BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS140A06

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792656.1|  PREDICTED: sucrose synthase                        111   1e-24   Nicotiana sylvestris
ref|XP_009625446.1|  PREDICTED: sucrose synthase                        110   1e-24   Nicotiana tomentosiformis
gb|ADK98103.1|  sucrose synthase                                        102   3e-24   Schiedea globosa
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             110   3e-24   
dbj|BAN18504.1|  sucrose synthase                                       102   3e-24   Schiedea trinervis
gb|ADW09887.1|  putative sucrose synthase                               102   4e-24   Schiedea stellarioides
ref|NP_001234804.1|  sucrose synthase                                   109   4e-24   
gb|ADK98120.1|  sucrose synthase                                        102   4e-24   Schiedea adamantis
gb|ADK98109.1|  sucrose synthase                                        102   4e-24   Schiedea globosa
gb|ADW09895.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
dbj|BAN18500.1|  sucrose synthase                                       102   4e-24   Schiedea pentandra
gb|ADW09907.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADW09905.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADK98101.1|  sucrose synthase                                        102   4e-24   Schiedea globosa
gb|ADW09927.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADW09936.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADK98116.1|  sucrose synthase                                        102   4e-24   Schiedea globosa
gb|ADA68250.1|  sucrose synthase                                        102   4e-24   Schiedea globosa
gb|ADW09921.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADA68251.1|  sucrose synthase                                        102   4e-24   Schiedea membranacea
gb|ADW09926.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADK98097.1|  sucrose synthase                                        102   4e-24   Schiedea globosa
gb|ADW09904.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADW09891.1|  putative sucrose synthase                               102   4e-24   Schiedea membranacea
gb|ADW09901.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADW09933.1|  putative sucrose synthase                               102   4e-24   Schiedea globosa
gb|ADW09903.1|  putative sucrose synthase                               102   5e-24   Schiedea globosa
gb|ADW09917.1|  putative sucrose synthase                               102   5e-24   Schiedea globosa
gb|ADW09918.1|  putative sucrose synthase                               102   5e-24   Schiedea globosa
ref|NP_001274911.1|  sucrose synthase 2                                 108   9e-24   Solanum tuberosum [potatoes]
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           108   9e-24   
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    108   9e-24   Solanum tuberosum [potatoes]
gb|ABD61653.1|  sucrose synthase                                        107   2e-23   Cichorium intybus [radicchio]
gb|ADA68252.1|  sucrose synthase                                        100   2e-23   Honckenya peploides
gb|AEN79500.1|  sucrose synthase 1                                      106   6e-23   Phelipanche ramosa
gb|ADK98112.1|  sucrose synthase                                      98.2    1e-22   Schiedea globosa
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        105   1e-22   Nicotiana sylvestris
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        105   1e-22   Nicotiana tomentosiformis
gb|ABV02029.1|  sucrose sythase                                         105   1e-22   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        105   2e-22   Sesamum indicum [beniseed]
ref|NP_001275286.1|  sucrose synthase                                   105   2e-22   Solanum tuberosum [potatoes]
gb|AAA97571.1|  sucrose synthase                                        105   2e-22   Solanum tuberosum [potatoes]
emb|CAA09681.1|  sucrose synthase                                       105   2e-22   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   105   2e-22   
emb|CAA67195.1|  sucrose synthase                                     99.4    2e-22   Pisum sativum [garden pea]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            105   2e-22   Solanum tuberosum [potatoes]
gb|ADW09923.1|  putative sucrose synthase                             97.8    2e-22   Schiedea globosa
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    104   2e-22   Daucus carota [carrots]
gb|ADW09914.1|  putative sucrose synthase                             97.4    2e-22   Schiedea globosa
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        104   3e-22   
gb|AHL84158.1|  sucrose synthase                                        104   3e-22   Nicotiana tabacum [American tobacco]
gb|AHL29281.1|  sucrose synthase 1                                      103   9e-22   Camellia sinensis [black tea]
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    102   1e-21   Solanum tuberosum [potatoes]
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             101   3e-21   Phaseolus vulgaris [French bean]
gb|AAN76498.1|AF315375_1  sucrose synthase                              101   3e-21   Phaseolus vulgaris [French bean]
emb|CAI56307.1|  sucrose synthase                                       101   3e-21   Coffea canephora [robusta coffee]
gb|ABI17891.1|  sucrose synthase                                        101   3e-21   Coffea canephora [robusta coffee]
emb|CAJ32596.1|  sucrose synthase                                       101   3e-21   Coffea arabica [arabica coffee]
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        101   3e-21   Cicer arietinum [garbanzo]
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        101   3e-21   Pisum sativum [garden pea]
gb|AIJ28960.1|  sucrose synthase                                        101   3e-21   Manihot esculenta subsp. flabellifolia
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    101   3e-21   Vicia faba [broad bean]
emb|CAA09910.1|  sucrose synthase                                       101   3e-21   Pisum sativum [garden pea]
