDE+
Sbjct  1    MAGNEWINGYLEAILDTGATAIE-EQKPASAAAAANLTDRGHFNPTKYFVEEVVSGVDES  59

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQR  +RR ERE+GR D
Sbjct  60   DLHRTWLKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRSTNRRLERERGRMD  119

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            VTEDMSEDLSEGEKGD + E +  E+P++ FQR SSNLE
Sbjct  120  VTEDMSEDLSEGEKGDTVSEIVQNETPKESFQRTSSNLE  158



>gb|AES70069.2| sucrose-phosphate synthase family protein [Medicago truncatula]
Length=1046

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 131/156 (84%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL +GAS IE +  P      G  GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIEEQKPPQAALRDG--GHFNPTKYFVEEVVASVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTW+KVVATRNT ERSSRLENMCWRIWHL RKKKQLE E +QRLA+RRWEREQGR+D TE
Sbjct  59   RTWVKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEEVQRLANRRWEREQGRRDATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD + + +  E+PR++FQR +SNLE
Sbjct  119  DMSEDLSEGEKGDNVVDMVQSETPRQRFQRQTSNLE  154



>gb|ADT64795.4| sucrose phosphate synthase [Musa acuminata AAA Group]
Length=1082

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSG +  + +   + ++ R    HFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGGAVADDQKVSSPVSVRDGGDHFNPTKYFVEEVVTGVDETDLH  60

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN+ ERS+RLENMCWRIWHLTRKKKQLE E +QR A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNSRERSTRLENMCWRIWHLTRKKKQLEWENVQRTANRRWEREQGRRDATE  120

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSE+LSEGEKGD +GE    E+PRKK QRN S+++
Sbjct  121  DMSEELSEGEKGDTVGELTQGETPRKKLQRNFSDIQ  156



>ref|XP_009396792.1| PREDICTED: sucrose-phosphate synthase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009396793.1| PREDICTED: sucrose-phosphate synthase [Musa acuminata subsp. 
malaccensis]
Length=1082

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILDSG +  + +   + ++ R    HFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGGAVADDQKVSSPVSVRDGGDHFNPTKYFVEEVVTGVDETDLH  60

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRN+ ERS+RLENMCWRIWHLTRKKKQLE E +QR A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNSRERSTRLENMCWRIWHLTRKKKQLEWENVQRTANRRWEREQGRRDATE  120

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSE+LSEGEKGD +GE    E+PRKK QRN S+++
Sbjct  121  DMSEELSEGEKGDTVGELTQGETPRKKLQRNFSDIQ  156



>ref|XP_010522391.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Tarenaya 
hassleriana]
Length=1059

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 131/158 (83%), Gaps = 3/158 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAV--INHRGEQGHFNPTKYFVEEVVSGVDETD  332
            MAGNEWINGYLEAILDS A AIE E +P    +N R     FNPTKYFVEEVV+GVDETD
Sbjct  1    MAGNEWINGYLEAILDSRAQAIE-EQRPQAPPVNSRDGGQFFNPTKYFVEEVVTGVDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHRTWIKVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR AHRRWEREQGR+D 
Sbjct  60   LHRTWIKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEVSQRQAHRRWEREQGRRDA  119

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            TED+SEDLSEGEKGD +GE +  E+PR++ QRN S +E
Sbjct  120  TEDLSEDLSEGEKGDGVGEIVQPETPRRRLQRNPSIIE  157



>ref|XP_010522392.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X2 [Tarenaya 
hassleriana]
Length=1044

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 131/158 (83%), Gaps = 3/158 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAV--INHRGEQGHFNPTKYFVEEVVSGVDETD  332
            MAGNEWINGYLEAILDS A AIE E +P    +N R     FNPTKYFVEEVV+GVDETD
Sbjct  1    MAGNEWINGYLEAILDSRAQAIE-EQRPQAPPVNSRDGGQFFNPTKYFVEEVVTGVDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHRTWIKVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR AHRRWEREQGR+D 
Sbjct  60   LHRTWIKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEVSQRQAHRRWEREQGRRDA  119

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            TED+SEDLSEGEKGD +GE +  E+PR++ QRN S +E
Sbjct  120  TEDLSEDLSEGEKGDGVGEIVQPETPRRRLQRNPSIIE  157



>ref|XP_006857652.1| hypothetical protein AMTR_s00061p00145220 [Amborella trichopoda]
 gb|ERN19119.1| hypothetical protein AMTR_s00061p00145220 [Amborella trichopoda]
Length=1072

 Score =   238 bits (606),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAILD+GA  +E ++K   +N  G   HFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDTGAGGVE-DNKAVNLNDHGS--HFNPTKYFVEEVVTGVDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTW+KVVATRNT ERS+RLENMCWRIWHL RKKKQLE E  QRLA+RR EREQGR+D TE
Sbjct  58   RTWLKVVATRNTRERSTRLENMCWRIWHLARKKKQLEGEDSQRLANRRSEREQGRRDATE  117

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD +GE +  E+PR+K QRN S+L+
Sbjct  118  DMSEDLSEGEKGDVMGEMVQSETPRRKLQRNFSDLQ  153



>ref|NP_171984.2| sucrose-phosphate synthase [Arabidopsis thaliana]
 sp|Q8RY24.1|SPSA3_ARATH RecName: Full=Probable sucrose-phosphate synthase 3; AltName: 
Full=Sucrose phosphate synthase 3F; Short=AtSPS3F; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase [Arabidopsis 
thaliana]
 gb|AAL84949.1| At1g04920/F13M7_7 [Arabidopsis thaliana]
 gb|AAN72222.1| At1g04920/F13M7_7 [Arabidopsis thaliana]
 gb|AEE27759.1| sucrose-phosphate synthase [Arabidopsis thaliana]
 gb|AHL38971.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1062

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+  +FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQASVNLREGDGQYFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
             TED+SEDLSEGEKGD LGE +  E+PR++ QRN SNLE
Sbjct  121  ATEDLSEDLSEGEKGDGLGEIVQPETPRRQLQRNLSNLE  159



>gb|AAF40445.1|AC004809_3 Strong similarity to the sucrose-phosphate synthase from Craterostigma 
plantagineum gb|Y11795 [Arabidopsis thaliana]
Length=1064

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+  +FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQASVNLREGDGQYFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
             TED+SEDLSEGEKGD LGE +  E+PR++ QRN SNLE
Sbjct  121  ATEDLSEDLSEGEKGDGLGEIVQPETPRRQLQRNLSNLE  159



>gb|AGE43981.1| sucrose phosphate synthase 1 [Cucumis sativus]
Length=1067

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 135/159 (85%), Gaps = 4/159 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVIN---HRGEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWI+GYLEAILD+GA+AIE E KPA      +  ++GHFNPTKYFVEEVVSGVDE+
Sbjct  1    MAGNEWISGYLEAILDTGATAIE-EQKPASAAAAANLTDRGHFNPTKYFVEEVVSGVDES  59

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQR  +RR ERE+GR D
Sbjct  60   DLHRTWLKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRSTNRRLERERGRMD  119

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            VTEDMSEDLSEGEKGD + E +  E+P++ FQR SSNLE
Sbjct  120  VTEDMSEDLSEGEKGDTVSEIVQNETPKESFQRTSSNLE  158



>ref|XP_006418081.1| hypothetical protein EUTSA_v10006639mg [Eutrema salsugineum]
 gb|ESQ36434.1| hypothetical protein EUTSA_v10006639mg [Eutrema salsugineum]
Length=1066

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 134/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR--GEQGHFNPTKYFVEEVVSGVDE  326
            MAGNEWINGYLEAILDS A  IE  + KP A +N R  GE  +FNPTKYFVEEVV+GVDE
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEEQQQKPQAALNLRDGGEGQYFNPTKYFVEEVVTGVDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            TDLHRTWIKVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+
Sbjct  61   TDLHRTWIKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVANRRLEREQGRR  120

Query  507  DVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D TED+SEDLSEGEKGD +G+ +  E+PR+  QRN SN+E
Sbjct  121  DATEDLSEDLSEGEKGDGVGDIIQPETPRRHLQRNLSNVE  160



>gb|KHN18081.1| Putative sucrose-phosphate synthase 3 [Glycine soja]
Length=1053

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWI+GYLEAIL +GAS IE E KPA +  + + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWIDGYLEAILSTGASTIE-EQKPAPVTLK-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E +QR+  RRWEREQG ++  E
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEEVQRVTSRRWEREQGLREAAE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD++ E +  ++P+KKFQR +SNLE
Sbjct  119  DMSEDLSEGEKGDSVVEMVQSDTPKKKFQRQTSNLE  154



>ref|XP_003553129.1| PREDICTED: probable sucrose-phosphate synthase 3-like [Glycine 
max]
Length=1053

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 133/156 (85%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWI+GYLEAIL +GAS IE E KPA +  + + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWIDGYLEAILSTGASTIE-EQKPAPVTLK-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E +QR+  RRWEREQG ++  E
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEEVQRVTSRRWEREQGLREAAE  118

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            DMSEDLSEGEKGD++ E +  ++P+KKFQR +SNLE
Sbjct  119  DMSEDLSEGEKGDSVVEMVQSDTPKKKFQRQTSNLE  154



>ref|XP_003545147.1| PREDICTED: probable sucrose-phosphate synthase 3-like [Glycine 
max]
Length=1063

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL +G  A  V+ +        E GHFNPT+YFVEEVVS VDE+DLH
Sbjct  1    MAGNEWINGYLEAILSTGTGAGTVDEQMQKAVTPPESGHFNPTQYFVEEVVSSVDESDLH  60

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEGEELQRFANRRWEREQGRRDATE  120

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SE+LSEGEKGD +GE + +E+ +K FQR  SNLE
Sbjct  121  DLSEELSEGEKGDGVGEMIQIETSKKNFQRQISNLE  156



>gb|KHN11970.1| Putative sucrose-phosphate synthase 3 [Glycine soja]
Length=1063

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL +G  A  V+ +        E GHFNPT+YFVEEVVS VDE+DLH
Sbjct  1    MAGNEWINGYLEAILSTGTGAGTVDEQMQKAVTPPESGHFNPTQYFVEEVVSSVDESDLH  60

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEGEELQRFANRRWEREQGRRDATE  120

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D+SE+LSEGEKGD +GE + +E+ +K FQR  SNLE
Sbjct  121  DLSEELSEGEKGDGVGEMIQIETSKKNFQRQISNLE  156



>ref|XP_006306646.1| hypothetical protein CARUB_v10008160mg [Capsella rubella]
 gb|EOA39544.1| hypothetical protein CARUB_v10008160mg [Capsella rubella]
Length=1064

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHRGEQG-HFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP A +N R   G +FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQAALNLREADGQYFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
              ED+S+DLSEGEKGD LGE +  E+PR++  RN SNLE
Sbjct  121  AAEDLSDDLSEGEKGDGLGEIVQPETPRRQLHRNLSNLE  159



>ref|XP_004166159.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cucumis 
sativus]
Length=1071

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 134/163 (82%), Gaps = 8/163 (5%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVIN---HRGEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILD+GA+AIE E KPA      +  ++GHFNPTKYFVEEVVSGVDE+
Sbjct  1    MAGNEWINGYLEAILDTGATAIE-EQKPASAAAAANLTDRGHFNPTKYFVEEVVSGVDES  59

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKK----QLELEGLQRLAHRRWEREQ  497
            DLHRTW+KVVATRNT ERSSRLENMCWRIWHLTRKK     QLE E LQR  +RR ERE+
Sbjct  60   DLHRTWLKVVATRNTRERSSRLENMCWRIWHLTRKKNSFCVQLEWEELQRSTNRRLERER  119

Query  498  GRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            GR DVTEDMSEDLSEGEKGD + E +  E+P++ FQR SSNLE
Sbjct  120  GRMDVTEDMSEDLSEGEKGDTVSEIVQNETPKESFQRTSSNLE  162



>gb|ABW89596.1| sucrose phosphate synthase B [Medicago sativa]
Length=683

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQG-HFNPTKYFVEEVVSGVDETDL  335
            MAGNEWINGYLEAILD+G ++  VE +  V     E G HFNPTKYFVEEVVS VDE+DL
Sbjct  1    MAGNEWINGYLEAILDTGGASTTVEEQHRVTAAARESGDHFNPTKYFVEEVVSAVDESDL  60

Query  336  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            HRTW+KVVATRNT ERSSRLENMCWRIWHL RKKK++E E LQRLA+RRWE EQGR+D T
Sbjct  61   HRTWLKVVATRNTRERSSRLENMCWRIWHLARKKKKVEGEELQRLAYRRWEIEQGRRDAT  120

Query  516  EDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            ED+SE+LSEGEKGD +GE + +E+ +KK QR++S+ E
Sbjct  121  EDLSEELSEGEKGDGIGEIIQIETTQKKLQRHASSQE  157



>emb|CDX89776.1| BnaA10g03060D [Brassica napus]
Length=1064

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP--AVINHRGEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP  +V    GE   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQTSVALRDGEGEFFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVANRRLEREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
             TED+ EDLSEGEKGD LGE +  E+PR++ QRNSS+++
Sbjct  121  ATEDLFEDLSEGEKGDGLGEIVQPETPRRQLQRNSSSVD  159



>ref|XP_010484393.1| PREDICTED: probable sucrose-phosphate synthase 3 [Camelina sativa]
Length=983

 Score =   229 bits (583),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEDTQQKPQAAVNLREGDGQFFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
             TE +SEDLSEGEKGD LG+ +  E+PR + QRN SN+E
Sbjct  121  ATEVLSEDLSEGEKGDGLGDIVQPETPRIQLQRNLSNVE  159



>ref|XP_010457558.1| PREDICTED: LOW QUALITY PROTEIN: probable sucrose-phosphate synthase 
3 [Camelina sativa]
Length=1065

 Score =   229 bits (584),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEDTQQKPQAAVNLREGDGQFFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
             TE +SEDLSEGEKGD LG+ +  E+PR + QRN SN+E
Sbjct  121  ATEVLSEDLSEGEKGDGLGDIVQPETPRIQLQRNLSNVE  159



>emb|CDY18270.1| BnaC05g02930D [Brassica napus]
Length=1065

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP--AVINHR-GEQGHFNPTKYFVEEVVSGVDE  326
            MAGNEWINGYLEAILDS A  IE  + KP  +V   R GE   FNPTKYFVEEVV+GVDE
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQTSVTALRDGEGEFFNPTKYFVEEVVTGVDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            TDLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+
Sbjct  61   TDLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVANRRLEREQGRR  120

Query  507  DVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D TED+ EDLSEGEKGD LGE +  E+PR++ QRNSS+++
Sbjct  121  DATEDLFEDLSEGEKGDGLGEIVQPETPRRQLQRNSSSVD  160



>ref|XP_003617418.1| Sucrose-phosphate synthase [Medicago truncatula]
 gb|AET00377.1| sucrose-phosphate synthase family protein [Medicago truncatula]
Length=1058

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA-IEVESKPAVINHRGEQG-HFNPTKYFVEEVVSGVDETD  332
            MAGNEWINGYLEAIL +G  A   VE +  V     E G HFNPTKYFVEEVVS VDE+D
Sbjct  1    MAGNEWINGYLEAILSTGGGASTTVEEQQRVAAAARESGDHFNPTKYFVEEVVSAVDESD  60

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHRTW+KVVATRNT ERSSRLENMCWRIWHL RKKK++E E LQRLA+RRWEREQGR+D 
Sbjct  61   LHRTWLKVVATRNTRERSSRLENMCWRIWHLARKKKKVEGEELQRLAYRRWEREQGRRDA  120

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            TED+SE+LSEGEKGD +GE + +E+ +KK QR++S+LE
Sbjct  121  TEDLSEELSEGEKGDGIGEIIQIETQQKKLQRHASSLE  158



>ref|XP_003532093.1| PREDICTED: probable sucrose-phosphate synthase 3-like [Glycine 
max]
Length=1055

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL +GAS IE E KPA +  + + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIE-EQKPAPVTLK-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E +QR+  RR EREQGR++ TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEEVQRVTSRRLEREQGRREATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESP--RKKFQRNSSNLE  626
            DMSEDLSEGEKGD++ E +  ++P  +K FQR +SNLE
Sbjct  119  DMSEDLSEGEKGDSVVEMVQSDTPPTKKHFQRQTSNLE  156



>gb|KHM99635.1| Putative sucrose-phosphate synthase 3 [Glycine soja]
Length=1055

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL +GAS IE E KPA +  + + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIE-EQKPAPVTLK-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E +QR+  RR EREQGR++ TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEEVQRVTSRRLEREQGRREATE  118

Query  519  DMSEDLSEGEKGDALGETLSLESP--RKKFQRNSSNLE  626
            DMSEDLSEGEKGD++ E +  ++P  +K FQR +SNLE
Sbjct  119  DMSEDLSEGEKGDSVVEMVQSDTPPTKKHFQRQTSNLE  156



>ref|XP_010475162.1| PREDICTED: probable sucrose-phosphate synthase 3 [Camelina sativa]
 ref|XP_010475163.1| PREDICTED: probable sucrose-phosphate synthase 3 [Camelina sativa]
 ref|XP_010475164.1| PREDICTED: probable sucrose-phosphate synthase 3 [Camelina sativa]
Length=1061

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 131/159 (82%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP   +N R G+   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEDTQQKPQTAVNLREGDGQFFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRMEREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
             TE +SEDLSEGEKGD LG+ +  E+PR + QRN SN+E
Sbjct  121  ATEVLSEDLSEGEKGDGLGDIVQPETPRIQLQRNLSNVE  159



>ref|XP_003599818.1| Sucrose-phosphate synthase [Medicago truncatula]
Length=1065

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 131/175 (75%), Gaps = 21/175 (12%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEWINGYLEAIL +GAS IE +  P      G  GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIEEQKPPQAALRDG--GHFNPTKYFVEEVVASVDESDLY  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ-------------------LELEGL  461
            RTW+KVVATRNT ERSSRLENMCWRIWHL RKKKQ                   LE E +
Sbjct  59   RTWVKVVATRNTRERSSRLENMCWRIWHLARKKKQLVRRGMRTDQALFPWESNSLEWEEV  118

Query  462  QRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            QRLA+RRWEREQGR+D TEDMSEDLSEGEKGD + + +  E+PR++FQR +SNLE
Sbjct  119  QRLANRRWEREQGRRDATEDMSEDLSEGEKGDNVVDMVQSETPRQRFQRQTSNLE  173



>ref|XP_009119233.1| PREDICTED: probable sucrose-phosphate synthase 3 [Brassica rapa]
Length=1064