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        101   3e-21   Cicer arietinum [garbanzo]
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        100   5e-21   Eucalyptus grandis [rose gum]
ref|NP_001289655.1|  sucrose synthase                                   100   5e-21   Eucalyptus grandis [rose gum]
gb|AFK45264.1|  unknown                                               95.5    6e-21   Medicago truncatula
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    100   7e-21   Daucus carota [carrots]
gb|KJB82966.1|  hypothetical protein B456_013G222400                    100   8e-21   Gossypium raimondii
gb|AEV40460.1|  sucrose synthase 1                                      100   8e-21   Gossypium arboreum [tree cotton]
gb|KHG00606.1|  Sucrose synthase                                        100   8e-21   Gossypium arboreum [tree cotton]
gb|AEK81522.1|  sucrose synthase isoform D                              100   8e-21   Gossypium hirsutum [American cotton]
gb|ADR00484.1|  sucrose synthase                                      98.6    9e-21   Arachis hypogaea var. vulgaris [Spanish peanut]
ref|XP_010107074.1|  Sucrose synthase                                 99.8    1e-20   Morus notabilis
gb|AFS17277.1|  sucrose synthase 1                                    99.8    1e-20   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                     99.8    1e-20   Theobroma cacao [chocolate]
ref|XP_003609947.1|  Sucrose synthase                                 98.6    1e-20   
dbj|BAA88905.1|  sucrose synthase                                     99.8    1e-20   Citrus unshiu [satsuma mandarin]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg           99.8    1e-20   Citrus clementina [clementine]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                     99.8    1e-20   
dbj|BAA89049.1|  sucrose synthase                                     99.8    1e-20   Citrus unshiu [satsuma mandarin]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1      99.4    1e-20   Citrus sinensis [apfelsine]
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                 99.4    1e-20   Citrus sinensis [apfelsine]
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...  99.0    2e-20   Vigna radiata var. radiata [golden gram]
dbj|BAH56282.1|  sucrose synthase                                     99.0    2e-20   Vigna angularis [azuki bean]
gb|KHN17754.1|  Sucrose synthase                                      99.0    2e-20   Glycine soja [wild soybean]
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1      99.0    2e-20   
gb|AIJ28962.1|  sucrose synthase                                      99.0    2e-20   Manihot esculenta [manioc]
gb|ABD96570.1|  sucrose synthase                                      99.0    2e-20   Manihot esculenta [manioc]
gb|AIJ28961.1|  sucrose synthase                                      99.0    2e-20   Manihot esculenta [manioc]
gb|AGH29112.1|  sucrose synthase                                      99.0    2e-20   Jatropha curcas
gb|AGM14949.1|  sucrose synthase 4                                    99.0    2e-20   Hevea brasiliensis [jebe]
gb|AIJ28959.1|  sucrose synthase                                      99.0    2e-20   Manihot esculenta subsp. flabellifolia
gb|AEF56625.1|  sucrose synthase                                      99.0    2e-20   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|KDP33978.1|  hypothetical protein JCGZ_07549                       99.0    2e-20   Jatropha curcas
emb|CAB40795.1|  sucrose synthase                                     99.0    2e-20   Medicago truncatula
ref|XP_003609949.1|  Sucrose synthase                                 99.0    2e-20   Medicago truncatula
gb|AGQ57012.1|  sucrose synthase 1                                    99.0    2e-20   Hevea brasiliensis [jebe]
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...  99.0    2e-20   Medicago sativa [alfalfa]
dbj|BAM68526.1|  sucrose synthase                                     99.0    2e-20   Mangifera indica
dbj|BAM68527.1|  sucrose synthase                                     99.0    2e-20   Mangifera indica
dbj|BAM68521.1|  sucrose synthase                                     99.0    2e-20   Mangifera indica
dbj|BAM68520.1|  sucrose synthase                                     99.0    2e-20   Mangifera indica
gb|ABP88869.1|  sucrose synthase                                      99.0    2e-20   Medicago falcata [sickle alfalfa]
dbj|BAM37539.1|  sucrose synthase                                     98.6    3e-20   Mangifera indica
emb|CAB39757.2|  sucrose synthase                                     94.7    3e-20   Lotus japonicus
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg              98.6    3e-20   Erythranthe guttata [common monkey flower]
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1      98.6    3e-20   
ref|XP_003609946.1|  Sucrose synthase                                 98.6    3e-20   
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2      98.2    4e-20   
gb|AGM14948.1|  sucrose synthase 3                                    98.2    4e-20   Hevea brasiliensis [jebe]
gb|AAR19769.1|  sucrose synthase                                      98.2    4e-20   Beta vulgaris [beet]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                      97.8    5e-20   
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g           97.8    5e-20   Phaseolus vulgaris [French bean]
gb|AFO84090.1|  sucrose synthase                                      97.8    5e-20   Actinidia chinensis
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1      97.8    5e-20   
gb|KHN49081.1|  Sucrose synthase                                      97.8    5e-20   Glycine soja [wild soybean]
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1      97.8    5e-20   Glycine max [soybeans]
gb|KHN47619.1|  Sucrose synthase                                      97.8    5e-20   Glycine soja [wild soybean]
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                 97.8    5e-20   
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                 97.8    6e-20   
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                 97.8    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                      97.8    6e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                 97.4    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1      97.4    7e-20   Populus euphratica
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                 97.4    7e-20   
ref|NP_001237525.1|  sucrose synthase                                 97.4    7e-20   Glycine max [soybeans]
dbj|BAA89232.1|  wsus                                                 97.4    8e-20   Citrullus lanatus [wild melon]
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2      97.4    8e-20   Populus euphratica
gb|AEV40463.1|  sucrose synthase 4                                    97.4    8e-20   Gossypium arboreum [tree cotton]
ref|XP_008242292.1|  PREDICTED: sucrose synthase                      97.4    8e-20   Prunus mume [ume]
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg           97.4    8e-20   Prunus persica
gb|AFI57908.1|  sucrose synthase 1                                    97.4    8e-20   Prunus persica
gb|KGN66333.1|  hypothetical protein Csa_1G597800                     97.4    8e-20   Cucumis sativus [cucumbers]
gb|KJB65372.1|  hypothetical protein B456_010G092300                  97.4    8e-20   Gossypium raimondii
ref|XP_008450968.1|  PREDICTED: sucrose synthase                      97.4    8e-20   Cucumis melo [Oriental melon]
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                 97.4    8e-20   Cucumis sativus [cucumbers]
gb|AEN83999.1|  sucrose synthase                                      97.1    8e-20   Cucumis sativus [cucumbers]
gb|AEV40464.1|  sucrose synthase 5                                    97.1    9e-20   Gossypium arboreum [tree cotton]
dbj|BAD94975.1|  sucrose-UDP glucosyltransferase                      94.0    9e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80556.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80551.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|KEH37657.1|  sucrose synthase                                      97.1    1e-19   Medicago truncatula
gb|ADW80558.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80550.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80555.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|AHA41509.1|  sucrose synthase                                      97.1    1e-19   Populus deltoides
gb|ADW80552.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                    97.1    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80571.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADR81996.1|  sucrose synthase 1                                    96.7    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002324136.2|  sucrose synthase family protein                  96.7    1e-19   
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6      96.7    1e-19   
gb|ADW80566.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
gb|ADW80545.1|  sucrose synthase 1                                    96.7    1e-19   Populus tomentosa [Chinese white poplar]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                      96.7    1e-19   Malus domestica [apple tree]
gb|AGO61958.1|  sucrose synthase                                      94.7    1e-19   Prunus serrulata
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788           96.7    1e-19   
ref|XP_004287669.1|  PREDICTED: sucrose synthase                      96.7    2e-19   Fragaria vesca subsp. vesca
tpg|DAA45272.1|  TPA: putative sucrose synthase family protein        93.2    2e-19   
ref|XP_002516210.1|  sucrose synthase, putative                       96.3    2e-19   
gb|AII19313.1|  sucrose synthase 1                                    96.3    2e-19   Ricinus communis
gb|AAK59464.1|  putative sucrose synthase                             95.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA45273.1|  TPA: putative sucrose synthase family protein        93.6    2e-19   
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                 96.3    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_002275155.1|  PREDICTED: sucrose synthase                      95.9    2e-19   Vitis vinifera
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2    95.9    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like               95.9    2e-19   Camelina sativa [gold-of-pleasure]
emb|CAN82840.1|  hypothetical protein VITISV_024563                   95.9    3e-19   Vitis vinifera
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                    95.9    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1    95.9    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3    95.9    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg           95.9    3e-19   Capsella rubella
emb|CDY16569.1|  BnaC09g37040D                                        95.5    3e-19   Brassica napus [oilseed rape]
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...  95.5    3e-19   Brassica rapa
emb|CDX92432.1|  BnaA10g14710D                                        95.5    3e-19   
ref|NP_566865.2|  sucrose synthase 4                                  95.5    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like               95.5    3e-19   Tarenaya hassleriana [spider flower]
emb|CAC32462.1|  sucrose synthase isoform 3                           95.1    4e-19   Pisum sativum [garden pea]
gb|AAR03498.1|  sucrose synthase                                      95.1    4e-19   Populus tremuloides
gb|AIL23782.1|  sucrose synthase                                      95.1    4e-19   Prunus serrulata
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                    94.7    5e-19   Tarenaya hassleriana [spider flower]
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                    94.7    6e-19   Brassica rapa
emb|CDX70945.1|  BnaC03g10290D                                        94.7    6e-19   
gb|AEK81520.1|  sucrose synthase isoform B                            94.7    6e-19   Gossypium hirsutum [American cotton]
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...  94.7    6e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ACP17902.1|  sucrose synthase                                      94.7    7e-19   Phaseolus vulgaris [French bean]