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKP--AVINHRGEQGHFNPTKYFVEEVVSGVDET  329
            MAGNEWINGYLEAILDS A  IE  + KP  +V    GE   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQTSVALRDGEGEFFNPTKYFVEEVVTGVDET  60

Query  330  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  509
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+R   REQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVANRSVTREQGRRD  120

Query  510  VTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
             TED+ EDLSEGEKGD LGE +  E+PR++ QRNSS+++
Sbjct  121  ATEDLFEDLSEGEKGDGLGEIVQPETPRRQLQRNSSSVD  159



>ref|XP_010929745.1| PREDICTED: LOW QUALITY PROTEIN: probable sucrose-phosphate synthase 
2 [Elaeis guineensis]
Length=1074

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 125/163 (77%), Gaps = 9/163 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES---KPAV------INHRGEQGHFNPTKYFVEEVV  311
            M GNEWINGYLEAILDSGA+ +  +    +PA         H  + GHFNPTKYFVEEVV
Sbjct  1    MVGNEWINGYLEAILDSGAATVSEDHQHHRPAASPKKERCGHHFDPGHFNPTKYFVEEVV  60

Query  312  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  491
            SGVDE DLHRTWIKVVATR+++ERS+RLENMCWRIWHL RKKKQ+E E  QR A  RWE+
Sbjct  61   SGVDEHDLHRTWIKVVATRDSLERSARLENMCWRIWHLARKKKQMEWEDFQRKAKHRWEQ  120

Query  492  EQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSN  620
            EQGRKD TED+ EDLSEGEKGD +GE +  E+P  K QRN S+
Sbjct  121  EQGRKDATEDLPEDLSEGEKGDTIGEMVQCETPWLKLQRNFSD  163



>gb|KFK42840.1| hypothetical protein AALP_AA1G045800 [Arabis alpina]
Length=1068

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 130/162 (80%), Gaps = 6/162 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKP----AVINHR--GEQGHFNPTKYFVEEVVSGV  320
            MAGNEWINGYLEAILDS    IE + +       +N R  GE   FNPTKYFVEEVV+GV
Sbjct  1    MAGNEWINGYLEAILDSQTQGIEEQQQQQKPQGALNLREGGEGQFFNPTKYFVEEVVTGV  60

Query  321  DETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQG  500
            DETDLHRTWIKVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A RR EREQG
Sbjct  61   DETDLHRTWIKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVASRRMEREQG  120

Query  501  RKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            R+D TED+SEDLSEGEKGD +GE +  E+P ++ QRNSSN+E
Sbjct  121  RRDATEDLSEDLSEGEKGDGVGEIVQPETPIRRLQRNSSNVE  162



>gb|AEO46461.1| sucrose phosphate synthase B [Saccharum hybrid cultivar ROC22]
Length=1074

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 127/164 (77%), Gaps = 9/164 (5%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAI---------EVESKPAVINHRGEQGHFNPTKYFVEEVV  311
            MAGNEWINGYLEAILDS ASA          +  S     + RG   +FNP+ YFVEEVV
Sbjct  1    MAGNEWINGYLEAILDSRASAGGGGGGGGGGDPRSPTKAASPRGPHMNFNPSHYFVEEVV  60

Query  312  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  491
             GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR++ RR E+
Sbjct  61   KGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQRISARRKEQ  120

Query  492  EQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            EQ R++ TED++EDLSEGEKGD LGE   +E+ +KKFQRN S+L
Sbjct  121  EQVRREATEDLAEDLSEGEKGDTLGELAPVETAKKKFQRNFSDL  164



>ref|NP_001105694.1| sucrose-phosphate synthase [Zea mays]
 sp|P31927.1|SPSA_MAIZE RecName: Full=Sucrose-phosphate synthase; AltName: Full=UDP-glucose-fructose-phosphate 
glucosyltransferase [Zea mays]
 gb|AAA33513.1| sucrose phosphate synthase [Zea mays]
 gb|AFW84161.1| sucrose phosphate synthase1 [Zea mays]
Length=1068

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 126/164 (77%), Gaps = 9/164 (5%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA---------IEVESKPAVINHRGEQGHFNPTKYFVEEVV  311
            MAGNEWINGYLEAILDS  S+          +  S     + RG   +FNP+ YFVEEVV
Sbjct  1    MAGNEWINGYLEAILDSHTSSRGAGGGGGGGDPRSPTKAASPRGAHMNFNPSHYFVEEVV  60

Query  312  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  491
             GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR++ RR E+
Sbjct  61   KGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQRISARRKEQ  120

Query  492  EQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            EQ R++ TED++EDLSEGEKGD +GE   +E+ +KKFQRN S+L
Sbjct  121  EQVRREATEDLAEDLSEGEKGDTIGELAPVETTKKKFQRNFSDL  164



>gb|AAR84220.1| sucrose-phosphate synthase [Triticum aestivum]
Length=188

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 124/171 (73%), Gaps = 16/171 (9%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVE----------------SKPAVINHRGEQGHFNPTK  290
            MAGNEWINGYLEAILDSGAS                        +  + RG    FNPT 
Sbjct  1    MAGNEWINGYLEAILDSGASGGGGGGGSGAGAGGGGGGGGGDPKSSSSPRGPHTIFNPTT  60

Query  291  YFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRL  470
            YFVEEVV GVDE+DLHRTWIKVVATRN  ERSSRLENMCWRIWHL RKKKQLE+EG+QR+
Sbjct  61   YFVEEVVKGVDESDLHRTWIKVVATRNARERSSRLENMCWRIWHLARKKKQLEIEGIQRM  120

Query  471  AHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            + R+ E+E+ R++ TED+SEDL EGEKGD +GE +   +P+KKFQRN S+L
Sbjct  121  SARQNEQEKVRREATEDLSEDLDEGEKGDIVGELMPSGTPKKKFQRNFSDL  171



>ref|XP_006645236.1| PREDICTED: probable sucrose-phosphate synthase 1-like [Oryza 
brachyantha]
Length=1083

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 127/172 (74%), Gaps = 17/172 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVI---NHRGEQG--------------HFNPT  287
            MAGNEWINGYLEAILDSG +A              HRGE                +FNPT
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGDAAGRRRHRGEPAPQLRGXXSPRGLHMNFNPT  60

Query  288  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  467
             YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR
Sbjct  61   HYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQR  120

Query  468  LAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            ++ RR E+EQ R++ TED++EDLSEGEKGD +GE +  ++P+KKFQRN S+L
Sbjct  121  ISARRKEQEQVRRETTEDLAEDLSEGEKGDTVGELMPQDTPKKKFQRNFSDL  172



>ref|XP_008674664.1| PREDICTED: sucrose-phosphate synthase-like [Zea mays]
Length=1079

 Score =   211 bits (537),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 126/169 (75%), Gaps = 14/169 (8%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA--------------IEVESKPAVINHRGEQGHFNPTKYF  296
            MAGNEWINGYLEAILDS  S+              +   S     + RG   +FNP+ YF
Sbjct  1    MAGNEWINGYLEAILDSRTSSGGGGGGGGGDPRSPVAGASPTKGASPRGPHMNFNPSHYF  60

Query  297  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  476
            VEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR++ 
Sbjct  61   VEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQRISA  120

Query  477  RRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            RR E+EQ R++ TED+++DLSEGEKGD L E + +E+ +KKFQRN S+L
Sbjct  121  RRKEQEQVRREATEDLADDLSEGEKGDTLAELVPVEAAKKKFQRNFSDL  169



>ref|XP_008794976.1| PREDICTED: probable sucrose-phosphate synthase 2 [Phoenix dactylifera]
Length=1084

 Score =   211 bits (536),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 120/171 (70%), Gaps = 15/171 (9%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEV--------------ESKPAVINHRGEQGHFNPTKYF  296
            M GNEWINGYLEAILDSGA+ +                  K     H  + GHFNPTKYF
Sbjct  1    MVGNEWINGYLEAILDSGAATVAEDHHHHHHRPAAAAASPKKKRGGHHFDPGHFNPTKYF  60

Query  297  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  476
            VEEVVSGVDE DLHRTWI VVATR++ ERS+RLENMCWRIWHL RKKKQ+E E  QR   
Sbjct  61   VEEVVSGVDEHDLHRTWIMVVATRDSRERSARLENMCWRIWHLARKKKQMEWEDFQRKEK  120

Query  477  RRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRN-SSNLE  626
             RWE+EQGRKD TED+ ED SEG +GD +GE +  E+PR K QRN S NL+
Sbjct  121  HRWEQEQGRKDATEDLPEDFSEGGRGDTIGEMVQCETPRIKLQRNLSDNLQ  171



>ref|XP_004491325.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cicer 
arietinum]
Length=1053

 Score =   210 bits (534),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 119/155 (77%), Gaps = 7/155 (5%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSG-ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  335
            MAGNEWINGYLEAIL +G A++  VE +  V     E GHFNP KYFVEEVVS VDE+DL
Sbjct  1    MAGNEWINGYLEAILSTGVAASTTVEEQQRVAATAAESGHFNPIKYFVEEVVSAVDESDL  60

Query  336  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            HRTW+KVVATRNT ERSSRLENMCWRIWHL RKKKQLE            EREQGR+D T
Sbjct  61   HRTWLKVVATRNTRERSSRLENMCWRIWHLARKKKQLE------GXXXXXEREQGRRDAT  114

Query  516  EDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSN  620
            ED+SE+LSEGEKGD +GE + +E+P+KK QR  SN
Sbjct  115  EDLSEELSEGEKGDGIGEMIQIETPKKKLQRQISN  149



>ref|XP_002458991.1| hypothetical protein SORBIDRAFT_03g043900 [Sorghum bicolor]
 gb|EES04111.1| hypothetical protein SORBIDRAFT_03g043900 [Sorghum bicolor]
Length=1081

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 124/173 (72%), Gaps = 18/173 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA------------------IEVESKPAVINHRGEQGHFNP  284
            MAGNEWINGYLEAILDS  +A                  +   S     + RG   +FNP
Sbjct  1    MAGNEWINGYLEAILDSRTTAGGGGGGGGGGGGGDPRSPVAGASPTKAASPRGPHMNFNP  60

Query  285  TKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQ  464
            + YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+Q
Sbjct  61   SHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGMQ  120

Query  465  RLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            R++ RR E+EQ R++ TED++EDL EGEK D LGE   +E+ +KKFQRN S+L
Sbjct  121  RISARRKEQEQVRREATEDLAEDLDEGEKADTLGELAPVETAKKKFQRNFSDL  173



>ref|XP_003564935.1| PREDICTED: sucrose-phosphate synthase [Brachypodium distachyon]
Length=1078

 Score =   207 bits (528),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 125/167 (75%), Gaps = 12/167 (7%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDS------------GASAIEVESKPAVINHRGEQGHFNPTKYFVE  302
            MAGNEWINGYLEAILDS               +    +  +  + RG   +F+PT YFVE
Sbjct  1    MAGNEWINGYLEAILDSGGAAAGGGAGGGDPKSAVAGAGASSASPRGPHMNFSPTHYFVE  60

Query  303  EVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRR  482
            EVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR++ R+
Sbjct  61   EVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQRMSARQ  120

Query  483  WEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
             E+EQ R++ TED++EDLSEGEKGD +GE  S  +P+KKFQRN S+L
Sbjct  121  KEQEQVRREATEDLAEDLSEGEKGDTVGELASYGTPKKKFQRNFSDL  167



>emb|CDM85683.1| unnamed protein product [Triticum aestivum]
Length=1069

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 125/172 (73%), Gaps = 17/172 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-----------------VESKPAVINHRGEQGHFNPT  287
            MAGNEWINGYLEAILDSGAS                    V    +  + RG    FNPT
Sbjct  1    MAGNEWINGYLEAILDSGASGGGGGGGGGGGSGGGGGGAGVGDPKSSSSPRGPHTIFNPT  60

Query  288  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  467
             YFVEEVV GVDE+DLHRTWIKVVATRN  ERSSRLENMCWRIWHL RKKKQLE+EG+QR
Sbjct  61   TYFVEEVVKGVDESDLHRTWIKVVATRNARERSSRLENMCWRIWHLARKKKQLEIEGIQR  120

Query  468  LAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            ++ R+ E+EQ R++ TED+SEDL EGEKGD +GE +   +P+KKFQRN S+L
Sbjct  121  MSARQKEQEQVRREATEDLSEDLDEGEKGDIVGELMPSGTPKKKFQRNFSDL  172



>gb|AAC49379.1| sucrose phosphate synthase [Oryza sativa Indica Group]
Length=1049

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 125/165 (76%), Gaps = 10/165 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA--------IEVESKPA-VINHRGEQGHFNPTKYFVEEVV  311
            MAGNEWINGYLEAILDSG +A        ++  S  A   + RG   +FNPT YFVEEVV
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGVDPRSPAAGAASPRGPHMNFNPTHYFVEEVV  60

Query  312  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  491
             GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+ R++ RR E+
Sbjct  61   KGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGILRISARRKEQ  120

Query  492  EQGRKDVTEDMSEDLSEGEKGDALGETLSLESP-RKKFQRNSSNL  623
            EQ R++ +ED++EDL EGEK D +GE    ++P +KKFQRN S L
Sbjct  121  EQVRRETSEDLAEDLFEGEKADTVGELAQQDTPMKKKFQRNFSEL  165



>gb|ADG01610.1| sucrose phosphate synthase [Xerophyta humilis]
Length=1080

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 124/163 (76%), Gaps = 7/163 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGAS---AIEVESKPAVINHRGEQG---HFNPTK-YFVEEVVSG  317
            MAGNEWINGYLEAILDSG +   A E + +      R       HFNPT+ Y VEEVV+G
Sbjct  1    MAGNEWINGYLEAILDSGGAGGGATEKDQQRRQQQKRSGAAVVEHFNPTRVYLVEEVVTG  60

Query  318  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  497
            VDETDLHRTWIKVVATR++ ERSSRLENMCWRIWHLTRKKKQLE E  QR+  RR EREQ
Sbjct  61   VDETDLHRTWIKVVATRSSRERSSRLENMCWRIWHLTRKKKQLEWEENQRITSRRLEREQ  120

Query  498  GRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            GR+D TEDM EDLSEGEKGD + E    E+P+KK QRN S+++
Sbjct  121  GRRDATEDMQEDLSEGEKGDTVSELSQSETPKKKLQRNVSDIQ  163



>sp|A2WYE9.2|SPSA1_ORYSI RecName: Full=Probable sucrose-phosphate synthase 1; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase [Oryza 
sativa Indica Group]
 sp|Q0JGK4.2|SPSA1_ORYSJ RecName: Full=Probable sucrose-phosphate synthase 1; AltName: 
Full=Sucrose phosphate synthase 1F; Short=OsSPS1F; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase [Oryza 
sativa Japonica Group]
 dbj|BAD87626.1| sucrose phosphate synthase [Oryza sativa Japonica Group]
Length=1084

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 125/181 (69%), Gaps = 26/181 (14%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA------------------------IEVESKPA-VINHRG  263
            MAGNEWINGYLEAILDSG +A                        ++  S  A   + RG
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPRSPAAGAASPRG  60

Query  264  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  443
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  444  LELEGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESP-RKKFQRNSSN  620
            LELEG+ R++ RR E+EQ R++ +ED++EDL EGEK D +GE    ++P +KKFQRN S 
Sbjct  121  LELEGILRISARRKEQEQVRRETSEDLAEDLFEGEKADTVGELAQQDTPMKKKFQRNFSE  180

Query  621  L  623
            L
Sbjct  181  L  181



>dbj|BAA08304.1| sucrose phosphate synthase [Oryza sativa Japonica Group]
Length=1084

 Score =   194 bits (492),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 123/181 (68%), Gaps = 26/181 (14%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEV-----------------------ESKP--AVINHRG  263
            MAGNEWINGYLEAILDSG +A                           S P     + RG
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPSSPTTGTTSPRG  60

Query  264  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  443
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  444  LELEGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESP-RKKFQRNSSN  620
            LELEG+ R++ RR E+EQ R++ +ED++EDL EGEK D +GE    ++P +KKFQRN S 
Sbjct  121  LELEGILRISARRKEQEQVRRETSEDLAEDLFEGEKADTVGELAQQDTPMKKKFQRNFSE  180

Query  621  L  623
            L
Sbjct  181  L  181



>emb|CAC81823.1| sucrose-phosphate synthase [Beta vulgaris]
Length=214

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 116/159 (73%), Gaps = 6/159 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            MAGN+WIN YLEAILD G   I+  +     +        E+GHF+P++YFVEEV++G D
Sbjct  1    MAGNDWINSYLEAILDVGGQGIDASNAKTSSSSPSSLLLRERGHFSPSRYFVEEVITGFD  60

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  +TR+  ER++RLEN+CWRIW+L RKKKQ+E E  QR A R  ERE+GR
Sbjct  61   ETDLHRSWVRAASTRSPQERNTRLENLCWRIWNLARKKKQIEGEEAQRSAKRHIEREKGR  120

Query  504  KDVTEDMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            ++ T DMSEDLSEGEKGD +G+ + + +S + + +R SS
Sbjct  121  REATADMSEDLSEGEKGDTVGDMSFAGDSTKGRMRRISS  159



>tpg|DAA56138.1| TPA: putative sucrose-phosphate synthase family protein [Zea 
mays]
Length=1127

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 126/217 (58%), Gaps = 62/217 (29%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA--------------IEVESKPAVINHRGEQGHFNPTKYF  296
            MAGNEWINGYLEAILDS  S+              +   S     + RG   +FNP+ YF
Sbjct  1    MAGNEWINGYLEAILDSRTSSGGGGGGGGGDPRSPVAGASPTKGASPRGPHMNFNPSHYF  60

Query  297  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ-----------  443
            VEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ           
Sbjct  61   VEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLDGEVTIDQAC  120

Query  444  -------------------------------------LELEGLQRLAHRRWEREQGRKDV  512
                                                 LELEG+QR++ RR E+EQ R++ 
Sbjct  121  MVGCGAFRIQNPTLNCDVTSKKKLFADLQCFIAVHIKLELEGIQRISARRKEQEQVRREA  180

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            TED+++DLSEGEKGD L E + +E+ +KKFQRN S+L
Sbjct  181  TEDLADDLSEGEKGDTLAELVPVEAAKKKFQRNFSDL  217



>dbj|BAA19241.1| Sucrose-Phosphate Synthase [Saccharum officinarum]
Length=1047

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 108/139 (78%), Gaps = 6/139 (4%)
 Frame = +3