ref|NP_197583.1|  sucrose synthase 1                                  94.7    7e-19   Arabidopsis thaliana [mouse-ear cress]
gb|ADM75097.1|  sucrose synthase-like protein                         87.8    7e-19   Picea sitchensis
gb|ADM75093.1|  sucrose synthase-like protein                         87.8    7e-19   Picea sitchensis
emb|CDX88838.1|  BnaA03g08110D                                        94.4    7e-19   
gb|ACF78506.1|  unknown                                               93.6    8e-19   Zea mays [maize]
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg           94.4    8e-19   
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...  94.4    8e-19   Alnus glutinosa
gb|EPS58089.1|  sucrose synthase                                      92.8    9e-19   Genlisea aurea
gb|ADM77484.1|  sucrose synthase-like protein                         89.0    1e-18   Picea sitchensis
gb|ADM77474.1|  sucrose synthase-like protein                         89.0    1e-18   Picea sitchensis
gb|AFA36485.1|  putative sucrose synthase 2                           90.5    1e-18   Lolium perenne [perennial ryegrass]
dbj|BAE06059.1|  sucrose synthase                                     94.0    1e-18   Potamogeton distinctus
gb|AAD28641.1|  sucrose synthase                                      93.6    1e-18   Gossypium hirsutum [American cotton]
gb|AGW23638.1|  sucrose synthase                                      94.0    1e-18   Lilium davidii
gb|AEN71067.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium tomentosum
gb|AEN71080.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium gossypioides
gb|AEN71068.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium tomentosum
ref|XP_010482198.1|  PREDICTED: sucrose synthase 2-like               87.8    1e-18   
gb|AAL27096.1|  sucrose synthase                                      93.6    1e-18   Zea mays [maize]
gb|AEN71066.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium darwinii
gb|ADY68845.1|  sucrose synthase                                      93.6    1e-18   Gossypium barbadense [Egyptian cotton]
gb|AEN71075.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium armourianum
gb|AEN71059.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium thurberi
ref|NP_001105194.1|  sucrose synthase2                                93.6    1e-18   
gb|AEN71063.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium mustelinum
gb|ADY68844.1|  sucrose synthase                                      93.6    1e-18   Gossypium barbadense [Egyptian cotton]
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like               93.6    1e-18   Zea mays [maize]
gb|AEN71060.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium laxum
gb|ADY68848.1|  sucrose synthase                                      93.6    1e-18   Gossypium hirsutum [American cotton]
gb|ADY68846.1|  sucrose synthase                                      93.6    1e-18   Gossypium herbaceum subsp. africanum
gb|ACV72640.1|  sucrose synthase 1                                    93.6    1e-18   Gossypium hirsutum [American cotton]
gb|AEN71079.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium aridum
gb|AEN71078.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium klotzschianum
gb|AEN71061.1|  sucrose synthase Sus1                                 93.6    1e-18   Gossypium schwendimanii
gb|AEV40462.1|  sucrose synthase 3                                    93.6    1e-18   Gossypium arboreum [tree cotton]
gb|ADM74146.1|  sucrose synthase-like protein                         87.0    2e-18   Picea sitchensis
gb|ADM74135.1|  sucrose synthase-like protein                         87.0    2e-18   Picea sitchensis
gb|ABK23178.1|  unknown                                               87.8    2e-18   Picea sitchensis
gb|AGV22112.1|  sucrose synthase 2                                    93.2    2e-18   Betula luminifera [liang ye hua]
ref|XP_009343357.1|  PREDICTED: sucrose synthase                      93.2    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like               93.2    2e-18   
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg           93.2    2e-18   Eutrema salsugineum [saltwater cress]
tpg|DAA45279.1|  TPA: putative sucrose synthase family protein        91.7    2e-18   
ref|XP_010271909.1|  PREDICTED: sucrose synthase                      92.8    3e-18   Nelumbo nucifera [Indian lotus]
emb|CAA57881.1|  sucrose synthase                                     92.8    3e-18   Oxybasis rubra [pigweed]
gb|ABW76422.1|  sucrose synthase                                      92.8    3e-18   Populus tremuloides
gb|AAM22755.1|  sucrose synthase                                      87.8    3e-18   Deschampsia antarctica
gb|ADW80583.1|  sucrose synthase 2                                    92.8    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                    92.8    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                    92.8    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADM77154.1|  sucrose synthase-like protein                         85.9    3e-18   Picea sitchensis
gb|ADW80610.1|  sucrose synthase 2                                    92.8    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80600.1|  sucrose synthase 2                                    92.8    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                    92.8    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADR81997.1|  sucrose synthase 2                                    92.4    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006381564.1|  sucrose synthase family protein                  92.4    3e-18   Populus trichocarpa [western balsam poplar]
gb|ADW80607.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80590.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
dbj|BAM75184.1|  sucrose synthase                                     89.7    3e-18   Ricinus communis
gb|ADW80605.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80576.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80597.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80608.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                    92.4    3e-18   Populus tomentosa [Chinese white poplar]
gb|ADW80611.1|  sucrose synthase 2                                    92.4    3e-18   
gb|ADW80596.1|  sucrose synthase 2                                    92.4    3e-18   
gb|ADW80587.1|  sucrose synthase 2                                    92.4    3e-18   
gb|ADW80602.1|  sucrose synthase 2                                    92.4    3e-18   
gb|ADW80589.1|  sucrose synthase 2                                    92.4    3e-18   
gb|ADW80586.1|  sucrose synthase 2                                    92.4    3e-18   
gb|ADW80604.1|  sucrose synthase 2                                    92.4    3e-18   
gb|ADW80593.1|  sucrose synthase 2                                    92.4    3e-18   
ref|XP_011039917.1|  PREDICTED: sucrose synthase                      92.4    4e-18   
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122           92.4    4e-18   
gb|EMT20174.1|  Sucrose synthase 2                                    92.0    4e-18   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like               92.0    4e-18   
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...  92.0    5e-18   
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2    92.0    5e-18   
gb|EAY99999.1|  hypothetical protein OsI_22001                        85.1    5e-18   
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1    92.0    5e-18   
gb|ADE77562.1|  unknown                                               88.6    6e-18   
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like               91.7    6e-18   
gb|EMS65561.1|  Sucrose synthase 2                                    91.7    6e-18   
ref|XP_009610442.1|  PREDICTED: sucrose synthase 4-like               89.0    8e-18   
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...  91.7    8e-18   
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...  91.3    9e-18   
ref|XP_006378062.1|  hypothetical protein POPTR_0010s01360g           89.0    9e-18   
gb|AGM14947.1|  sucrose synthase 2                                    91.3    1e-17   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein        91.3    1e-17   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                       91.3    1e-17   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890        91.3    1e-17   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                    91.3    1e-17   
gb|ADW80603.1|  sucrose synthase 2                                    91.3    1e-17   
gb|AJA37527.1|  sucrose synthase                                      91.3    1e-17   
gb|ABR15470.1|  sucrose synthase                                      91.3    1e-17   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                    90.9    1e-17   
ref|XP_002516963.1|  sucrose synthase, putative                       90.9    1e-17   
gb|ADW80599.1|  sucrose synthase 2                                    90.9    1e-17   
gb|AGV22111.1|  sucrose synthase 1                                    90.9    1e-17   
gb|ABF95854.1|  Sucrose synthase 2, putative, expressed               90.5    1e-17   
gb|ADW80579.1|  sucrose synthase 2                                    90.9    1e-17   
emb|CAB61893.1|  putative sucrose synthase type 1                     83.2    1e-17   
gb|ADW80577.1|  sucrose synthase 2                                    90.9    1e-17   
gb|AHM02468.1|  sucrose synthase                                      90.5    1e-17   
ref|NP_001050064.1|  Os03g0340500                                     90.5    2e-17   
gb|ADW80601.1|  sucrose synthase 2                                    90.5    2e-17   
gb|KCW67227.1|  hypothetical protein EUGRSUZ_F01010                   90.1    2e-17   
gb|AIL88516.1|  sucrose synthase type 2-1                             90.5    2e-17   
ref|NP_001268888.1|  sucrose synthase 2-like                          90.5    2e-17   
ref|XP_007035651.1|  Sucrose synthase 2 isoform 1                     90.1    2e-17   
ref|XP_008795811.1|  PREDICTED: sucrose synthase 4-like               87.0    2e-17   
gb|ACF85812.1|  unknown                                               84.7    2e-17   
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like               90.1    2e-17   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                     90.1    2e-17   
ref|XP_011079962.1|  PREDICTED: sucrose synthase 2                    90.1    2e-17   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                    90.1    2e-17   
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like               90.1    2e-17   
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920        90.1    2e-17   
gb|AGQ57013.1|  sucrose synthase 2                                    90.1    2e-17   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1    90.1    3e-17   
ref|NP_001289661.1|  sucrose synthase-like                            90.1    3e-17   
ref|XP_010932355.1|  PREDICTED: sucrose synthase 2-like isoform X2    90.1    3e-17   
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                 90.1    3e-17   
ref|XP_002523115.1|  sucrose synthase, putative                       89.7    3e-17   
ref|XP_006597734.1|  PREDICTED: sucrose synthase 2-like isoform X2    89.7    3e-17   
gb|KHN20784.1|  Sucrose synthase 2                                    89.7    3e-17   
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                    89.7    3e-17   
ref|XP_003547390.1|  PREDICTED: sucrose synthase 2-like isoform X1    89.7    3e-17   
emb|CAA50317.1|  sucrose synthase                                     89.7    3e-17   
gb|AGM14950.1|  sucrose synthase 5                                    89.7    3e-17   
ref|XP_008223239.1|  PREDICTED: sucrose synthase 2                    86.3    3e-17   
gb|AEO09338.2|  sucrose synthase                                      89.7    3e-17   
dbj|BAE06058.1|  sucrose synthase                                     89.7    4e-17   
emb|CDO97805.1|  unnamed protein product                              89.4    4e-17   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...  89.4    4e-17   
gb|AIL88517.1|  sucrose synthase type 2-2                             89.4    4e-17   