Query  207  SGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERS  386
            +GAS  +  S       RG   +FNP+ YFVEEVV GVDE+DLHRTWIKVVATRN  ERS
Sbjct  11   AGASPTKAASP------RGPHMNFNPSHYFVEEVVKGVDESDLHRTWIKVVATRNARERS  64

Query  387  SRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALG  566
            +RLENMCWRIWHL RKKKQLELEG+QR++ RR E+EQ  ++ TED+ EDLSEG KGD LG
Sbjct  65   TRLENMCWRIWHLARKKKQLELEGIQRISARRKEQEQVPREPTEDLPEDLSEGHKGDTLG  124

Query  567  ETLSLESPRKKFQRNSSNL  623
            +   +E+P+KKFQRN S+L
Sbjct  125  DFPPVETPKKKFQRNFSSL  143



>gb|EEE55897.1| hypothetical protein OsJ_04561 [Oryza sativa Japonica Group]
Length=1240

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 125/197 (63%), Gaps = 42/197 (21%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA------------------------IEVESKPA-VINHRG  263
            MAGNEWINGYLEAILDSG +A                        ++  S  A   + RG
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPRSPAAGAASPRG  60

Query  264  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  443
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  444  ----------------LELEGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETL  575
                            LELEG+ R++ RR E+EQ R++ +ED++EDL EGEK D +GE  
Sbjct  121  ACIDLSLSFSFFLVFMLELEGILRISARRKEQEQVRRETSEDLAEDLFEGEKADTVGELA  180

Query  576  SLESP-RKKFQRNSSNL  623
              ++P +KKFQRN S L
Sbjct  181  QQDTPMKKKFQRNFSEL  197



>gb|EEC72045.1| hypothetical protein OsI_04951 [Oryza sativa Indica Group]
Length=1240

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 125/197 (63%), Gaps = 42/197 (21%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA------------------------IEVESKPA-VINHRG  263
            MAGNEWINGYLEAILDSG +A                        ++  S  A   + RG
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPRSPAAGAASPRG  60

Query  264  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  443
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  444  ----------------LELEGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETL  575
                            LELEG+ R++ RR E+EQ R++ +ED++EDL EGEK D +GE  
Sbjct  121  ACIDLSLSFSFFLVFMLELEGILRISARRKEQEQVRRETSEDLAEDLFEGEKADTVGELA  180

Query  576  SLESP-RKKFQRNSSNL  623
              ++P +KKFQRN S L
Sbjct  181  QQDTPMKKKFQRNFSEL  197



>sp|P31928.1|SPSA_SPIOL RecName: Full=Sucrose-phosphate synthase; AltName: Full=UDP-glucose-fructose-phosphate 
glucosyltransferase [Spinacia oleracea]
 gb|AAA20092.1| sucrose phosphate synthase [Spinacia oleracea]
Length=1056

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 118/159 (74%), Gaps = 7/159 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES-----KPAVINHRGEQGHFNPTKYFVEEVVSGVD  323
            MAGN+WIN YLEAILD G   I+  +      P  +  R E+GHF+P++YFVEEV+SG D
Sbjct  1    MAGNDWINSYLEAILDVGGQGIDASTGKTSTAPPSLLLR-ERGHFSPSRYFVEEVISGFD  59

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  +TR+  ER++RLEN+CWRIW+L RKKKQ+E E  QRLA R  ERE+GR
Sbjct  60   ETDLHRSWVRAASTRSPQERNTRLENLCWRIWNLARKKKQIEGEEAQRLAKRHVERERGR  119

Query  504  KDVTEDMSEDLSEGEKGDALGETL-SLESPRKKFQRNSS  617
            ++ T DMSEDLSEGE+GD + + L + ES + + +R SS
Sbjct  120  REATADMSEDLSEGERGDTVADMLFASESTKGRMRRISS  158



>gb|KJB65850.1| hypothetical protein B456_010G116100 [Gossypium raimondii]
 gb|KJB65851.1| hypothetical protein B456_010G116100 [Gossypium raimondii]
Length=1047

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    E +S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  ATR   ER++RLENMCWRIW+L RKKKQLE E +QR A R  ERE+GR++ T 
Sbjct  57   RSWIRAAATRGPKERNTRLENMCWRIWNLARKKKQLEGEEVQRNAKRHLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD  G+
Sbjct  117  DMSEDLSEGEKGDFPGD  133



>ref|XP_010696531.1| PREDICTED: sucrose-phosphate synthase [Beta vulgaris subsp. vulgaris]
Length=1052

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 116/159 (73%), Gaps = 6/159 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            MAGN+WIN YLEAILD G   I+  +     +        E+GHF+P++YFVEEV++G D
Sbjct  1    MAGNDWINSYLEAILDVGGQGIDASNAKTSSSSPSSLLLRERGHFSPSRYFVEEVITGFD  60

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  +TR+  ER++RLEN+CWRIW+L RKKKQ+E E  QR A R  ERE+GR
Sbjct  61   ETDLHRSWVRAASTRSPQERNTRLENLCWRIWNLARKKKQIEGEEAQRSAKRHIEREKGR  120

Query  504  KDVTEDMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            ++ T DMSEDLSEGEKGD +G+ + + +S + + +R SS
Sbjct  121  REATADMSEDLSEGEKGDTVGDMSFAGDSTKGRMRRISS  159



>ref|XP_007011815.1| Sucrose phosphate synthase 1F [Theobroma cacao]
 gb|EOY29434.1| Sucrose phosphate synthase 1F [Theobroma cacao]
Length=1050

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 113/154 (73%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G   I+V     ++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGP-GIDVAKSSLLLR---ERGHFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR   ER++RLENMCWRIW+L RKKKQLE E  QR    R ERE+GRK+ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARKKKQLEGEEAQRKVKCRLERERGRKEATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD  G+  +  +S R++  R SS
Sbjct  117  DMSEDLSEGEKGDIPGDVSAHGDSMRERMPRISS  150



>gb|ACN89831.2| sucrose phosphate synthase B3 [Medicago sativa]
Length=543

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  VVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRW  485
            VV+ VDE+DL+RTW+KVVATRNT ERSSRLENMCWRIWHL RKKKQLE E +QRLA+RRW
Sbjct  1    VVASVDESDLYRTWVKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEEVQRLANRRW  60

Query  486  EREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            EREQGR+D TEDMSEDLSEGEKGD + + +  E+PR++FQR +SNLE
Sbjct  61   EREQGRRDATEDMSEDLSEGEKGDNVVDMVQCETPRQRFQRQTSNLE  107



>ref|XP_008443934.1| PREDICTED: probable sucrose-phosphate synthase 1 [Cucumis melo]
Length=1150

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES-KPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  335
            MAGN+WIN YLEAILD G    E +S K +      E+GHF+PT+YFVEEV++G DE+DL
Sbjct  97   MAGNDWINSYLEAILDVGPGIDEAKSAKQSSSLLLRERGHFSPTRYFVEEVITGFDESDL  156

Query  336  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            +R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T
Sbjct  157  YRSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRMAKRRLEREKGRREAT  216

Query  516  EDMSEDLSEGEKGDALGET  572
             DMSEDLSEGEKGD + + 
Sbjct  217  ADMSEDLSEGEKGDIVNDV  235



>ref|XP_006478341.1| PREDICTED: probable sucrose-phosphate synthase 4-like [Citrus 
sinensis]
Length=1024

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 115/153 (75%), Gaps = 9/153 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINH----RGEQGH-FNPTKYFVEEVVSGVD  323
            MAGNEWINGYLEAILD+G+   ++      ++     + ++G  F+PTKYFVEEV++  D
Sbjct  1    MAGNEWINGYLEAILDAGSGKTKMNDGKFKLSKFEETKQKEGQLFSPTKYFVEEVINSFD  60

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            E+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  E  QRLA RR EREQGR
Sbjct  61   ESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWEDAQRLAKRRLEREQGR  120

Query  504  KDVTEDMSEDLSEG--EKGDALGETLSL-ESPR  593
             D  +D+SE LSEG  EKGD++  + SL E PR
Sbjct  121  NDAADDLSE-LSEGEKEKGDSINASESLKEIPR  152



>gb|KDO42450.1| hypothetical protein CISIN_1g001705mg [Citrus sinensis]
Length=1024

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 115/153 (75%), Gaps = 9/153 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINH----RGEQGH-FNPTKYFVEEVVSGVD  323
            MAGNEWINGYLEAILD+G+   ++      ++     + ++G  F+PTKYFVEEV++  D
Sbjct  1    MAGNEWINGYLEAILDAGSGKTKMNDGKFKLSKFEETKQKEGQLFSPTKYFVEEVINSFD  60

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            E+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  E  QRLA RR EREQGR
Sbjct  61   ESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWEDAQRLAKRRLEREQGR  120

Query  504  KDVTEDMSEDLSEG--EKGDALGETLSL-ESPR  593
             D  +D+SE LSEG  EKGD++  + SL E PR
Sbjct  121  NDAADDLSE-LSEGEKEKGDSINASESLKEIPR  152



>gb|AAC23914.1| sucrose-phosphate synthase [Musa acuminata AAA Group]
Length=502

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 117/153 (76%), Gaps = 5/153 (3%)
 Frame = +3

Query  162  AGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLHR  341
            AGN+WIN YLEAILD+G S   +++  + +  R E+G F+P +YFVEEV++G DETDL++
Sbjct  1    AGNDWINSYLEAILDAGPS---IDAAKSSLLLR-ERGRFSPARYFVEEVITGYDETDLYK  56

Query  342  TWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTED  521
            TW++  A R+  ER++RLENMCWRIW+L RKK+Q+E E  QRL+ RR ERE+ R+D T D
Sbjct  57   TWVRAAAMRSPQERNTRLENMCWRIWNLARKKEQIEGEEAQRLSKRRLEREKARRDATAD  116

Query  522  MSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            MSEDLSEGEKG+A+G+ ++  +S R +  R SS
Sbjct  117  MSEDLSEGEKGEAIGDLSVHGDSTRGRMPRISS  149



>gb|EPS71734.1| sucrose-phosphate synthase 1, partial [Genlisea aurea]
Length=1036

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 117/157 (75%), Gaps = 6/157 (4%)
 Frame = +3

Query  153  RKMAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            R MAGN+WIN YLEAILD G S I+ E KP+++    E+G F+PT+YFVEEV++G DETD
Sbjct  6    RLMAGNDWINSYLEAILDVGGSGID-EGKPSLLLR--ERGRFSPTRYFVEEVITGYDETD  62

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHR+WI+  ATR+  ER++RLENMCWRIW+L R KKQ E +  QR+A R  ERE+G ++ 
Sbjct  63   LHRSWIRAQATRSPQERNTRLENMCWRIWNLARLKKQHEEKEAQRIAKRHIERERGLREA  122

Query  513  TEDMSEDLSEGEKGDALGETLSL--ESPRKKFQRNSS  617
              DMSEDLSEGEKGDA G  LS+  ES R +  R SS
Sbjct  123  VADMSEDLSEGEKGDA-GSELSIHGESHRGRLPRISS  158



>ref|XP_006836877.1| hypothetical protein AMTR_s00099p00104230 [Amborella trichopoda]
 gb|ERM99730.1| hypothetical protein AMTR_s00099p00104230 [Amborella trichopoda]
Length=1053

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 113/160 (71%), Gaps = 6/160 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVI----NHRGEQGHFNPTKYFVEEVVSGVDE  326
            MAGNEWINGYLEAILD GA   E     A        +  +G  +PTKYFV +VV+G DE
Sbjct  1    MAGNEWINGYLEAILDVGAKLEEGSKNSAWAKLDEGSKNSKGFIDPTKYFVGQVVTGFDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            TD H+TWIKV+ATRNT ER++RLENMCWRIWHL RKKK++E +  +RLA R  +REQGRK
Sbjct  61   TDFHKTWIKVIATRNTRERNNRLENMCWRIWHLARKKKKIEWDDARRLAKRYLKREQGRK  120

Query  507  DVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            D   DMSEDLSEGEK    GE+   ++ ++   R +S+L+
Sbjct  121  DAAADMSEDLSEGEK--EKGESSLSDASKENIARINSDLQ  158



>gb|ABG67969.1| putative sucrose phosphate synthase [Gossypium hirsutum]
Length=581

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD +G+
Sbjct  117  DMSEDLSEGEKGDLVGD  133



>ref|XP_002324874.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
 gb|EEF03439.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
Length=1054

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD     ++ +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVDPGIVDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  A R+T ER++RLENMCWRIW+L RKKKQLE E  QR+A R  ERE+GRK+ T 
Sbjct  57   RSWLRAAAMRSTQERNTRLENMCWRIWNLARKKKQLEGEEAQRIAKRHLERERGRKEATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD  G+
Sbjct  117  DMSEDLSEGEKGDVPGD  133



>ref|NP_197528.1| sucrose phosphate synthase 1F [Arabidopsis thaliana]
 sp|Q94BT0.1|SPSA1_ARATH RecName: Full=Sucrose-phosphate synthase 1; AltName: Full=Sucrose-phosphate 
synthase 1F; Short=AtSPS1F; AltName: Full=Sucrose-phosphate 
synthase 5.1; Short=AtSPS5.1; AltName: Full=UDP-glucose-fructose-phosphate 
glucosyltransferase [Arabidopsis 
thaliana]
 gb|AAK64015.1| putative sucrose-phosphate synthase [Arabidopsis thaliana]
 gb|AAL85065.1| putative sucrose-phosphate synthase [Arabidopsis thaliana]
 gb|AED92824.1| sucrose phosphate synthase 1F [Arabidopsis thaliana]
 gb|AHL38616.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1043

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD G    +  S P+++    E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQGLDDARSSPSLLLR--ERGRFTPSRYFVEEVITGYDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K VATR+  ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++ T 
Sbjct  59   RSWVKAVATRSPQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLEREKGRREATA  118

Query  519  DMSEDLSEGEKGDALGE  569
            DMSE+ SEGEKGD + +
Sbjct  119  DMSEEFSEGEKGDIISD  135



>ref|XP_002873988.1| ATSPS1F [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50247.1| ATSPS1F [Arabidopsis lyrata subsp. lyrata]
Length=1045

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD G    +  S P+++    E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQGLDDARSSPSLLLR--ERGRFTPSRYFVEEVITGYDETDLH  58

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K VATR+  ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++ T 
Sbjct  59   RSWVKAVATRSPQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLEREKGRREATA  118

Query  519  DMSEDLSEGEKGDALGE  569
            DMSE+ SEGEKGD + +
Sbjct  119  DMSEEFSEGEKGDIISD  135



>ref|XP_006450383.1| hypothetical protein CICLE_v10007312mg [Citrus clementina]
 gb|ESR63623.1| hypothetical protein CICLE_v10007312mg [Citrus clementina]
Length=1054

 Score =   173 bits (439),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD G    + +S   +     E+G F+PT+YFVE+V++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEQVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QR A RR ERE+GRK+ + 
Sbjct  57   RSWIRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRKAKRRLERERGRKEASA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEG+KGD  GE
Sbjct  117  DMSEDLSEGDKGDVSGE  133



>ref|XP_006483396.1| PREDICTED: probable sucrose-phosphate synthase 1-like isoform 
X1 [Citrus sinensis]
 gb|KDO61793.1| hypothetical protein CISIN_1g001557mg [Citrus sinensis]
Length=1054

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD G    + +S   +     E+G F+PT+YFVE+V++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEQVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QR A RR ERE+GRK+ + 
Sbjct  57   RSWIRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRKAKRRLERERGRKEASA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEG+KGD  GE
Sbjct  117  DMSEDLSEGDKGDVSGE  133



>gb|AHE93347.1| sucrose phosphate synthase 1 [Camellia sinensis]
Length=1051

 Score =   173 bits (438),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVE+V++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEQVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E +QR+A RR ERE+GRK+ T 
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEVQRMAKRRLERERGRKEATA  116

Query  519  DMSEDLSEGEKGD  557
            DMSEDLSEGEKGD
Sbjct  117  DMSEDLSEGEKGD  129



>ref|XP_011036585.1| PREDICTED: probable sucrose-phosphate synthase 1 [Populus euphratica]
Length=1054

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD      + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVDPGIDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  A R+T ER++RLENMCWRIW+L RKKKQLE E  QR+A R  ERE+GRK+ T 
Sbjct  57   RSWLRAAAMRSTQERNTRLENMCWRIWNLARKKKQLEGEEAQRIAKRHLERERGRKEATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD  G+
Sbjct  117  DMSEDLSEGEKGDVPGD  133



>gb|KJB27353.1| hypothetical protein B456_004G292800 [Gossypium raimondii]
Length=937

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD +G+
Sbjct  117  DMSEDLSEGEKGDLVGD  133



>ref|XP_002515487.1| sucrose phosphate syntase, putative [Ricinus communis]
 gb|EEF46936.1| sucrose phosphate syntase, putative [Ricinus communis]
Length=1024

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 112/154 (73%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD      E +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVDPGIDEAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  A R+T ER++RLENMCWRIW+L RKKKQLE E +QR A R  ERE+GR++ T 
Sbjct  57   RSWIRAAAMRSTQERNTRLENMCWRIWNLARKKKQLEGEEVQRKAKRNVERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD  G  ++  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVHGGISVHGDSVRGRMPRISS  150



>gb|KJB27352.1| hypothetical protein B456_004G292800 [Gossypium raimondii]
Length=1048

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD +G+
Sbjct  117  DMSEDLSEGEKGDLVGD  133



>gb|KHG17450.1| Solanesyl diphosphate synthase 1 [Gossypium arboreum]
Length=1045

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD +G+
Sbjct  117  DMSEDLSEGEKGDLVGD  133



>gb|KHG17451.1| Solanesyl diphosphate synthase 1 [Gossypium arboreum]
Length=1041

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD +G+
Sbjct  117  DMSEDLSEGEKGDLVGD  133



>gb|AFM46031.1| sucrose phosphate synthase [Gossypium hirsutum]
Length=1028

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD +G+
Sbjct  117  DMSEDLSEGEKGDLVGD  133



>gb|AAF06792.1|AF194022_1 sucrose-6-phosphate synthase A [Nicotiana tabacum]
 gb|AHZ89840.1| sucrose-phosphate synthase [Nicotiana tabacum]
Length=1054

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G     +E K + +  R E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPG---IEDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  Q +A RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQWMAKRRQEREKGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD + +  S  ES + +  R SS
Sbjct  117  DMSEDLSEGEKGDVVSDIPSHGESTKGRLPRISS  150



>gb|AAC60545.2| sucrose-phosphate synthase [Spinacia oleracea]
Length=1056

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 114/159 (72%), Gaps = 7/159 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES-----KPAVINHRGEQGHFNPTKYFVEEVVSGVD  323
            MAGN+WIN YLEAILD G   I+  +      P  +  R E+GHF+P++YFVEEV+SG D
Sbjct  1    MAGNDWINSYLEAILDIGGQGIDASTGKTSTAPPSLLLR-ERGHFSPSRYFVEEVISGFD  59

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W+ +       ER++RLEN+CWRIW+L RKKKQ+E E  QRLA R  ERE+GR
Sbjct  60   ETDLHRSWVALHQLAGPQERNTRLENLCWRIWNLARKKKQIEGEEAQRLAKRHVERERGR  119

Query  504  KDVTEDMSEDLSEGEKGDALGETL-SLESPRKKFQRNSS  617
            ++ T DMSEDLSEGE+GD + + L + ES + + +R SS
Sbjct  120  REATADMSEDLSEGERGDTVADMLFASESTKGRMRRISS  158



>ref|XP_008795846.1| PREDICTED: probable sucrose-phosphate synthase 1 [Phoenix dactylifera]
Length=1053

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 112/154 (73%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            M GN+WIN YLEAILD+G  AI+      ++  RG    F+PT+YFVEEV++G DETDL+
Sbjct  1    MPGNDWINSYLEAILDAGP-AIDASKSSLLLRERGS---FSPTRYFVEEVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E   R++  R ERE+GRKDVT 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEALRMSKHRLERERGRKDVTA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVSDLSAHGDSTRGRIPRISS  150



>ref|XP_004292975.1| PREDICTED: probable sucrose-phosphate synthase 1 [Fragaria vesca 
subsp. vesca]
Length=1066

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 108/141 (77%), Gaps = 3/141 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+NGYLEAILD G    + +S  +++    E+G F+PT+YFVEEV++  DETDLH
Sbjct  1    MAGNDWVNGYLEAILDVGPGLDDAKSSSSLLLR--ERGRFSPTRYFVEEVITRYDETDLH  58

Query  339  RTWIKVVAT-RNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            R+W++  AT R+  ER++RLENMCWRIW+L RKK QLE E  QR A RR ERE GR++ T
Sbjct  59   RSWVRAAATARSAEERNTRLENMCWRIWNLARKKNQLEGEEAQRTASRRLEREMGRREAT  118

Query  516  EDMSEDLSEGEKGDALGETLS  578
            EDMSEDLSEGE  DA+G+ L+
Sbjct  119  EDMSEDLSEGESRDAVGDILA  139



>ref|XP_009774296.1| PREDICTED: probable sucrose-phosphate synthase [Nicotiana sylvestris]
Length=1054

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G     +E K + +  R E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPG---LEDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  Q +A RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQWMAKRRQEREKGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD + +  S  ES + +  R SS
Sbjct  117  DMSEDLSEGEKGDMVSDMPSHGESTKGRLPRISS  150



>gb|AGA82513.1| sucrose phosphate synthase, partial [Camellia sinensis]
Length=1051

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 114/153 (75%), Gaps = 5/153 (3%)
 Frame = +3

Query  162  AGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLHR  341
             GN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVE+V++G DETDL+R
Sbjct  2    GGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEQVITGFDETDLYR  57

Query  342  TWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTED  521
            +W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E +QR+A RR ERE+GRK+ T D
Sbjct  58   SWVRAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEVQRMAKRRLERERGRKEATAD  117

Query  522  MSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            MSEDLSEGEKGD + + +   ++ R + +R SS
Sbjct  118  MSEDLSEGEKGDTVSDLSAHGDNTRGRLRRISS  150



>ref|XP_002521744.1| sucrose phosphate syntase, putative [Ricinus communis]
 gb|EEF40554.1| sucrose phosphate syntase, putative [Ricinus communis]
Length=1021

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 104/141 (74%), Gaps = 8/141 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVI-----NHRGEQGHFNPTKYFVEEVVSGVD  323
            MAGN+WINGYLEAILD G S  +       I     +   E   F+PT+YFVEEV++  D
Sbjct  1    MAGNDWINGYLEAILDVGNSLRKRNDGKLKIAKYEESKEKEDKSFSPTRYFVEEVINSFD  60

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            E+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKK++E +  QRLA RR EREQGR
Sbjct  61   ESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKKIEWDDAQRLAKRRLEREQGR  120

Query  504  KDVTEDMSEDLSEG--EKGDA  560
             D  ED+SE LSEG  EKGDA
Sbjct  121  NDAAEDLSE-LSEGEKEKGDA  140



>ref|XP_010048168.1| PREDICTED: probable sucrose-phosphate synthase 1 [Eucalyptus 
grandis]
 gb|KCW80349.1| hypothetical protein EUGRSUZ_C01715 [Eucalyptus grandis]
Length=1040

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGNEW+N YLEAILD G +  + +S   ++    E+G F+PT+YFVE+V++G DETDLH
Sbjct  1    MAGNEWVNSYLEAILDVGPALDDPKSSSLLLR---ERGRFSPTRYFVEQVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L RKKKQLE E  QR+A RR E E+GR++ T 
Sbjct  58   RSWLRAAATRSPQERNTRLENMCWRIWNLARKKKQLEGEEAQRIAKRRLEHERGRREATA  117

Query  519  DMSEDL-SEGEKGDA  560
            DMSEDL SEGEKGD+
Sbjct  118  DMSEDLSSEGEKGDS  132



>ref|XP_010520567.1| PREDICTED: sucrose-phosphate synthase 1 [Tarenaya hassleriana]
Length=1061

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    +  S   +     E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDARSSLLL----RERGRFTPSRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K VATR+  ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++ T 
Sbjct  57   RSWVKAVATRSPQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLEREKGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSE+LSEGEKGD + +
Sbjct  117  DMSEELSEGEKGDMVSD  133



>emb|CBI21066.3| unnamed protein product [Vitis vinifera]
Length=1034

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAI+D+G +  + +S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWLNSYLEAIIDAGPNLGDAKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLENMCWRIW+L RKKKQLE E  QR+A R  + E+GR++ T 
Sbjct  57   RSWARASATRSPQERNTRLENMCWRIWNLARKKKQLEGEEAQRVAKRHIDHERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD + +
Sbjct  117  DMSEDLSEGEKGDTVSD  133



>ref|XP_007019751.1| Sucrose-phosphate synthase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY16976.1| Sucrose-phosphate synthase family protein isoform 2 [Theobroma 
cacao]
Length=1027

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 105/143 (73%), Gaps = 10/143 (7%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA-------IEVESKPAVINHRGEQGHFNPTKYFVEEVVSG  317
            MAGNEWINGYLEAILD G+         +++   P       E+  F+PTKYFVEEV++ 
Sbjct  1    MAGNEWINGYLEAILDVGSGTRKRYDGQLKIAKFPEHKVQVKEEKVFSPTKYFVEEVINS  60

Query  318  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  497
             DE+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  +RLA RR EREQ
Sbjct  61   FDESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDARRLAKRRLEREQ  120

Query  498  GRKDVTEDMSEDLSEG--EKGDA  560
            GR D  +D+SE LSEG  EKGD+
Sbjct  121  GRNDAADDLSE-LSEGEKEKGDS  142



>ref|XP_002282808.1| PREDICTED: probable sucrose-phosphate synthase 1 [Vitis vinifera]
Length=1058

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAI+D+G +  + +S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWLNSYLEAIIDAGPNLGDAKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLENMCWRIW+L RKKKQLE E  QR+A R  + E+GR++ T 
Sbjct  57   RSWARASATRSPQERNTRLENMCWRIWNLARKKKQLEGEEAQRVAKRHIDHERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD + +
Sbjct  117  DMSEDLSEGEKGDTVSD  133



>ref|XP_007019750.1| Sucrose-phosphate synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16975.1| Sucrose-phosphate synthase family protein isoform 1 [Theobroma 
cacao]
Length=1024

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 105/143 (73%), Gaps = 10/143 (7%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASA-------IEVESKPAVINHRGEQGHFNPTKYFVEEVVSG  317
            MAGNEWINGYLEAILD G+         +++   P       E+  F+PTKYFVEEV++ 
Sbjct  1    MAGNEWINGYLEAILDVGSGTRKRYDGQLKIAKFPEHKVQVKEEKVFSPTKYFVEEVINS  60

Query  318  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  497
             DE+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  +RLA RR EREQ
Sbjct  61   FDESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDARRLAKRRLEREQ  120

Query  498  GRKDVTEDMSEDLSEG--EKGDA  560
            GR D  +D+SE LSEG  EKGD+
Sbjct  121  GRNDAADDLSE-LSEGEKEKGDS  142



>dbj|BAP47500.1| sucrose phosphate synthase [Gentiana triflora]
Length=1048

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 109/154 (71%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEVVSG DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVVSGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QRL  R  ERE+GR++   
Sbjct  57   RSWIRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQRLKKRHLEREKGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLSL-ESPRKKFQRNSS  617
            DMSE+LSEGEKGD   +     ES R +  R SS
Sbjct  117  DMSEELSEGEKGDVSADVSGHGESHRGRLPRISS  150



>gb|KDP31602.1| hypothetical protein JCGZ_14827 [Jatropha curcas]
Length=1016

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVI-----NHRGEQGHFNPTKYFVEEVVSGVD  323
            MAGN+WINGYLEAILD G+S  +       I     +   E   FNPTKYFVEEVV+  D
Sbjct  1    MAGNDWINGYLEAILDVGSSLRKRNDGKVKIAKFEESKEKEDKLFNPTKYFVEEVVNSFD  60

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            E+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  QRLA R+ EREQGR
Sbjct  61   ESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDAQRLARRQLEREQGR  120

Query  504  KDVTEDMSEDLSEGEK  551
             D  +D+SE LSEGEK
Sbjct  121  DDAEDDLSE-LSEGEK  135



>ref|XP_002319320.2| sucrose-phosphate synthase family protein [Populus trichocarpa]
 gb|EEE95243.2| sucrose-phosphate synthase family protein [Populus trichocarpa]
Length=1020

 Score =   168 bits (426),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 100/135 (74%), Gaps = 5/135 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES----KPAVINHRGEQGHFNPTKYFVEEVVSGVDE  326
            MA NEWINGYLEAILD G+  ++  S    K A      E   F+P KYFVEEV++  DE
Sbjct  1    MARNEWINGYLEAILDVGSGVMKKRSDGRLKIAKFQQVKEDKLFSPIKYFVEEVINSFDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            +DLHRTW+K++ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  QRLA RR EREQGR 
Sbjct  61   SDLHRTWVKMIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDAQRLAKRRLEREQGRN  120

Query  507  DVTEDMSEDLSEGEK  551
            D  +D+SE LSEGEK
Sbjct  121  DAADDLSE-LSEGEK  134



>gb|KDP33569.1| hypothetical protein JCGZ_07140 [Jatropha curcas]
Length=1055

 Score =   168 bits (426),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 105/145 (72%), Gaps = 14/145 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHR-----GEQGHFNPTKYFVEEVVSGVD  323
            MAGN+WIN YL+AILD           P + N +      E+G F+PT+YFVEEV++G D
Sbjct  1    MAGNDWINSYLDAILDV---------DPGIDNAKLSLLLRERGRFSPTRYFVEEVITGFD  51

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  A R+T ER++RLENMCWRIW+L RKKKQLE E LQR   R+ ERE+GR
Sbjct  52   ETDLHRSWLRAAAMRSTQERNTRLENMCWRIWNLARKKKQLEGEELQRKNKRQLERERGR  111

Query  504  KDVTEDMSEDLSEGEKGDALGETLS  578
            ++ T DMSEDLSEGEKGD  G+  S
Sbjct  112  REATADMSEDLSEGEKGDVHGDISS  136



>emb|CDY45096.1| BnaA02g04800D [Brassica napus]
Length=972

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 108/138 (78%), Gaps = 4/138 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD G    +  ++P+++    E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQPLDD--ARPSLLLR--ERGRFTPSRYFVEEVITGYDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            ++W K VATR+T ER++RLENMCWRIW+L R+KKQ E +  QRLA R  ERE+GR+++T+
Sbjct  57   KSWTKAVATRSTQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRPLERERGRREITD  116

Query  519  DMSEDLSEGEKGDALGET  572
            DMSE+ SEGEKGD + + 
Sbjct  117  DMSEEFSEGEKGDIVSDV  134



>ref|XP_011011070.1| PREDICTED: probable sucrose-phosphate synthase 4 [Populus euphratica]
Length=1020

 Score =   167 bits (424),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 100/135 (74%), Gaps = 5/135 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES----KPAVINHRGEQGHFNPTKYFVEEVVSGVDE  326
            MA NEWINGYLEAILD G+  ++  S    K A      E   F+P KYFVEEV++  DE
Sbjct  1    MARNEWINGYLEAILDVGSGIMKKRSDGRLKIAKFQQVKEDKLFSPIKYFVEEVINSFDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            +DLHRTW+K++ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  QRLA RR EREQGR 
Sbjct  61   SDLHRTWVKMIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDAQRLAKRRLEREQGRN  120

Query  507  DVTEDMSEDLSEGEK  551
            D  +D+SE LSEGEK
Sbjct  121  DAADDLSE-LSEGEK  134



>gb|ADG01611.1| sucrose phosphate synthase [Xerophyta humilis]
Length=1062

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 104/138 (75%), Gaps = 5/138 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILDSG   I+ + +  ++    E+G F+PT YFVEEV+SG DETDL+
Sbjct  1    MAGNDWINSYLEAILDSGR--IDGDKQSLLLR---ERGRFSPTAYFVEEVISGFDETDLY  55

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            ++W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  Q  A RR ERE+ R++   
Sbjct  56   KSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQHSAKRRLEREKARREAAA  115

Query  519  DMSEDLSEGEKGDALGET  572
            DMSEDLSEGEKGD  G+ 
Sbjct  116  DMSEDLSEGEKGDHAGDA  133



>ref|XP_010252403.1| PREDICTED: probable sucrose-phosphate synthase 4 [Nelumbo nucifera]
Length=1054

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 117/182 (64%), Gaps = 27/182 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES------------KPAVINHRGEQGH---------  275
            MAGNEWINGYLEAILD+G SA +               +P  I++R E+           
Sbjct  1    MAGNEWINGYLEAILDAGISATKSRKNGGGGGGHDRSFRPGRISNRKEESEEKESKVEET  60

Query  276  ----FNPT-KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKK  440
                F+PT KYFVEEVV+  DE+DLHRTWI V+ATRNT ER++RLENMCWRIWHL RKKK
Sbjct  61   NLSLFSPTTKYFVEEVVNSFDESDLHRTWIAVIATRNTRERNNRLENMCWRIWHLVRKKK  120

Query  441  QLELEGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSN  620
            Q+E +  QRLA RR EREQGR D  ED+SE LSEGEK        + +S   K  R +S+
Sbjct  121  QIEWDDAQRLAKRRIEREQGRNDAAEDLSE-LSEGEKEKGGANNQNDQSVSDKIPRINSD  179

Query  621  LE  626
            ++
Sbjct  180  MQ  181



>ref|XP_010099850.1| putative sucrose-phosphate synthase 1 [Morus notabilis]
 gb|EXB80727.1| putative sucrose-phosphate synthase 1 [Morus notabilis]
Length=1072

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 4/153 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD G +  + +S   +     E+GHF+PT+YFVEEV++G DETDL+
Sbjct  1    MAGNDWVNSYLEAILDVGPNLDDAKSSLLL----RERGHFSPTRYFVEEVITGYDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L RKKKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQLEGEEAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD LGE    +S + +  R SS
Sbjct  117  DMSEDLSEGEKGDTLGEIAHGDSTKGRLPRISS  149



>ref|XP_010062352.1| PREDICTED: probable sucrose-phosphate synthase 4 [Eucalyptus 
grandis]
 gb|KCW69478.1| hypothetical protein EUGRSUZ_F02931 [Eucalyptus grandis]
Length=1031

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 115/170 (68%), Gaps = 17/170 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE--------------VESKPAVINHRGEQGHFNPTKYF  296
            MAGNEWINGYLEAILD+G   ++              V +     N R E   F+PT+YF
Sbjct  1    MAGNEWINGYLEAILDAGRYNVKRRGDGKIGGGGKGGVVATEFDGNER-EGSLFSPTRYF  59

Query  297  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  476
            VEEVV+  DE+DLH+TWIKV+ATRNT ER++RLENMCWRIWHL RKKKQ+  +  QRLA 
Sbjct  60   VEEVVNSFDESDLHKTWIKVIATRNTRERNNRLENMCWRIWHLARKKKQIAWDDAQRLAK  119

Query  477  RRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            RR EREQGR +  +D+SE LSEGEK    G + S E  + K  R +S+L+
Sbjct  120  RRLEREQGRSEAADDLSE-LSEGEKEKGDG-SHSPEPAKDKIARINSDLQ  167



>gb|AJG44460.1| sucrose phosphate synthase, partial [Lilium davidii var. unicolor]
Length=197

 Score =   154 bits (389),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 104/142 (73%), Gaps = 5/142 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            MAGN+WIN YLEAILDSG   I     P     +      E+G F+PT+YFVEEV++G D
Sbjct  1    MAGNDWINSYLEAILDSGGPGIADAGGPGNAASKKSLLLRERGRFSPTRYFVEEVITGFD  60

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDL+++W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E   R + RR ERE+GR
Sbjct  61   ETDLYKSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEALRQSKRRLERERGR  120

Query  504  KDVTEDMSEDLSEGEKGDALGE  569
            +D T DMSEDLSEGEKGD + +
Sbjct  121  RDATADMSEDLSEGEKGDVVSD  142



>ref|XP_009348252.1| PREDICTED: LOW QUALITY PROTEIN: probable sucrose-phosphate synthase 
4, partial [Pyrus x bretschneideri]
Length=630

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 112/163 (69%), Gaps = 11/163 (7%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQ--------GHFNPTKYFVEEVVS  314
            MAGN+W+NGYLEAILD+G +  + +     I+   E+          FNPTKYFVEEVV+
Sbjct  1    MAGNDWLNGYLEAILDAGNNMRKRDDGRQKISKFEEKFEEQVKADKFFNPTKYFVEEVVN  60

Query  315  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  494
              DE++LHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  +RL  RR +RE
Sbjct  61   SFDESELHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDARRLVKRRLDRE  120

Query  495  QGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            QGR D  +D+SE LSEGEK    G+  S E   K   R+ S++
Sbjct  121  QGRHDAEDDLSE-LSEGEK--EKGDVSSAEPTVKDVLRSKSDM  160