ref|XP_004984440.1|  PREDICTED: sucrose synthase 4-like               89.4    4e-17   
gb|AAA34304.1|  sucrose synthase type 1                               85.5    5e-17   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like               89.4    5e-17   
gb|AEQ94149.1|  sucrose synthase1                                     85.9    5e-17   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                    89.4    5e-17   
gb|AAM95944.1|  sucrose synthase                                      89.4    5e-17   
gb|ADP88918.1|  sucrose synthase                                      89.0    6e-17   
gb|ABR25521.1|  sucrose synthase metabolism                           85.1    6e-17   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like               89.0    6e-17   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like               89.0    6e-17   
dbj|BAM05649.1|  sucrose synthase 3                                   89.0    6e-17   
ref|XP_002302727.1|  sucrose synthase family protein                  89.0    6e-17   
gb|ACF80843.1|  unknown                                               84.7    7e-17   
ref|XP_011006464.1|  PREDICTED: sucrose synthase 2                    89.0    7e-17   
ref|XP_006651359.1|  PREDICTED: sucrose synthase 4-like               89.0    7e-17   
gb|EYU46747.1|  hypothetical protein MIMGU_mgv1a001481mg              88.6    7e-17   
pir||S22535  sucrose synthase (EC 2.4.1.13) 1 - rice (fragment)       84.7    8e-17
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                    88.6    8e-17   
gb|KDO71750.1|  hypothetical protein CISIN_1g003726mg                 88.6    8e-17   
ref|NP_001060278.1|  Os07g0616800                                     88.6    8e-17   
gb|AAC41682.1|  sucrose synthase 3                                    88.6    8e-17   
gb|EAZ04713.1|  hypothetical protein OsI_26874                        88.6    8e-17   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like               88.6    8e-17   
gb|AAA34305.1|  sucrose synthase type 2                               85.1    8e-17   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg           88.6    8e-17   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                    88.6    8e-17   
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like               88.6    9e-17   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2    88.6    9e-17   
emb|CDX86250.1|  BnaA06g29670D                                        88.6    9e-17   
ref|XP_010088307.1|  Sucrose synthase 2                               88.2    9e-17   
ref|XP_002865717.1|  hypothetical protein ARALYDRAFT_494980           88.6    9e-17   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...  88.6    9e-17   
gb|EYU46748.1|  hypothetical protein MIMGU_mgv1a001481mg              88.6    9e-17   
ref|XP_010440290.1|  PREDICTED: sucrose synthase 2                    88.6    9e-17   
ref|XP_010558803.1|  PREDICTED: sucrose synthase 2                    88.2    9e-17   
sp|Q42652.1|SUSY_BETVU  RecName: Full=Sucrose synthase; AltName: ...  88.2    9e-17   
gb|AEN79501.1|  sucrose synthase 2                                    88.2    9e-17   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                    88.2    9e-17   
ref|NP_001280838.1|  sucrose synthase 3                               88.2    9e-17   
ref|NP_199730.1|  sucrose synthase 2                                  88.2    9e-17   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                    88.2    9e-17   
gb|KDO87153.1|  hypothetical protein CISIN_1g003492mg                 88.2    9e-17   
dbj|BAB20799.1|  sucrose synthase 1                                   88.2    9e-17   
ref|NP_001275237.1|  sucrose synthase                                 88.2    1e-16   
gb|ABR87939.1|  sucrose synthase 1                                    88.2    1e-16   
ref|XP_010684343.1|  PREDICTED: sucrose synthase                      88.2    1e-16   
ref|XP_009151715.1|  PREDICTED: sucrose synthase 2                    88.2    1e-16   
ref|XP_010092252.1|  Sucrose synthase 2                               88.2    1e-16   
gb|AAK65960.1|AF273253_1  sucrose synthase                            88.2    1e-16   
gb|KDO87158.1|  hypothetical protein CISIN_1g003492mg                 87.8    1e-16   
ref|XP_006444401.1|  hypothetical protein CICLE_v10018889mg           87.8    1e-16   
gb|AIL88515.1|  sucrose synthase type 3                               88.2    1e-16   
emb|CAA43303.1|  sucrose synthase                                     88.2    1e-16   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                 88.2    1e-16   
ref|XP_006395087.1|  hypothetical protein EUTSA_v10003667mg           88.2    1e-16   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like               88.2    1e-16   
dbj|BAA88904.1|  sucrose synthase                                     88.2    1e-16   
dbj|BAB10337.1|  sucrose synthase                                     88.2    1e-16   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                 88.2    1e-16   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg           88.2    1e-16   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                    87.8    1e-16   
gb|ADY02961.1|  sucrose synthase                                      87.8    1e-16   
ref|XP_007225257.1|  hypothetical protein PRUPE_ppa001573mg           87.8    1e-16   
gb|AFM52233.1|  putative sucrose synthase 2                           87.8    1e-16   
ref|XP_004247973.1|  PREDICTED: sucrose synthase 2-like               87.8    2e-16   
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                    87.4    2e-16   
ref|XP_009391495.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...  87.4    2e-16   
gb|AFZ78660.1|  sucrose synthase                                      87.4    2e-16   
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1    87.4    2e-16   
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                    87.4    2e-16   
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2    87.4    2e-16   
gb|EMS57564.1|  Sucrose synthase 2                                    87.4    2e-16   
gb|AFM52237.1|  putative sucrose synthase 6                           87.0    2e-16   
gb|AEN71101.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71099.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71086.1|  sucrose synthase SusA1                                87.0    2e-16   
emb|CAB61891.1|  putative Sucrose synthase type 1                     80.1    2e-16   
gb|AEN71088.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEZ00745.1|  SusA1                                                 87.0    2e-16   
gb|AEV40896.1|  sucrose synthase                                      87.0    2e-16   
gb|AEV40894.1|  sucrose synthase                                      87.0    2e-16   
gb|AEN71085.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71084.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71092.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEV40893.1|  sucrose synthase                                      87.0    2e-16   
gb|AEN71106.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71104.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71103.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71096.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71094.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71093.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71091.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71090.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71083.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEZ00746.1|  SusA1                                                 87.0    2e-16   
gb|AEN71089.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|AEN71105.1|  sucrose synthase SusA1                                87.0    2e-16   
gb|KDP27836.1|  hypothetical protein JCGZ_18916                       87.0    3e-16   
pir||S24966  sucrose synthase (EC 2.4.1.13) - barley (fragment)       86.7    3e-16
emb|CAB38022.1|  sucrose synthase                                     87.0    3e-16   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                    87.0    3e-16   
gb|AFW88069.1|  sucrose synthase1                                     85.1    3e-16   
gb|AAL50570.1|AF412037_1  sucrose synthase                            87.0    3e-16   
ref|XP_008789904.1|  PREDICTED: sucrose synthase 4                    87.0    3e-16   
emb|CDP17108.1|  unnamed protein product                              86.7    3e-16   
emb|CAJ32597.1|  sucrose synthase                                     86.7    3e-16   
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                    86.7    3e-16   
emb|CAZ64535.1|  sucrose synthase                                     86.7    3e-16   
dbj|BAJ99820.1|  predicted protein                                    86.7    3e-16   
gb|ABH07386.1|  sucrose synthase                                      86.7    3e-16   
sp|P31922.1|SUS1_HORVU  RecName: Full=Sucrose synthase 1; AltName...  86.7    3e-16   
emb|CDX85398.1|  BnaC07g27090D                                        86.7    4e-16   
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                 86.7    4e-16   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                    86.7    4e-16   
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                  86.3    4e-16   
gb|KCW47010.1|  hypothetical protein EUGRSUZ_K00816                   84.7    4e-16   
gb|KCW58409.1|  hypothetical protein EUGRSUZ_H01094                   85.9    4e-16   
ref|XP_008246168.1|  PREDICTED: sucrose synthase 2-like               83.2    4e-16   
emb|CAZ65725.1|  sucrose synthase                                     86.3    5e-16   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                    86.3    5e-16   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                    86.3    5e-16   
gb|AAL50571.1|AF412038_1  sucrose synthase                            86.3    5e-16   
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1      86.3    5e-16   
emb|CAL25362.2|  sucrose synthase                                     86.3    5e-16   
ref|XP_007200961.1|  hypothetical protein PRUPE_ppa002723mg           85.9    5e-16   
gb|AAL50572.2|AF412039_1  sucrose synthase                            86.3    5e-16   
ref|XP_009414138.1|  PREDICTED: sucrose synthase 4-like               86.3    5e-16   
gb|ACL79522.1|  sucrose synthase                                      82.8    5e-16   
ref|XP_006279996.1|  hypothetical protein CARUB_v10025867mg           85.9    6e-16   
gb|KHN43494.1|  Sucrose synthase 2                                    85.9    6e-16   
gb|EMT33394.1|  Sucrose synthase 1                                    85.9    7e-16   
ref|XP_002979153.1|  sucrose synthase                                 85.9    7e-16   
dbj|BAA88981.1|  sucrose synthase                                     85.9    7e-16   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like               85.9    7e-16   
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like               85.9    7e-16   
gb|ACN36258.1|  unknown                                               85.1    7e-16   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like               85.9    7e-16   
gb|KEH24408.1|  sucrose synthase                                      85.9    7e-16   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2    85.5    7e-16   
emb|CAA04543.1|  sucrose synthase type I                              85.5    7e-16   
gb|AHN50409.1|  sucrose synthase 2                                    85.5    8e-16   
emb|CAB38021.1|  sucrose synthase                                     85.5    8e-16   
gb|AEN71087.1|  sucrose synthase SusA1                                85.5    8e-16   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like               85.5    8e-16   
emb|CAA03935.1|  sucrose synthase type 2                              85.5    8e-16   
gb|AEX32875.1|  sucrose synthase 2                                    85.5    9e-16   
gb|AFY03626.1|  sucrose synthase                                      85.5    9e-16   
ref|NP_001057047.1|  Os06g0194900                                     85.5    9e-16   
ref|XP_009111303.1|  PREDICTED: sucrose synthase 3                    85.5    9e-16   