>gb|AAN11294.1| sucrose phosphate synthase [Oncidium hybrid cultivar]
Length=1061

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 119/154 (77%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD+G S   +++  + +  R E+G F+PTKYFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGPS---IDASKSSLLLR-ERGRFSPTKYFVEEVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            ++W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QRL+ RR ERE+GR+D T 
Sbjct  57   KSWLRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRLSKRRLERERGRRDATA  116

Query  519  DMSEDLSEGEKGDALGETLSL-ESPRKKFQRNSS  617
            DMSEDLSEGEKGD +GE  S  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGELSSHGDSSRGRMHRISS  150



>ref|XP_002871456.1| ATSPS2F [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47715.1| ATSPS2F [Arabidopsis lyrata subsp. lyrata]
Length=1044

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 112/160 (70%), Gaps = 8/160 (5%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            M GN+W+N YLEAIL +    I     P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MVGNDWVNSYLEAIL-AAEPGIGNSKSPGIGNSKSSLLLRERGHFSPTRYFVEEVITGFD  59

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+ R
Sbjct  60   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKREAKRQREREKAR  119

Query  504  KDVTEDMSEDLSEGEKGDALGE--TLSLESPRKKFQRNSS  617
            ++VT +MSED SEGEK D  GE  TLS  + + +  R SS
Sbjct  120  REVTAEMSEDFSEGEKADLPGEIPTLSDNNTKGRMSRISS  159



>ref|XP_010241591.1| PREDICTED: probable sucrose-phosphate synthase 1 [Nelumbo nucifera]
Length=1063

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 4/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    E +S   ++    E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSSSLLLR---ERGRFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR   ER++RLENMCWRIW+L RKKKQ+E E  QR+A  R ERE+GR++ T 
Sbjct  58   RSWVRAAATRGPKERNTRLENMCWRIWNLARKKKQIEGEEAQRMAKHRLERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGDA G+ +   +S R +  R SS
Sbjct  118  DMSEDLSEGEKGDAAGDISAHGDSNRGRMPRISS  151



>ref|XP_010456485.1| PREDICTED: probable sucrose-phosphate synthase 2 [Camelina sativa]
Length=953

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 111/160 (69%), Gaps = 16/160 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            M GN+W+N YLEAIL          ++P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MVGNDWVNSYLEAIL---------AAEPGIGNSKSSLLLRERGHFSPTRYFVEEVITGFD  51

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+ R
Sbjct  52   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKRAAKRQLEREKAR  111

Query  504  KDVTEDMSEDLSEGEKGDALGE--TLSLESPRKKFQRNSS  617
            ++VT DMSED SEGEK D  GE  T S  + + +  R SS
Sbjct  112  REVTADMSEDFSEGEKADLPGEIPTPSDSNTKGRMSRISS  151



>gb|KFK25382.1| hypothetical protein AALP_AA8G106300 [Arabis alpina]
Length=1060

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 108/142 (76%), Gaps = 8/142 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            MAGN+W+N YL+AIL   A+   + ++P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MAGNDWVNSYLDAIL---AAEPGLAAEPRIGNPKSSLLLRERGHFSPTRYFVEEVITGFD  57

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E + ++R+A R  ERE+ R
Sbjct  58   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNVKRVAKRNLEREKAR  117

Query  504  KDVTEDMSEDLSEGEKGDALGE  569
            K+++ DMSED SEGEK D  GE
Sbjct  118  KEMSVDMSEDFSEGEKADLHGE  139



>ref|XP_010419666.1| PREDICTED: probable sucrose-phosphate synthase 2 [Camelina sativa]
Length=1039

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 111/160 (69%), Gaps = 16/160 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            M GN+W+N YLEAIL          ++P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MVGNDWVNSYLEAIL---------AAEPGIGNSKSSLLLRERGHFSPTRYFVEEVITGFD  51

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+ R
Sbjct  52   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKRAAKRQLEREKAR  111

Query  504  KDVTEDMSEDLSEGEKGDALGE--TLSLESPRKKFQRNSS  617
            ++VT DMSED SEGEK D  GE  T S  + + +  R SS
Sbjct  112  REVTADMSEDFSEGEKADLPGEIPTPSDSNTKGRMSRISS  151



>ref|XP_010491806.1| PREDICTED: probable sucrose-phosphate synthase 2 [Camelina sativa]
Length=1039

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 111/160 (69%), Gaps = 16/160 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            M GN+W+N YLEAIL          ++P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MVGNDWVNSYLEAIL---------AAEPGIGNSKSSLLLRERGHFSPTRYFVEEVITGFD  51

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+ R
Sbjct  52   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKRAAKRQLEREKAR  111

Query  504  KDVTEDMSEDLSEGEKGDALGE--TLSLESPRKKFQRNSS  617
            ++VT DMSED SEGEK D  GE  T S  + + +  R SS
Sbjct  112  REVTADMSEDFSEGEKADLPGEIPTPSDSNTKGRMSRISS  151



>ref|XP_008381670.1| PREDICTED: probable sucrose-phosphate synthase 4 [Malus domestica]
Length=1024

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGH----FNPTKYFVEEVVSGVDE  326
            MAGN+W+NGYLEAILD+G +  +       I    EQ      F+PTKYFVEEVV+  DE
Sbjct  1    MAGNDWLNGYLEAILDAGNNTRKRNDGRQKIAKFEEQVKAEKLFSPTKYFVEEVVNSFDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            ++LHRTW+KV+ATRNT E S+RLENMCWRIWHL RKKKQ+  +  QRL  RR EREQGR 
Sbjct  61   SELHRTWVKVIATRNTRESSNRLENMCWRIWHLARKKKQIAWDDAQRLVKRRLEREQGRN  120

Query  507  DVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            D  +D+SE LSEGEK    G+  S E   K   R  S++
Sbjct  121  DAEDDLSE-LSEGEK--EKGDMSSAEPSVKDILRTKSDM  156



>ref|NP_001289997.1| probable sucrose-phosphate synthase [Beta vulgaris subsp. vulgaris]
 sp|P49031.1|SPSA_BETVU RecName: Full=Probable sucrose-phosphate synthase; AltName: Full=UDP-glucose-fructose-phosphate 
glucosyltransferase [Beta 
vulgaris]
 emb|CAA57500.1| sucrose-phosphate synthase [Beta vulgaris subsp. vulgaris]
Length=1045

 Score =   162 bits (410),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 105/146 (72%), Gaps = 5/146 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR   RR E E+GR++ T 
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLENEEAQRKTKRRMELERGRREATA  116

Query  519  DMSEDLSEGEKG-DALGETLSLESPR  593
            DMSEDLSEGEK   A G++     PR
Sbjct  117  DMSEDLSEGEKDISAHGDSTRPRLPR  142



>ref|NP_001267857.1| sucrose-phosphate synthase 1 [Vitis vinifera]
 gb|AAW82754.1| sucrose-phosphate synthase 1 [Vitis vinifera]
Length=1043

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 116/182 (64%), Gaps = 30/182 (16%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGAS-----AIEVESKPAVINHRGEQGH----------------  275
            MAGNEWINGYLEAILD+G+S      +E   + +   + G +                  
Sbjct  1    MAGNEWINGYLEAILDAGSSRNGLRVVEDGDEKSNSKNNGSRRRRFVEGKVRIGRLEEKE  60

Query  276  ------FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKK  437
                  FNPTKYFVEEVV+  DE+DLHRTWIKV+ATRN+ +RS+RLENMCWRIWHL RKK
Sbjct  61   KEKEEVFNPTKYFVEEVVNSFDESDLHRTWIKVIATRNSRDRSNRLENMCWRIWHLARKK  120

Query  438  KQLELEGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSS  617
            KQ+  +  QRL  RR EREQGR D  +D+SE LSEGEK    G+   +E  +++  R +S
Sbjct  121  KQIAWDDAQRLTKRRLEREQGRHDAADDLSE-LSEGEKEK--GDPNQIEPVKEQMTRINS  177

Query  618  NL  623
            ++
Sbjct  178  DM  179



>gb|AAG01888.1| sucrose phosphate synthase [Ipomoea batatas]
Length=226

 Score =   152 bits (384),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 110/151 (73%), Gaps = 10/151 (7%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGRGIDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+ ++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QRLA RR ERE+GR++   
Sbjct  57   RSRVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQRLAKRRQERERGRREAVA  116

Query  519  DMSEDLSEGEKGDAL------GETLSLESPR  593
            DMSEDLSEGEKGDA+      GE++    PR
Sbjct  117  DMSEDLSEGEKGDAISDISAHGESIKGRLPR  147



>ref|XP_008348712.1| PREDICTED: probable sucrose-phosphate synthase 4 [Malus domestica]
Length=1024

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 110/159 (69%), Gaps = 7/159 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGH----FNPTKYFVEEVVSGVDE  326
            MAGN+W+NGYLEAILD+G +  + +     I+   EQ      FNPTKYFVEEVV+  DE
Sbjct  1    MAGNDWLNGYLEAILDAGNNTRKRDDGRQKISKFEEQVKAEKLFNPTKYFVEEVVNSFDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            ++LHRTWIKV+ATRN+ E S+RLEN CWRIWHL RKKKQ+  +  QRL  RR +REQGR+
Sbjct  61   SELHRTWIKVIATRNSREHSNRLENTCWRIWHLARKKKQMAWDDAQRLVKRRLDREQGRR  120

Query  507  DVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
            D  +D+SE LSEGEK    G+    E   K   R+ S++
Sbjct  121  DAEDDLSE-LSEGEK--EKGDVSCAEPTVKDILRSKSDM  156



>emb|CDX94270.1| BnaC02g29300D [Brassica napus]
Length=473

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 111/164 (68%), Gaps = 10/164 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH-------FNPTKYFVEEVVS  314
            MA NEWIN YLEAILD G S  +  ES   ++   G+          F+P KYFVEEVV+
Sbjct  1    MARNEWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKEPQEKVFSPIKYFVEEVVN  60

Query  315  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  494
              DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +   RL+ RR ERE
Sbjct  61   SFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWDDGIRLSKRRDERE  120

Query  495  QGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            +GR D  ED+SE LSEGEK  +   T +LE PR +  R  S ++
Sbjct  121  KGRNDAEEDLSE-LSEGEKEKSDAVT-TLEPPRDQMPRIRSEMQ  162



>gb|AEG78833.1| sucrose phosphate synthase [Dendrobium catenatum]
Length=1061

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 116/154 (75%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD+G  AI+      ++    E+G F+PTKYFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGP-AIDASKSSLLLR---ERGRFSPTKYFVEEVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            ++W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QRL+ RR ERE+GR+D T 
Sbjct  57   KSWLRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRLSKRRLERERGRRDATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD + E  S  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDTVSELSSHGDSTRGRMPRISS  150



>ref|XP_009340653.1| PREDICTED: probable sucrose-phosphate synthase 1 [Pyrus x bretschneideri]
 ref|XP_009340654.1| PREDICTED: probable sucrose-phosphate synthase 1 [Pyrus x bretschneideri]
Length=1055

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 119/154 (77%), Gaps = 4/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWTLARQKKQLEGEEAQRMAKRRLERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+ +   +S R K  R +S
Sbjct  118  DMSEDLSEGEKGDLVGDISAHGDSHRSKLPRINS  151



>ref|XP_011093228.1| PREDICTED: probable sucrose-phosphate synthase 1 [Sesamum indicum]
Length=1044

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD   + I+ +    ++    E+G F+P +YFVEEV++G +ETDLH
Sbjct  1    MAGNDWINSYLEAILDVD-TGIDDQKSSLLLR---ERGRFSPAQYFVEEVITGFNETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  + RN+ ER++RLENMCWRIW L R+KKQ+E E  QR A R  ERE+ R++ T 
Sbjct  57   RSWVRASSIRNSEERNTRLENMCWRIWTLARRKKQIEGEEAQRRAKRHLEREKARREATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+ +   +  +   QR SS
Sbjct  117  DMSEDLSEGEKGDIVGDISAHADIAKGSMQRVSS  150



>ref|XP_006582436.1| PREDICTED: probable sucrose-phosphate synthase 4-like isoform 
X2 [Glycine max]
Length=582

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 101/139 (73%), Gaps = 10/139 (7%)
 Frame = +3

Query  162  AGNEWINGYLEAILDSGASAIEVESKPAVIN--------HRGEQGHFNPT-KYFVEEVVS  314
            A NEW+NGYLEAILD G+S  E ++   V N        H+ E+  FNPT KYFVEEVV+
Sbjct  3    AVNEWLNGYLEAILDVGSSVKEKKNDGKVKNFAKFEQEKHQREEKLFNPTTKYFVEEVVN  62

Query  315  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  494
              +E DL+RTW+KV A RNT ERS+RLENMCWRIWHLTRKKKQ+  +  QRLA +R +RE
Sbjct  63   SFNEHDLYRTWVKVTARRNTRERSNRLENMCWRIWHLTRKKKQIAWDDAQRLARKRLDRE  122

Query  495  QGRKDVTEDMSEDLSEGEK  551
            QGR D   D+SE LSEGEK
Sbjct  123  QGRNDAANDLSE-LSEGEK  140



>ref|XP_010250236.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X1 [Nelumbo 
nucifera]
Length=1061

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    E +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+ +   +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGDISAHGDSNRGRLPRISS  150



>ref|XP_010250237.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X2 [Nelumbo 
nucifera]
Length=980

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    E +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+ +   +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGDISAHGDSNRGRLPRISS  150



>ref|XP_009418507.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1061

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 118/154 (77%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD+G S   +++  + +  R E+G F+P +YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGPS---IDAAKSSLLLR-ERGRFSPARYFVEEVITGYDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E  QRL+ RR ERE+ R+D T 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRLSKRRLERERARRDATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKG+A+G+ ++  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGEAIGDLSVHGDSTRGRMPRISS  150



>ref|XP_009418508.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1049

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 118/154 (77%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD+G S   +++  + +  R E+G F+P +YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGPS---IDAAKSSLLLR-ERGRFSPARYFVEEVITGYDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E  QRL+ RR ERE+ R+D T 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRLSKRRLERERARRDATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKG+A+G+ ++  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGEAIGDLSVHGDSTRGRMPRISS  150



>ref|XP_008786458.1| PREDICTED: probable sucrose-phosphate synthase 4 [Phoenix dactylifera]
Length=1040

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 8/137 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGAS---AIEVESKPAVINH----RGEQGHFNPTKYFVEEVVSG  317
            MAGNEW+NGYLEAILD+GA         S P+ +       G++  ++PTKYFVEEVV  
Sbjct  1    MAGNEWLNGYLEAILDAGAKRSVGSRQRSHPSALEKEELGNGKEPGYSPTKYFVEEVVDR  60

Query  318  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  497
             DETDLH+TWIKVVATRN+ ERS+RLEN+CWRIWHL RKKKQ++ +  QRLA RR E+ +
Sbjct  61   CDETDLHKTWIKVVATRNSQERSNRLENLCWRIWHLARKKKQIKRDDAQRLAKRREEQRR  120

Query  498  GRKDVTEDMSEDLSEGE  548
            G KD  ED+SE LSE E
Sbjct  121  GSKDAAEDISE-LSEEE  136



>gb|EYU32355.1| hypothetical protein MIMGU_mgv1a000596mg [Erythranthe guttata]
Length=1050

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 108/156 (69%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILD--SGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            MAGN+WIN YLEAILD  +G       +  +      E+G F+P +YFVEEV++G +ETD
Sbjct  1    MAGNDWINSYLEAILDVDTGGINDNNNNNKSSSLLLRERGRFSPAQYFVEEVITGFNETD  60

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHR+W++  + RN+ ER++RLENMCWRIW L RKKKQ+E+E  QR   RR ERE   ++ 
Sbjct  61   LHRSWVRASSIRNSEERNTRLENMCWRIWTLARKKKQIEVEESQRRTKRRLERENAHREA  120

Query  513  TEDMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            T DMSEDLSEGEKGD + + ++  +S R +  R SS
Sbjct  121  TADMSEDLSEGEKGDTVCDISVRGDSVRGRMPRVSS  156



>ref|XP_009404836.1| PREDICTED: probable sucrose-phosphate synthase 4 [Musa acuminata 
subsp. malaccensis]
Length=1043

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 110/169 (65%), Gaps = 23/169 (14%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGA-------------SAIEVESKPAVINHRGEQGHFNPTKYFV  299
            MAGNEWINGYLEAILD+G              SA++     +  +  G    ++PTKYFV
Sbjct  1    MAGNEWINGYLEAILDAGPKQPLRLRDRNFSFSALKQLVVRSASSGGGGVERYSPTKYFV  60

Query  300  EEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHR  479
            EEVVS  D+ DLH+TW KVVATRN+ ER++RLENMCWRIWHL RKKKQ++ E  QRL+ +
Sbjct  61   EEVVSRFDDADLHKTWTKVVATRNSQERNNRLENMCWRIWHLARKKKQIQWEEAQRLSKK  120

Query  480  RWEREQGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            R EREQG KD   D+SE LSEGEK         +E P+    R +S ++
Sbjct  121  RREREQGSKDAAADISE-LSEGEK---------VEPPKDSMPRINSEMK  159



>gb|AAP94624.1| sucrose phosphate synthase [Viscum album subsp. album]
Length=1019

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 109/153 (71%), Gaps = 7/153 (5%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD+     + +S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNCYLEAILDADPGIGDAKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R KKQLE +  +R A    +RE+GR +   
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARTKKQLEGDAARRKAKHHLDRERGRXEAAA  116

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSS  617
            DMS DLSEGEKGD  G+ LS  S R +F R SS
Sbjct  117  DMS-DLSEGEKGDFTGD-LSAHSDR-RFPRISS  146



>ref|XP_008336979.1| PREDICTED: probable sucrose-phosphate synthase 1 [Malus domestica]
Length=1055

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 119/154 (77%), Gaps = 4/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRLERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   +S R K  R +S
Sbjct  118  DMSEDLSEGEKGDLVSDISAHGDSHRSKLPRINS  151



>ref|XP_009358563.1| PREDICTED: probable sucrose-phosphate synthase 1 [Pyrus x bretschneideri]
Length=1055

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 119/154 (77%), Gaps = 4/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRLERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   +S R K  R +S
Sbjct  118  DMSEDLSEGEKGDLVSDISAHGDSHRSKLPRINS  151



>emb|CDY41124.1| BnaA02g23460D [Brassica napus]
Length=1047

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 111/164 (68%), Gaps = 10/164 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH-------FNPTKYFVEEVVS  314
            MA NEWIN YLEAILD G S  +  ES   ++   G+          F+P KYFVEEVV+
Sbjct  1    MARNEWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKEPQEKVFSPIKYFVEEVVN  60

Query  315  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  494
              DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +   RL+ RR ERE
Sbjct  61   SFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWDDGIRLSKRRDERE  120

Query  495  QGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            +GR D  ED+SE LSEGEK  +   T +LE PR +  R  S ++
Sbjct  121  KGRNDAEEDLSE-LSEGEKEKSDAVT-TLEPPRDQMPRIRSEMQ  162



>ref|XP_006399612.1| hypothetical protein EUTSA_v10012643mg [Eutrema salsugineum]
 gb|ESQ41065.1| hypothetical protein EUTSA_v10012643mg [Eutrema salsugineum]
Length=881

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 104/137 (76%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+P++YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPSRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KK++E +  +R A R+ ER++ RK+VT 
Sbjct  57   RSWVQAAATRSPQERNTRLENLCWRIWNLARQKKKVEGKNAKRAAKRQLERDKARKEVTA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSED SEGEK D  GE
Sbjct  117  DMSEDFSEGEKADLPGE  133



>ref|XP_009128722.1| PREDICTED: probable sucrose-phosphate synthase 4 [Brassica rapa]
Length=1029

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 111/164 (68%), Gaps = 10/164 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH-------FNPTKYFVEEVVS  314
            MA NEWIN YLEAILD G S  +  ES   ++   G+          F+P KYFVEEVV+
Sbjct  1    MARNEWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKEPQEKVFSPIKYFVEEVVN  60

Query  315  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  494
              DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +   RL+ RR ERE
Sbjct  61   SFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWDDGIRLSKRRDERE  120

Query  495  QGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            +GR D  ED+SE LSEGEK  +   T +LE PR +  R  S ++
Sbjct  121  KGRNDAEEDLSE-LSEGEKEKSDAVT-TLEPPRDQMPRIRSEMQ  162



>emb|CDX78411.1| BnaA03g03230D [Brassica napus]
Length=1039

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 111/155 (72%), Gaps = 6/155 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+P++YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPSRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KK++E +  +R A R   RE+ RK+VT 
Sbjct  57   RSWVQAAATRSPQERNTRLENLCWRIWNLARQKKKVEGKNAKRAAKRHLLREKARKEVTA  116

Query  519  DMSEDLSEGEKGDALGE--TLSLESPRKKFQRNSS  617
            DMSED SEGEK D  GE  TLS  + + +  R SS
Sbjct  117  DMSEDFSEGEKADVPGEIPTLSDGNTKGRMSRVSS  151



>ref|XP_006659287.1| PREDICTED: probable sucrose-phosphate synthase 4-like [Oryza 
brachyantha]
Length=1070

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 111/173 (64%), Gaps = 20/173 (12%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG------------------EQGHFNP  284
            MAGN+WIN YLEAILD+G +A E+ +        G                  E+G F+P
Sbjct  1    MAGNDWINSYLEAILDAGGAAQEISAAAGAGAGAGGDGAAAAEKRDKSSLMLRERGRFSP  60

Query  285  TKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQ  464
             +YFVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   
Sbjct  61   ARYFVEEVISGFDETDLYKTWVRTAAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEAS  120

Query  465  RLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGETLSL--ESPRKKFQRNSS  617
            RLA +R ERE+ R+    DMSEDLSEGEKG+ + E+ S+  ES R +  R  S
Sbjct  121  RLAKQRLEREKARRYAAADMSEDLSEGEKGENINESSSIHDESTRGRMPRIGS  173



>ref|XP_009131196.1| PREDICTED: probable sucrose-phosphate synthase 2 [Brassica rapa]
Length=1039

 Score =   159 bits (401),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 111/155 (72%), Gaps = 6/155 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+P++YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPSRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KK++E +  +R A R   RE+ RK+VT 
Sbjct  57   RSWVQAAATRSPQERNTRLENLCWRIWNLARQKKKVEGKNAKRAAKRHLLREKARKEVTA  116

Query  519  DMSEDLSEGEKGDALGE--TLSLESPRKKFQRNSS  617
            DMSED SEGEK D  GE  TLS  + + +  R SS
Sbjct  117  DMSEDFSEGEKADVPGEIPTLSDGNTKGRMSRVSS  151



>ref|XP_007199693.1| hypothetical protein PRUPE_ppa000716mg [Prunus persica]
 gb|EMJ00892.1| hypothetical protein PRUPE_ppa000716mg [Prunus persica]
Length=1025

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 4/128 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQ----GHFNPTKYFVEEVVSGVDE  326
            MAGN+W+NGYLEAILD+G++  ++      I    EQ      F+PTKYFVEEV++  DE
Sbjct  1    MAGNDWLNGYLEAILDAGSNTRKMNDGRVKIAKFEEQVKEEKMFSPTKYFVEEVINSFDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            +DLHRTW+KV+ATRNT ERS+RLEN CWRIWHL RKKKQ+  +  +RLA RR EREQGR 
Sbjct  61   SDLHRTWVKVIATRNTRERSNRLENTCWRIWHLARKKKQIAWDDARRLAKRRLEREQGRH  120

Query  507  DVTEDMSE  530
            D  +D+SE
Sbjct  121  DAEDDLSE  128



>sp|O22060.1|SPSA1_CITUN RecName: Full=Probable sucrose-phosphate synthase 1; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase 1 [Citrus 
unshiu]
 dbj|BAA23213.1| sucrose-phosphate synthase [Citrus unshiu]
Length=1057

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD + +  +  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDIVSDVSAHGDSTRSRLPRISS  150



>ref|XP_006397097.1| hypothetical protein EUTSA_v10028384mg [Eutrema salsugineum]
 gb|ESQ38550.1| hypothetical protein EUTSA_v10028384mg [Eutrema salsugineum]
Length=1029

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 110/164 (67%), Gaps = 10/164 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH-------FNPTKYFVEEVVS  314
            MA NEWIN YLEAILD G S  +  ES   ++   G+          F+P KYFVEEVV+
Sbjct  1    MARNEWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKEHQEKVFSPIKYFVEEVVN  60

Query  315  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  494
              DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +   RL+ RR ERE
Sbjct  61   SFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWDDGIRLSKRRDERE  120

Query  495  QGRKDVTEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNLE  626
            QGR D  ED+SE LSEGEK  +   T +LE PR    R  S ++
Sbjct  121  QGRNDAEEDLSE-LSEGEKEKSDVVT-TLEPPRDHMSRIRSEMQ  162



>ref|XP_006453095.1| hypothetical protein CICLE_v10007311mg [Citrus clementina]
 ref|XP_006474408.1| PREDICTED: probable sucrose-phosphate synthase 1-like [Citrus 
sinensis]
 gb|ESR66335.1| hypothetical protein CICLE_v10007311mg [Citrus clementina]
Length=1057

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD + +  +  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDIVSDVSAHGDSTRSRLPRISS  150



>gb|KDO73470.1| hypothetical protein CISIN_1g001541mg [Citrus sinensis]
Length=1057

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD + +  +  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDIVSDVSAHGDSTRSRLPRISS  150



>ref|XP_002972277.1| sucrose phosphate synthase [Selaginella moellendorffii]
 gb|EFJ26363.1| sucrose phosphate synthase [Selaginella moellendorffii]
Length=1104

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 98/146 (67%), Gaps = 21/146 (14%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESK----PAVINHRGEQGHFNPTKYFVEEVVSGVDE  326
            MAGNEWINGYLEAILDSG    E  +     PA  +  G    FN +KYFVEEVVSG DE
Sbjct  1    MAGNEWINGYLEAILDSGVGIDEQRASDRKAPASPDLLG----FNASKYFVEEVVSGFDE  56

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLEL---------EGLQRLAHR  479
            TD+HRTW+K  ATRN  ERS+RLEN+CWRIWHLTRKKKQ            E  QR++HR
Sbjct  57   TDIHRTWVKATATRNVRERSARLENLCWRIWHLTRKKKQASFCPLWFFFLAEHAQRVSHR  116

Query  480  RWEREQGRKDVTEDMSEDLSEGEKGD  557
            + +REQG  + T    EDLSEGEK D
Sbjct  117  KIQREQGLLETT----EDLSEGEKAD  138



>gb|KHG18731.1| putative sucrose-phosphate synthase 4 [Gossypium arboreum]
Length=1043

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 25/175 (14%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVE-----SKPAVINHRG------------EQGHFNPT  287
            MAGNEWIN YLEAILD+G+S  + +     +K A   H              E+  F+ T
Sbjct  1    MAGNEWINSYLEAILDAGSSTKKRDDYVKLTKDAKFQHDNKQHQQQQQQLLKEEKPFSTT  60

Query  288  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  467
            +YFVEEV++  DE+DL+RTW+KV+ATRN+ ER++RLENMCWRIWHL RKKKQ+  +  +R
Sbjct  61   RYFVEEVITSFDESDLYRTWVKVIATRNSRERNNRLENMCWRIWHLARKKKQIAWDDARR  120

Query  468  LAHRRWEREQGRKDVTEDMSEDLSEG--EKGDALGETLSLESPRKKFQRNSSNLE  626
            LA RR EREQGR D  +D+SE LSEG  EKGD      ++  P K   R +S+ +
Sbjct  121  LAKRRLEREQGRNDAADDLSE-LSEGEKEKGDP-----NVSEPIKNLSRINSDTQ  169



>gb|KHG18729.1| putative sucrose-phosphate synthase 4 [Gossypium arboreum]
Length=1341

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 25/175 (14%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVE-----SKPAVINHRG------------EQGHFNPT  287
            MAGNEWIN YLEAILD+G+S  + +     +K A   H              E+  F+ T
Sbjct  1    MAGNEWINSYLEAILDAGSSTKKRDDYVKLTKDAKFQHDNKQHQQQQQQLLKEEKPFSTT  60

Query  288  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  467
            +YFVEEV++  DE+DL+RTW+KV+ATRN+ ER++RLENMCWRIWHL RKKKQ+  +  +R
Sbjct  61   RYFVEEVITSFDESDLYRTWVKVIATRNSRERNNRLENMCWRIWHLARKKKQIAWDDARR  120

Query  468  LAHRRWEREQGRKDVTEDMSEDLSEG--EKGDALGETLSLESPRKKFQRNSSNLE  626
            LA RR EREQGR D  +D+SE LSEG  EKGD      ++  P K   R +S+ +
Sbjct  121  LAKRRLEREQGRNDAADDLSE-LSEGEKEKGDP-----NVSEPIKNLSRINSDTQ  169



>emb|CBI17025.3| unnamed protein product [Vitis vinifera]
Length=1018

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 109/157 (69%), Gaps = 5/157 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGAS--AIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            MAGNEWINGYLEAILD+G+S   + V       ++    G      YFVEEVV+  DE+D
Sbjct  1    MAGNEWINGYLEAILDAGSSRNGLRVVEDGDEKSNSKNNGSRRRRFYFVEEVVNSFDESD  60

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHRTWIKV+ATRN+ +RS+RLENMCWRIWHL RKKKQ+  +  QRL  RR EREQGR D 
Sbjct  61   LHRTWIKVIATRNSRDRSNRLENMCWRIWHLARKKKQIAWDDAQRLTKRRLEREQGRHDA  120

Query  513  TEDMSEDLSEGEKGDALGETLSLESPRKKFQRNSSNL  623
             +D+SE LSEGEK    G+   +E  +++  R +S++
Sbjct  121  ADDLSE-LSEGEKEK--GDPNQIEPVKEQMTRINSDM  154



>ref|XP_011020206.1| PREDICTED: probable sucrose-phosphate synthase 1 [Populus euphratica]
Length=1050

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    E   KP+++    E+G F+PT+YFVEEVVSG DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDE--KKPSLLLR--ERGRFSPTRYFVEEVVSGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R W +  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR A RR ERE+GR++   
Sbjct  57   RAWARAQATRSPQERNTRLENMCWRIWNLARQKKQLEGELAQRNAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGDA+G+ +   +S R K  R +S
Sbjct  117  DMSEDLSEGEKGDAVGDLSAHGDSTRNKLSRINS  150



>ref|XP_006286964.1| hypothetical protein CARUB_v10000113mg [Capsella rubella]
 gb|EOA19862.1| hypothetical protein CARUB_v10000113mg [Capsella rubella]
Length=1049

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 114/162 (70%), Gaps = 10/162 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAIL--DSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSG  317
            M GN+W+N YLEAIL  + G S  +  S+P   + +      E+GHF+PT+YFVEEV++G
Sbjct  1    MVGNDWVNSYLEAILAAEPGISNSK-SSQPGTGDSKSSLLLRERGHFSPTRYFVEEVITG  59

Query  318  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  497
             DETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+
Sbjct  60   FDETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKRAAKRQLEREK  119

Query  498  GRKDVTEDMSEDLSEGEKGDALGE--TLSLESPRKKFQRNSS  617
             R++VT +MSED SEGE+ D  GE  T S  + + +  R SS
Sbjct  120  ARREVTAEMSEDFSEGERADLPGEIPTPSDSNTKGRMSRISS  161



>ref|XP_003526395.1| PREDICTED: probable sucrose-phosphate synthase 4-like isoform 
X1 [Glycine max]
Length=1037

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 101/139 (73%), Gaps = 10/139 (7%)
 Frame = +3

Query  162  AGNEWINGYLEAILDSGASAIEVESKPAVIN--------HRGEQGHFNPT-KYFVEEVVS  314
            A NEW+NGYLEAILD G+S  E ++   V N        H+ E+  FNPT KYFVEEVV+
Sbjct  3    AVNEWLNGYLEAILDVGSSVKEKKNDGKVKNFAKFEQEKHQREEKLFNPTTKYFVEEVVN  62

Query  315  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  494
              +E DL+RTW+KV A RNT ERS+RLENMCWRIWHLTRKKKQ+  +  QRLA +R +RE
Sbjct  63   SFNEHDLYRTWVKVTARRNTRERSNRLENMCWRIWHLTRKKKQIAWDDAQRLARKRLDRE  122

Query  495  QGRKDVTEDMSEDLSEGEK  551
            QGR D   D+SE LSEGEK
Sbjct  123  QGRNDAANDLSE-LSEGEK  140



>dbj|BAM37540.1| sucrose phosphate synthase [Mangifera indica]
 dbj|BAM68533.1| sucrose phosphate synthase [Mangifera indica]
 dbj|BAM68534.1| sucrose phosphate synthase [Mangifera indica]
Length=1056

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWARAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+  S  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGDLSSHGDSNRGRLPRISS  150



>dbj|BAM68535.1| sucrose phosphate synthase [Mangifera indica]
Length=1056

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWARAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+  S  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGDLSSHGDSNRGRLPRISS  150



>dbj|BAM68530.1| sucrose phosphate synthase [Mangifera indica]
 dbj|BAM68531.1| sucrose phosphate synthase [Mangifera indica]
 dbj|BAM68532.1| sucrose phosphate synthase [Mangifera indica]
 dbj|BAM68536.1| sucrose phosphate synthase [Mangifera indica]
 dbj|BAM68538.1| sucrose phosphate synthase [Mangifera indica]
Length=1056

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWARAQATRSPQERNTRLENMCWRIWNLARQKKQLEGETAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+  S  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGDLSSHGDSNRGRLPRISS  150



>ref|XP_008385228.1| PREDICTED: probable sucrose-phosphate synthase 1 [Malus domestica]
 ref|XP_008354361.1| PREDICTED: probable sucrose-phosphate synthase 1 [Malus domestica]
Length=1055

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR A RR ERE+GR++ T 
Sbjct  58   RSWVRASATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRXAKRRLERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGETLS  578
            DMSEDLSEGEKGD + +  S
Sbjct  118  DMSEDLSEGEKGDTVSDISS  137



>dbj|BAM68537.1| sucrose phosphate synthase [Mangifera indica]
Length=1056

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWARAQATRSPQERNTRLENMCWRIWNLARQKKQLEGETAQRMAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+  S  +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGDLSSHGDSNRGRLPRISS  150



>ref|XP_008237831.1| PREDICTED: probable sucrose-phosphate synthase 4 [Prunus mume]
Length=1023

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 95/128 (74%), Gaps = 4/128 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQ----GHFNPTKYFVEEVVSGVDE  326
            MAGN+W+NGYLEAILD+G++  ++      I    EQ      F+PTKYFVEEV++  DE
Sbjct  1    MAGNDWLNGYLEAILDAGSNTRKMNDGRVKIAKFEEQVKEENMFSPTKYFVEEVINSFDE  60

Query  327  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  506
            +DLHRTW+KV+ATRNT ERS+RLEN CWRIWHL RKKKQ+  +  +RLA RR ERE GR 
Sbjct  61   SDLHRTWVKVIATRNTRERSNRLENTCWRIWHLARKKKQIAWDDARRLAKRRLEREHGRN  120

Query  507  DVTEDMSE  530
            D  +D+SE
Sbjct  121  DAEDDLSE  128



>ref|XP_008242829.1| PREDICTED: probable sucrose-phosphate synthase 1 [Prunus mume]
Length=1057

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MA N+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MASNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRVERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD + +
Sbjct  118  DMSEDLSEGEKGDVVSD  134



>gb|EYU18237.1| hypothetical protein MIMGU_mgv1a000621mg [Erythranthe guttata]
Length=1042

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    E +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDEAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  AT++  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++   
Sbjct  57   RSWVRAQATKSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRMAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLSL-ESPRKKFQRNSS  617
            DMSEDLSEGEKGD + +  +L ES R +  R SS
Sbjct  117  DMSEDLSEGEKGDLVSDLSTLGESTRGRLARISS  150



>ref|XP_007204296.1| hypothetical protein PRUPE_ppa000639mg [Prunus persica]
 gb|AFI57907.1| sucrose phosphate synthase 1f [Prunus persica]
 gb|EMJ05495.1| hypothetical protein PRUPE_ppa000639mg [Prunus persica]
Length=1057

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MA N+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MASNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRIERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD + +
Sbjct  118  DMSEDLSEGEKGDVVSD  134



>gb|ABV32551.1| sucrose phosphate synthase protein 1 [Prunus persica]
Length=1057

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MA N+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MASNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRIERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD + +
Sbjct  118  DMSEDLSEGEKGDVVSD  134



>ref|XP_011078416.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X2 [Sesamum 
indicum]
Length=1054

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    EV+S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEVKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR A RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRNAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+ +   ES + +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGDLSAHGESNKGRLPRISS  150



>ref|XP_011078414.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X1 [Sesamum 
indicum]
 ref|XP_011078415.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X1 [Sesamum 
indicum]
Length=1055

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    EV+S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEVKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR A RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRNAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+ +   ES + +  R SS
Sbjct  117  DMSEDLSEGEKGDVVGDLSAHGESNKGRLPRISS  150



>gb|AAL34531.1|AF439861_1 sucrose-phosphate synthase [Ipomoea batatas]
Length=1048

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 111/151 (74%), Gaps = 10/151 (7%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QRLA RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQRLAKRRQERERGRREAVA  116

Query  519  DMSEDLSEGEKGDAL------GETLSLESPR  593
            DMSEDLSEGEKGDA+      GE++    PR
Sbjct  117  DMSEDLSEGEKGDAISDISAHGESIKGRLPR  147



>gb|AFW61932.1| putative sucrose-phosphate synthase family protein [Zea mays]
Length=217

 Score =   147 bits (371),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 17/169 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG---------------EQGHFNPTKY  293
            MAGN+WIN YLEAILD+G +A ++ +     + R                E+G F+P +Y
Sbjct  1    MAGNDWINSYLEAILDAGGAAGDLSAAAGSGDGRDGTAVEKRDKSSLMLRERGRFSPARY  60

Query  294  FVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLA  473
            FVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   RL+
Sbjct  61   FVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRLS  120

Query  474  HRRWEREQGRKDVTEDMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
             +R E E+ R+    D+SEDLSEGEKG+   E ++  ES R +  R  S
Sbjct  121  KQRMEFEKARQ-YAADLSEDLSEGEKGETNNEPSIHDESMRTRMPRIGS  168



>gb|ABK29437.1| sucrose phosphate synthase [Coffea canephora]
Length=1049

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++   
Sbjct  57   RSWARAQATRSPQERNTRLENLCWRIWNLARQKKQLEGEQAQRMAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+ L+  ES R +  R SS
Sbjct  117  DMSEDLSEGEKGDTVGDFLAHGESNRGRLPRISS  150



>emb|CDP10465.1| unnamed protein product [Coffea canephora]
Length=1049

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++   
Sbjct  57   RSWARAQATRSPQERNTRLENLCWRIWNLARQKKQLEGEQAQRMAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD +G+ L+  ES R +  R SS
Sbjct  117  DMSEDLSEGEKGDTVGDFLAHGESNRGRLPRISS  150



>gb|KJB59576.1| hypothetical protein B456_009G262100 [Gossypium raimondii]
Length=956

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 25/175 (14%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVE-----SKPAVINHRGEQGH------------FNPT  287
            MAGNEWIN YLEAILD+G+S  + +     +K A   H  +Q              F+ T
Sbjct  1    MAGNEWINSYLEAILDAGSSTKKRDDDVKLTKDAKFQHDNKQHQEQQQQLLKEEKPFSTT  60

Query  288  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  467
            +YFVEEV++  DE+DL+RTW+KV+ATRN+ ER++RLENMCWRIWHL RKKKQ+  +  +R
Sbjct  61   RYFVEEVITSFDESDLYRTWVKVIATRNSRERNNRLENMCWRIWHLARKKKQIAWDDARR  120

Query  468  LAHRRWEREQGRKDVTEDMSEDLSEG--EKGDALGETLSLESPRKKFQRNSSNLE  626
            LA RR EREQGR D  +D+SE LSEG  EKGD      ++  P K   R +S+ +
Sbjct  121  LAKRRLEREQGRNDAADDLSE-LSEGEKEKGDP-----NVSEPIKNLSRINSDTQ  169



>emb|CDX70382.1| BnaC03g04660D [Brassica napus]
Length=962

 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 110/155 (71%), Gaps = 6/155 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+P++YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPSRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KK++E +  +R A R   RE+  K+VT 
Sbjct  57   RSWVQAAATRSPQERNTRLENLCWRIWNLARQKKKVEGKNAKRAAKRHLLREKALKEVTA  116

Query  519  DMSEDLSEGEKGDALGE--TLSLESPRKKFQRNSS  617
            DMSED SEGEK D  GE  TLS  + + +  R SS
Sbjct  117  DMSEDFSEGEKADVPGEIPTLSDGNTKGRMSRVSS  151



>gb|KJB59577.1| hypothetical protein B456_009G262100 [Gossypium raimondii]
Length=1036

 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 25/175 (14%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVE-----SKPAVINHRGEQGH------------FNPT  287
            MAGNEWIN YLEAILD+G+S  + +     +K A   H  +Q              F+ T
Sbjct  1    MAGNEWINSYLEAILDAGSSTKKRDDDVKLTKDAKFQHDNKQHQEQQQQLLKEEKPFSTT  60

Query  288  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  467
            +YFVEEV++  DE+DL+RTW+KV+ATRN+ ER++RLENMCWRIWHL RKKKQ+  +  +R
Sbjct  61   RYFVEEVITSFDESDLYRTWVKVIATRNSRERNNRLENMCWRIWHLARKKKQIAWDDARR  120

Query  468  LAHRRWEREQGRKDVTEDMSEDLSEG--EKGDALGETLSLESPRKKFQRNSSNLE  626
            LA RR EREQGR D  +D+SE LSEG  EKGD      ++  P K   R +S+ +
Sbjct  121  LAKRRLEREQGRNDAADDLSE-LSEGEKEKGDP-----NVSEPIKNLSRINSDTQ  169



>ref|XP_009363963.1| PREDICTED: probable sucrose-phosphate synthase 1 [Pyrus x bretschneideri]
Length=1055

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 110/137 (80%), Gaps = 3/137 (2%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR A RR ERE+GR++ T 
Sbjct  58   RSWVRASATRSPQERNTRLENLCWRIWNLARQKKQLEGEESQRKAKRRLERERGRREATA  117

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD + +
Sbjct  118  DMSEDLSEGEKGDTVSD  134



>ref|XP_006381105.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
 gb|ERP58902.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
Length=1049

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    E    P+++    E+G F+PT+YFVEEVVSG DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDE--KNPSLLLR--ERGRFSPTRYFVEEVVSGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E   R A RR ERE+GR++   
Sbjct  57   RAWVRAQATRSPRERNTRLENMCWRIWNLARQKKQLEGELAHRNAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGDA+G+ L+  +S R +  R +S
Sbjct  117  DMSEDLSEGEKGDAVGDLLAHGDSIRNRLSRINS  150



>ref|XP_006852870.1| hypothetical protein AMTR_s00033p00204130 [Amborella trichopoda]
 gb|ERN14337.1| hypothetical protein AMTR_s00033p00204130 [Amborella trichopoda]
Length=1062

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 108/140 (77%), Gaps = 4/140 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G     ++ K + +  R E+G F+PT+YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDVGTP---LDDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WIK  +TR+  ER++RLENMCWRIW+L RKKKQ+E E  QR A RR ERE+GR+D T 
Sbjct  57   RSWIKASSTRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRSAKRRLERERGRRDATA  116

Query  519  DMSEDLSEGEKGDALGETLS  578
            DMSEDLSEGEKGD + +  S
Sbjct  117  DMSEDLSEGEKGDTISDISS  136



>gb|KDP30238.1| hypothetical protein JCGZ_17020 [Jatropha curcas]
Length=1056

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR A RR ERE+GR++ T 
Sbjct  57   RSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLEGELAQRHAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGDA+ +
Sbjct  117  DMSEDLSEGEKGDAISD  133



>ref|XP_011084090.1| PREDICTED: probable sucrose-phosphate synthase 1 [Sesamum indicum]
Length=1053

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 113/154 (73%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    EV+S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEVKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+  RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRMTKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   ES R +  R SS
Sbjct  117  DMSEDLSEGEKGDTVTDLSTHGESNRGRLPRISS  150



>emb|CDX80498.1| BnaC07g29460D [Brassica napus]
Length=967

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 4/156 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAIL--DSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            M GN+W+N YLEAIL  + G    +     + +  R E+GHF+PT+YFVEEV++G DETD
Sbjct  1    MVGNDWVNSYLEAILAAEPGIGDSKYSDSKSSLLLR-ERGHFSPTRYFVEEVITGFDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHR+WI+  ATR+  ER++RLEN+CWRIW+L R+KKQ+  +  +R A R   RE+ R + 
Sbjct  60   LHRSWIQAAATRSPQERNTRLENLCWRIWNLARQKKQVAGKYAKRTAKRHLLRERARLEA  119

Query  513  TEDMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            T DMSEDLSEGEK D  GE L+  +S + +  R SS
Sbjct  120  TADMSEDLSEGEKADVPGEILTPTDSSKGRMSRISS  155



>emb|CDX88168.1| BnaA06g27590D [Brassica napus]
Length=960

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 4/156 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAIL--DSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            M GN+W+N YLEAIL  + G    +     + +  R E+GHF+PT+YFVEEV++G DETD
Sbjct  1    MVGNDWVNSYLEAILAAEPGIGDSKYSDSKSSLLLR-ERGHFSPTRYFVEEVITGFDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHR+WI+  ATR+  ER++RLEN+CWRIW+L R+KKQ+  +  +R A R   RE+ R + 
Sbjct  60   LHRSWIQAAATRSPQERNTRLENLCWRIWNLARQKKQVAGKYAKRTAKRHLLRERARLEA  119

Query  513  TEDMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            T DMSEDLSEGEK D  GE L+  +S + +  R SS
Sbjct  120  TADMSEDLSEGEKADVPGEILTPTDSSKGRMSRISS  155



>gb|EMT02687.1| Sucrose-phosphate synthase 1 [Aegilops tauschii]
Length=1069

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 108/167 (65%), Gaps = 14/167 (8%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-------------EQGHFNPTKYFV  299
            M GN+WIN YLEAILD+G +A E+ +  A                   E+G FNP +YFV
Sbjct  1    MVGNDWINSYLEAILDAGGAAGEISAASAAPGGSAAEKRRDKSSLMLRERGRFNPARYFV  60

Query  300  EEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHR  479
            EEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   R + +
Sbjct  61   EEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRSSKK  120

Query  480  RWEREQGRKDVTEDMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            R ERE+ R+D   D+SEDLS+GEKG+ + E ++  ES R    R  S
Sbjct  121  RLEREKARRDAAADLSEDLSDGEKGEHINESSIHAESTRGHMPRIGS  167



>ref|XP_010928318.1| PREDICTED: probable sucrose-phosphate synthase 1 [Elaeis guineensis]
Length=1058

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD+G   I+      ++    E+G F+PT+YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGP-VIDASKSSLLLR---ERGRFSPTRYFVEEVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E   R++ RR ERE+GR+D T 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEALRMSKRRLERERGRRDATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   +S R +F R SS
Sbjct  117  DMSEDLSEGEKGDIVSDLSTHGDSTRGRFPRISS  150



>ref|XP_002969539.1| sucrose phosphate synthase [Selaginella moellendorffii]
 gb|EFJ29627.1| sucrose phosphate synthase [Selaginella moellendorffii]
Length=1030

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 106/162 (65%), Gaps = 21/162 (13%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSG-ASAIE------VESKPA--VINHRGEQGHFNPTKYFVEEVV  311
            MAGNEWINGYLEAILD+G A  I+      +ES PA  ++         N TKYF++EVV
Sbjct  1    MAGNEWINGYLEAILDTGTAGTIDYQQQRLLESSPARRIVA-------VNATKYFIQEVV  53

Query  312  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  491
            SG DETD+H+TW+K    RN+ ERS+RLEN+CWRIWH++RK+KQ+E    QR+A R +E 
Sbjct  54   SGFDETDIHQTWMKATVCRNSKERSARLENLCWRIWHISRKRKQIEWANTQRVADRHFEH  113

Query  492  EQGRKDVTEDMSEDLSEGE-KGDALGETLSLESP----RKKF  602
            EQGRKD  +D+ ED  E +   D  G  LS  S     RK F
Sbjct  114  EQGRKDAADDLCEDHPEADLHSDIAGTRLSRNSSETDVRKSF  155



>dbj|BAD94390.1| sucrose-phosphate synthase - like protein [Arabidopsis thaliana]
 dbj|BAD94960.1| sucrose-phosphate synthase - like protein [Arabidopsis thaliana]
 dbj|BAF01835.1| sucrose-phosphate synthase - like protein [Arabidopsis thaliana]
Length=1050

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 110/183 (60%), Gaps = 27/183 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRG--------------------EQGH  275
            MA N+WIN YLEAILD G S  +  ES   ++   G                    ++  
Sbjct  1    MARNDWINSYLEAILDVGTSKKKRFESNSKIVQKLGDINSKDHQEKVFGDMNGKDHQEKV  60

Query  276  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  455
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  456  GLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE------TLSLESPRKKFQRNSS  617
               RL+ RR EREQGR D  ED+  +LSEGEK    GE        +LE PR    R  S
Sbjct  121  DGVRLSKRRIEREQGRNDAEEDLLSELSEGEKDKNDGEKEKSEVVTTLEPPRDHMPRIRS  180

Query  618  NLE  626
             ++
Sbjct  181  EMQ  183



>gb|AFP23360.1| sucrose phosphate synthase [Litchi chinensis]
Length=1045

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  ATR+  ER++RLENMCWRIW+L R+KKQLE E +QR+A RR ERE+ R++ T 
Sbjct  57   RSWIRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAVQRMAKRRQERERARREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD + +
Sbjct  117  DMSEDLSEGEKGDTVSD  133



>gb|ABI17900.1| sucrose phosphate synthase [Coffea canephora]
Length=1049

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++   
Sbjct  57   RSWARAQATRSPQERNTRLENLCWRIWNLARQKKQLEGEQAQRMAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGE+GD +G+ L+  ES R +  R SS
Sbjct  117  DMSEDLSEGEEGDTVGDFLAHGESNRGRLPRISS  150



>emb|CAB39764.1| sucrose-phosphate synthase-like protein [Arabidopsis thaliana]
 emb|CAB78135.1| sucrose-phosphate synthase-like protein [Arabidopsis thaliana]
Length=1083

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 110/183 (60%), Gaps = 27/183 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRG--------------------EQGH  275
            MA N+WIN YLEAILD G S  +  ES   ++   G                    ++  
Sbjct  1    MARNDWINSYLEAILDVGTSKKKRFESNSKIVQKLGDINSKDHQEKVFGDMNGKDHQEKV  60

Query  276  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  455
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  456  GLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE------TLSLESPRKKFQRNSS  617
               RL+ RR EREQGR D  ED+  +LSEGEK    GE        +LE PR    R  S
Sbjct  121  DGVRLSKRRIEREQGRNDAEEDLLSELSEGEKDKNDGEKEKSEVVTTLEPPRDHMPRIRS  180

Query  618  NLE  626
             ++
Sbjct  181  EMQ  183



>ref|NP_192750.2| probable sucrose-phosphate synthase 4 [Arabidopsis thaliana]
 ref|NP_001031609.1| probable sucrose-phosphate synthase 4 [Arabidopsis thaliana]
 sp|F4JLK2.1|SPSA4_ARATH RecName: Full=Probable sucrose-phosphate synthase 4; AltName: 
Full=Sucrose phosphate synthase 4F; Short=AtSPS4F; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase [Arabidopsis 
thaliana]
 gb|AEE82844.1| probable sucrose-phosphate synthase 4 [Arabidopsis thaliana]
 gb|AEE82845.1| probable sucrose-phosphate synthase 4 [Arabidopsis thaliana]
 gb|AHL38703.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1050

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 110/183 (60%), Gaps = 27/183 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRG--------------------EQGH  275
            MA N+WIN YLEAILD G S  +  ES   ++   G                    ++  
Sbjct  1    MARNDWINSYLEAILDVGTSKKKRFESNSKIVQKLGDINSKDHQEKVFGDMNGKDHQEKV  60

Query  276  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  455
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  456  GLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE------TLSLESPRKKFQRNSS  617
               RL+ RR EREQGR D  ED+  +LSEGEK    GE        +LE PR    R  S
Sbjct  121  DGVRLSKRRIEREQGRNDAEEDLLSELSEGEKDKNDGEKEKSEVVTTLEPPRDHMPRIRS  180

Query  618  NLE  626
             ++
Sbjct  181  EMQ  183



>dbj|BAD43701.1| sucrose-phosphate synthase - like protein [Arabidopsis thaliana]
Length=1050

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 110/183 (60%), Gaps = 27/183 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRG--------------------EQGH  275
            MA N+WIN YLEAILD G S  +  ES   ++   G                    ++  
Sbjct  1    MARNDWINSYLEAILDVGTSKKKRFESNSKIVQKLGDINSKDHQEKVFGDMNGKDHQEKV  60

Query  276  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  455
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  456  GLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE------TLSLESPRKKFQRNSS  617
               RL+ RR EREQGR D  ED+  +LSEGEK    GE        +LE PR    R  S
Sbjct  121  DGVRLSKRRIEREQGRNDAEEDLLSELSEGEKDKNDGEKEKSEVVTTLEPPRDHMPRIRS  180

Query  618  NLE  626
             ++
Sbjct  181  EMQ  183



>ref|XP_004150653.1| PREDICTED: probable sucrose-phosphate synthase 1-like [Cucumis 
sativus]
 gb|KGN65109.1| hypothetical protein Csa_1G224890 [Cucumis sativus]
Length=1061

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES-KPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  335
            MAGN+WIN YLEAILD G    E +S K +      E+GHF+PT+YFVEEV++G DE+DL
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSAKQSSSLLLRERGHFSPTRYFVEEVITGFDESDL  60

Query  336  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            +R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E   R+A RR ERE+GR++ T
Sbjct  61   YRSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEALRMAKRRLERERGRREAT  120

Query  516  EDMSEDLSEGEKGDALGET  572
             DMSEDLSEGEKGD + + 
Sbjct  121  ADMSEDLSEGEKGDVVNDV  139



>ref|XP_009151050.1| PREDICTED: probable sucrose-phosphate synthase 2 [Brassica rapa]
 ref|XP_009151051.1| PREDICTED: probable sucrose-phosphate synthase 2 [Brassica rapa]
Length=1047

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 4/156 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAIL--DSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  332
            M GN+W+N YLEAIL  + G    +     + +  R E+GHF+PT+YFVEEV++G DETD
Sbjct  1    MVGNDWVNSYLEAILAAEPGIGDSKYSDSKSSLLLR-ERGHFSPTRYFVEEVITGFDETD  59

Query  333  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  512
            LHR+WI+  ATR+  ER++RLEN+CWRIW+L R+KKQ+  +  +R A R   RE+ R + 
Sbjct  60   LHRSWIQAAATRSPQERNTRLENLCWRIWNLARQKKQVAGKYAKRTAKRHLLRERARLEA  119

Query  513  TEDMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            T DMSEDLSEGEK D  GE L+  +S + +  R SS
Sbjct  120  TADMSEDLSEGEKADVPGEILTPTDSSKGRMSRISS  155



>ref|XP_004167243.1| PREDICTED: LOW QUALITY PROTEIN: probable sucrose-phosphate synthase 
1-like, partial [Cucumis sativus]
Length=987

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVES-KPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  335
            MAGN+WIN YLEAILD G    E +S K +      E+GHF+PT+YFVEEV++G DE+DL
Sbjct  91   MAGNDWINSYLEAILDVGPGIDEAKSAKQSSSLLLRERGHFSPTRYFVEEVITGFDESDL  150

Query  336  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  515
            +R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E   R+A RR ERE+GR++ T
Sbjct  151  YRSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEALRMAKRRLERERGRREAT  210

Query  516  EDMSEDLSEGEKGDALGET  572
             DMSEDLSEGEKGD + + 
Sbjct  211  ADMSEDLSEGEKGDVVNDV  229



>ref|XP_009395490.1| PREDICTED: probable sucrose-phosphate synthase 1 [Musa acuminata 
subsp. malaccensis]
Length=1059

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 107/137 (78%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD+G S   +++  A +  R E+G F+PT+YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGPS---IDAAKASLLLR-ERGRFSPTRYFVEEVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E  Q ++ RR ERE+ R+D T 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQGISKRRLERERARRDATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD + +
Sbjct  117  DMSEDLSEGEKGDIIND  133



>ref|XP_010437512.1| PREDICTED: probable sucrose-phosphate synthase 4 [Camelina sativa]
Length=1050

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 109/183 (60%), Gaps = 27/183 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  275
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKDHQDKVFGDMNTKDHQEKV  60

Query  276  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  455
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  456  GLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE------TLSLESPRKKFQRNSS  617
               RL+ RR EREQGR D  ED+  +LSEGEK    GE        +LE PR    R  S
Sbjct  121  DGIRLSKRRIEREQGRNDAEEDLLSELSEGEKEKNDGEKEKNEVVTTLEPPRDHMPRIRS  180

Query  618  NLE  626
             ++
Sbjct  181  EMQ  183



>ref|XP_010455412.1| PREDICTED: probable sucrose-phosphate synthase 4 [Camelina sativa]
Length=1049

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 109/183 (60%), Gaps = 27/183 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  275
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKDHQDKVFGDMNTKDHQEKV  60

Query  276  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  455
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  456  GLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE------TLSLESPRKKFQRNSS  617
               RL+ RR EREQGR D  ED+  +LSEGEK    GE        +LE PR    R  S
Sbjct  121  DGIRLSKRRIEREQGRNDAEEDLLSELSEGEKEKNDGEKEKNEVVTTLEPPRDHMPRIRS  180

Query  618  NLE  626
             ++
Sbjct  181  EMQ  183



>emb|CDP11522.1| unnamed protein product [Coffea canephora]
Length=1039

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 104/158 (66%), Gaps = 28/158 (18%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKP--AVINHRG-----------------------  263
            MAGNEW+NGYLEAILD+G+      S+    + NH+                        
Sbjct  1    MAGNEWLNGYLEAILDAGSGRNSDGSREEEKIKNHKSTSPSLRKRFDEKLKFEKFEAWKE  60

Query  264  -EQGH-FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKK  437
             E G  F+PTKYFVEEVV+  DE+DL+RTWIKVVATRN+ ER++RLENMCWRIWHL RKK
Sbjct  61   KEAGKLFSPTKYFVEEVVNSFDESDLYRTWIKVVATRNSRERNNRLENMCWRIWHLARKK  120

Query  438  KQLELEGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEK  551
            KQ+  +  Q+L  RR ERE+GR D  +D+SE +SEGEK
Sbjct  121  KQIAWDDAQKLVKRRLEREKGRSDAADDLSE-ISEGEK  157



>ref|XP_004250761.1| PREDICTED: probable sucrose-phosphate synthase 4 [Solanum lycopersicum]
Length=1029

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 99/145 (68%), Gaps = 15/145 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGH--------------FNPTKYF  296
            MA NEW+NGYLEAILD G+       K  + ++  +  +              F+PTKYF
Sbjct  1    MAENEWLNGYLEAILDVGSERNGSRQKKPISSNNFKHNNMEEILRLEIHKEKLFSPTKYF  60

Query  297  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  476
            VEEVV+  DE+DLHRTWIKVVATRN  ER++RLENMCWRIWHLTRKKKQ+  +  Q+L  
Sbjct  61   VEEVVNSFDESDLHRTWIKVVATRNCRERNNRLENMCWRIWHLTRKKKQIAWDDAQKLVK  120

Query  477  RRWEREQGRKDVTEDMSEDLSEGEK  551
            RR E E+GR D  ED+SE LSEGEK
Sbjct  121  RRVELEKGRFDAAEDLSE-LSEGEK  144



>ref|XP_006352069.1| PREDICTED: probable sucrose-phosphate synthase 4-like [Solanum 
tuberosum]
Length=1033

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 100/149 (67%), Gaps = 19/149 (13%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGA--------SAIEVESKPAVINHRG----------EQGHFNP  284
            MA NEW+NGYLEAILD G+          + +E       H            ++  F+P
Sbjct  1    MAENEWLNGYLEAILDVGSERNGSRQKKPLSIEESSNNFKHNNMEENLRLEIHKEKLFSP  60

Query  285  TKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQ  464
            TKYFVEEVV+  DE+DLHRTWIKVVATRN+ ER++RLENMCWRIWHLTRKKKQ+  +  Q
Sbjct  61   TKYFVEEVVNSFDESDLHRTWIKVVATRNSRERNNRLENMCWRIWHLTRKKKQIAWDDAQ  120

Query  465  RLAHRRWEREQGRKDVTEDMSEDLSEGEK  551
            +L  RR E E+GR D  ED+SE LSEGEK
Sbjct  121  KLVKRRVELEKGRFDAAEDLSE-LSEGEK  148



>ref|XP_010555013.1| PREDICTED: probable sucrose-phosphate synthase 2 [Tarenaya hassleriana]
Length=1044

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R  ERE+ R++ T 
Sbjct  57   RSWIQAAATRSPQERNTRLENLCWRIWNLARQKKQIEGKYAKRAAKRHLERERARREATA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLS+ EK D  G+
Sbjct  117  DMSEDLSDREKADVPGD  133



>sp|O04932.1|SPSA1_CRAPL RecName: Full=Probable sucrose-phosphate synthase 1; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase 1 [Craterostigma 
plantagineum]
 emb|CAA72506.1| sucrose-phosphate synthase [Craterostigma plantagineum]
Length=1054

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 14/140 (10%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  323
            MAGN+WIN YLEAILD G         P +   +G     E+G F+PT+YFVEEVVSG D
Sbjct  1    MAGNDWINSYLEAILDVG---------PGIDEAKGSLLLRERGRFSPTRYFVEEVVSGFD  51

Query  324  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  503
            ETDLHR+WI+  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR
Sbjct  52   ETDLHRSWIRAQATRSPQERNTRLENMCWRIWNLARQKKQLENEEAQRMAKRRLERERGR  111

Query  504  KDVTEDMSEDLSEGEKGDAL  563
            ++   DMSEDLSEGEKGD +
Sbjct  112  REAVADMSEDLSEGEKGDIV  131



>ref|XP_002872492.1| ATSPS4F [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48751.1| ATSPS4F [Arabidopsis lyrata subsp. lyrata]
Length=1051

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 109/184 (59%), Gaps = 28/184 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  275
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNSKDHQDKVFGDMNSKDHHQEK  60

Query  276  -FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLEL  452
             F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  
Sbjct  61   VFSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVW  120

Query  453  EGLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE------TLSLESPRKKFQRNS  614
            +   RL+ RR EREQGR D  ED+  +LSEGEK    GE        +LE PR    R  
Sbjct  121  DDGIRLSKRRIEREQGRNDAEEDLLSELSEGEKEKNDGEKEKNEVVTTLEPPRDHMPRIR  180

Query  615  SNLE  626
            S ++
Sbjct  181  SEMQ  184



>ref|XP_007148633.1| hypothetical protein PHAVU_005G002600g [Phaseolus vulgaris]
 gb|ESW20627.1| hypothetical protein PHAVU_005G002600g [Phaseolus vulgaris]
Length=1030

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 103/150 (69%), Gaps = 23/150 (15%)
 Frame = +3

Query  162  AGNEWINGYLEAILDSGASA--------------IEVESKPAVINHRGEQGHFNPT-KYF  296
            A NEW+NGYLEAILD G+S                E E+K    + R E+  FNPT KYF
Sbjct  3    AVNEWLNGYLEAILDVGSSVRKKKKNDGKVKIAKFEEENK----DERVEK-LFNPTTKYF  57

Query  297  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  476
            VEEVV+  DE DL+RTW+KV ATRN  ERS+RLENMCWRIWHLTRKKKQ+  +  QRLA 
Sbjct  58   VEEVVNSFDEHDLYRTWVKVTATRNIRERSNRLENMCWRIWHLTRKKKQIACDDAQRLAR  117

Query  477  RRWEREQGRKDVTEDMSEDLSEG--EKGDA  560
            RR +RE+GR D   D+SE LSEG  EKGDA
Sbjct  118  RRLDREEGRNDAANDLSE-LSEGEKEKGDA  146



>ref|XP_006286963.1| hypothetical protein CARUB_v10000112mg [Capsella rubella]
 gb|EOA19861.1| hypothetical protein CARUB_v10000112mg [Capsella rubella]
Length=1049

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 27/183 (15%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  275
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKDHQDKVFGDMNRKDHQEKV  60

Query  276  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  455
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  456  GLQRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE------TLSLESPRKKFQRNSS  617
               RL+ RR EREQGR D  ED+  +LS+GEK    GE         LE PR +  R  S
Sbjct  121  DGIRLSKRRIEREQGRNDAEEDLLSELSDGEKDKNDGEKEKNEIVTPLERPRDQMPRIRS  180

Query  618  NLE  626
             ++
Sbjct  181  EMQ  183



>ref|XP_003573681.1| PREDICTED: probable sucrose-phosphate synthase 4 [Brachypodium 
distachyon]
Length=1064

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 109/173 (63%), Gaps = 20/173 (12%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-------------------EQGHFN  281
            M GN+WIN YLEAILD+G +A ++ +        G                   E+G FN
Sbjct  1    MVGNDWINSYLEAILDAGGAAGDISAASVAGGGDGPGAGGADGEKRDKSSLMLRERGRFN  60

Query  282  PTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGL  461
            P +YFVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E  
Sbjct  61   PARYFVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEA  120

Query  462  QRLAHRRWEREQGRKDVTEDMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
             R + +R ERE+ R+D   D+SEDLSEGEKG+ + E ++  ES R +  R  S
Sbjct  121  SRSSKKRLEREKARRDAAADLSEDLSEGEKGENIHESSIHDESTRGRMPRIGS  173



>ref|XP_010057603.1| PREDICTED: probable sucrose-phosphate synthase 1 [Eucalyptus 
grandis]
 gb|KCW74791.1| hypothetical protein EUGRSUZ_E03524 [Eucalyptus grandis]
Length=1056

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/154 (58%), Positives = 117/154 (76%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G +   ++ K + +  R E+G F+PT+YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDVGPA---LDDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR + RR ERE+GR++ T 
Sbjct  57   RSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRKSKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGDA+ + +   +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDAVSDISTHGDSNRGRLPRISS  150



>gb|AAC39434.1| sucrose-phosphate synthase [Actinidia deliciosa]
Length=577

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 6/154 (4%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVE+V+ G DETDL+
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEQVI-GFDETDLY  55

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  56   RSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRMAKRRLERERGRREATA  115

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   ES R +  R SS
Sbjct  116  DMSEDLSEGEKGDTVSDLSAHGESNRGRLPRISS  149



>ref|NP_001275243.1| probable sucrose-phosphate synthase [Solanum tuberosum]
 gb|ACD50895.1| sucrose-phosphate-synthase [Solanum tuberosum]
Length=1054

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G     ++ K + +  R E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPG---LDDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  ATR+  ER++RLENMCWRIW+L R+KKQLE E  Q +A RR ERE+GR++   
Sbjct  57   RSWIRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQWMAKRRQERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD + +  S  ES R +  R SS
Sbjct  117  DMSEDLSEGEKGDIVADMSSHGESTRGRLPRISS  150



>ref|XP_010913331.1| PREDICTED: probable sucrose-phosphate synthase 1 [Elaeis guineensis]
 ref|XP_010913332.1| PREDICTED: probable sucrose-phosphate synthase 1 [Elaeis guineensis]
Length=1052

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 113/154 (73%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            M GN+WIN YLEAILD+G  AI+      ++    E+G F+PT+YFVEEV++G DETDL+
Sbjct  1    MPGNDWINSYLEAILDAGP-AIDASKSSLLLR---ERGRFSPTRYFVEEVITGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E   R++ RR ERE+GR+D T 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEALRMSKRRLERERGRRDATA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDVVSDLSAHGDSTRGRIPRISS  150



>emb|CBI25540.3| unnamed protein product [Vitis vinifera]
Length=1032

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 113/154 (73%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + ++   +     E+G F+PT+YFVE+V++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKTSLLL----RERGRFSPTRYFVEQVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ER++GR++   
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRIAKRRLERDRGRREAIA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDTVSDISAHGDSIRGRMPRISS  150



>ref|XP_002265473.1| PREDICTED: probable sucrose-phosphate synthase 1 [Vitis vinifera]
Length=1052

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 113/154 (73%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G    + ++   +     E+G F+PT+YFVE+V++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKTSLLL----RERGRFSPTRYFVEQVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ER++GR++   
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRIAKRRLERDRGRREAIA  116

Query  519  DMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
            DMSEDLSEGEKGD + + +   +S R +  R SS
Sbjct  117  DMSEDLSEGEKGDTVSDISAHGDSIRGRMPRISS  150



>ref|XP_006400595.1| hypothetical protein EUTSA_v10012540mg [Eutrema salsugineum]
 ref|XP_006400596.1| hypothetical protein EUTSA_v10012540mg [Eutrema salsugineum]
 gb|ESQ42048.1| hypothetical protein EUTSA_v10012540mg [Eutrema salsugineum]
 gb|ESQ42049.1| hypothetical protein EUTSA_v10012540mg [Eutrema salsugineum]
Length=1041

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 115/153 (75%), Gaps = 5/153 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD G    +  ++P+++    E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQPLDD--ARPSLLLR--ERGRFTPSRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K VATR+  ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++ T 
Sbjct  57   RSWVKAVATRSPQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLSLESPRKKFQRNSS  617
            DMSE+ SEGEKGD + + +S   P+ +  R +S
Sbjct  117  DMSEEFSEGEKGDIVSD-VSTHGPKSRLPRINS  148



>gb|ABX59534.1| sucrose phosphate synthase II [Saccharum officinarum]
Length=1060

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 107/169 (63%), Gaps = 16/169 (9%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG---------------EQGHFNPTKY  293
            MAGN+WIN YLEAILD+G +A E+ +                        E+G FNP +Y
Sbjct  1    MAGNDWINSYLEAILDAGGAAGEISAAAGSGGGGDGTAGEKRDKSSLMLRERGRFNPARY  60

Query  294  FVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLA  473
            FVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   RL+
Sbjct  61   FVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRLS  120

Query  474  HRRWEREQGRKDVTEDMSEDLSEGEKGDALGE-TLSLESPRKKFQRNSS  617
             RR E E+ R+    D+SEDLSEGEKG+   E ++  ES R +  R  S
Sbjct  121  KRRMELEKARQYAAADLSEDLSEGEKGETNNEPSIHDESMRTRMPRIGS  169



>gb|EPS69735.1| hypothetical protein M569_05029 [Genlisea aurea]
Length=1050

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 100/145 (69%), Gaps = 8/145 (6%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            M GN+WINGYLEAILD      E +S   +     E+G F+P +YFVEEV++G +ETDLH
Sbjct  1    MTGNDWINGYLEAILDVDVGINEKDSSLLL----RERGRFSPAQYFVEEVITGFNETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W +  A RN+ ER+ RLENMCWRIW L RKKKQ+E+E +QR A +  +RE  R++ T 
Sbjct  57   RSWARAAAIRNSEERNMRLENMCWRIWTLARKKKQIEIEEMQRKAKKTLDRETARREATA  116

Query  519  DMSEDLSEGEKGDALGETLSLESPR  593
            +M +D+ EGEK D +GE     SPR
Sbjct  117  EMPDDILEGEKMDTVGEL----SPR  137



>gb|AHH86105.1| sucrose-phosphate synthase [Lycium barbarum]
Length=1054

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G     ++ K + +  R E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPG---LDDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+WI+  ATR+  ER++RLENMCWRIW+L R+KKQLE E  Q +A RR ERE+GR++   
Sbjct  57   RSWIRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQWMAKRRQERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGETLS-LESPRKKFQRNSS  617
            DMSEDLSEGEKGD + +  S  ES R +  R SS
Sbjct  117  DMSEDLSEGEKGDIVSDMSSHGESTRGRLPRISS  150



>ref|XP_011017846.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X1 [Populus 
euphratica]
Length=1049

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 107/137 (78%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+WIN YLEAILD G     ++ K + +  R E+G F+PT+YFVEEVVSG DETDL+
Sbjct  1    MAGNDWINSYLEAILDVGPG---LDDKKSSLLLR-ERGRFSPTRYFVEEVVSGFDETDLY  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR A RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGELAQRNAKRRLERERGRREAVA  116

Query  519  DMSEDLSEGEKGDALGE  569
            DMSEDLSEGEKGD +G+
Sbjct  117  DMSEDLSEGEKGDTVGD  133



>ref|XP_010454335.1| PREDICTED: sucrose-phosphate synthase 1 [Camelina sativa]
Length=1043

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 113/154 (73%), Gaps = 5/154 (3%)
 Frame = +3

Query  159  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  338
            MAGN+W+N YLEAILD G    +  S   +     E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQGLEDARSSLLL----RERGRFTPSRYFVEEVITGFDETDLH  56

Query  339  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  518
            R+W+K VATR+  ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++ T 
Sbjct  57   RSWVKAVATRSPQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLERERGRREATA  116

Query  519  DMSEDLSEGEKGDALGETLSL-ESPRKKFQRNSS  617
            DMSE+ SEGEKGDA+ +  +L ES + +  R +S
Sbjct  117  DMSEEFSEGEKGDAITDISTLSESTKPRLPRINS  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380