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  751  YTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  751  YTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>gb|ADK98103.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98113.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09889.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09890.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09915.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09916.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  751  YTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>dbj|BAN18504.1| sucrose synthase, partial [Schiedea trinervis]
 dbj|BAN18505.1| sucrose synthase, partial [Schiedea obovata]
 dbj|BAN18506.1| sucrose synthase, partial [Schiedea viscosa]
 dbj|BAN18507.1| sucrose synthase, partial [Schiedea verticillata]
Length=118

 Score =   102 bits (254),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADW09887.1| putative sucrose synthase, partial [Schiedea stellarioides]
 gb|ADW09888.1| putative sucrose synthase, partial [Schiedea stellarioides]
Length=114

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  751  YTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>gb|ADK98120.1| sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09897.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09898.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98109.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98118.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09895.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09896.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>dbj|BAN18500.1| sucrose synthase, partial [Schiedea pentandra]
 dbj|BAN18501.1| sucrose synthase, partial [Schiedea kauaiensis]
 dbj|BAN18502.1| sucrose synthase, partial [Schiedea perlmanii]
 dbj|BAN18509.1| sucrose synthase, partial [Schiedea stellarioides]
Length=118

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADW09907.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09908.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09905.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09906.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98101.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98102.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09927.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09928.1| putative sucrose synthase, partial [Schiedea globosa]
Length=113

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  58   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  112



>gb|ADW09936.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98116.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADA68250.1| sucrose synthase, partial [Schiedea globosa]
 dbj|BAN18490.1| sucrose synthase, partial [Schiedea spergulina]
 dbj|BAN18491.1| sucrose synthase, partial [Schiedea kealiae]
 dbj|BAN18492.1| sucrose synthase, partial [Schiedea mannii]
 dbj|BAN18493.1| sucrose synthase, partial [Schiedea menziesii]
 dbj|BAN18494.1| sucrose synthase, partial [Schiedea hookeri]
 dbj|BAN18495.1| sucrose synthase, partial [Schiedea sarmentosa]
 dbj|BAN18496.1| sucrose synthase, partial [Schiedea lydgatei]
 dbj|BAN18497.1| sucrose synthase, partial [Schiedea haleakalensis]
 dbj|BAN18498.1| sucrose synthase, partial [Schiedea salicaria]
 dbj|BAN18499.1| sucrose synthase, partial [Schiedea globosa]
Length=118

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADW09921.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09922.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADA68251.1| sucrose synthase, partial [Schiedea membranacea]
 dbj|BAN18503.1| sucrose synthase, partial [Schiedea helleri]
 dbj|BAN18508.1| sucrose synthase, partial [Schiedea membranacea]
Length=118

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADW09926.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98097.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98098.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98099.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98100.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98104.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98105.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98106.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98107.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98108.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98110.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98111.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98114.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98115.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98117.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98119.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09893.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09894.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09899.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09900.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09902.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09909.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09910.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09919.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09920.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09931.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09932.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09935.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09937.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09938.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09904.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09911.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09912.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09913.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09925.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09929.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09930.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09891.1| putative sucrose synthase, partial [Schiedea membranacea]
 gb|ADW09892.1| putative sucrose synthase, partial [Schiedea membranacea]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09901.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09933.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09934.1| putative sucrose synthase, partial [Schiedea globosa]
Length=113

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  58   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  112



>gb|ADW09903.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09917.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09918.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  751  YTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  751  YTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  751  YTWQIYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA++
Sbjct  751  YTWQIYSDRLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAESVPLAVD  805



>gb|ADA68252.1| sucrose synthase, partial [Honckenya peploides]
Length=118

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LD LE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   YTWQIYSDRLLTLAGVYGFWKYVSNLDHLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAVE  805



>gb|ADK98112.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YT QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTXQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VSKLDR EIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  751  YTWQIYSDRLLTLAGVYGFWKYVSKLDRREIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>emb|CAA67195.1| sucrose synthase [Pisum sativum]
Length=164

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RK AE VPLA+E
Sbjct  109  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKSAESVPLAVE  163



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ADW09923.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09924.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSD LLTLA VYGFWK+VS LDRLE RRYLEMFY LK+RKLAE VPLAIE
Sbjct  59   YTWQIYSDXLLTLAGVYGFWKYVSNLDRLEARRYLEMFYXLKYRKLAESVPLAIE  113



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  159
            YTWQIYS+RLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RKLAE VPLA
Sbjct  753  YTWQIYSERLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKLAESVPLA  805



>gb|ADW09914.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YT QIYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  59   YTRQIYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWQIYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAAE  805



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTLA+VYGFWKHVSKLDRLEIRRYL+MFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSERLLTLAAVYGFWKHVSKLDRLEIRRYLDMFYALKYRKMAEAVPLAAE  805



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RL+TLA VYGFWK+VSKLDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  751  YTWQIYSERLMTLAGVYGFWKYVSKLDRLETRRYLEMFYALKYRKLAESVPLAIE  805



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+ LLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  751  YTWQIYSESLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  751  YTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  751  YTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  751  YTWQIYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDRLE RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRLESRRYLEMFYALKYRKLAESVPLTVE  805



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AFK45264.1| unknown [Medicago truncatula]
Length=175

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW IY  RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  121  YTWTIYFQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  175



>sp|O49845.1|SUS2_DAUCA RecName: Full=Sucrose synthase isoform 2; AltName: Full=Sucrose 
synthase isoform II; AltName: Full=Sucrose-UDP glucosyltransferase 
2; AltName: Full=Susy*Dc2 [Daucus carota]
 emb|CAA76057.1| sucrose synthase isoform II [Daucus carota]
Length=801

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVSKLDR+EIRRYLEMF ALK+R LAE VPLA++
Sbjct  747  YTWQIYSERLLTLGGVYGFWKHVSKLDRIEIRRYLEMFCALKYRNLAESVPLAVD  801



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  759  YTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  813



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADR00484.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=490

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  435  YTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  489



>ref|XP_010107074.1| Sucrose synthase [Morus notabilis]
 gb|EXC13595.1| Sucrose synthase [Morus notabilis]
Length=806

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA++
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVD  805



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  748  YTWQIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  797  YTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  851



>ref|XP_003609947.1| Sucrose synthase [Medicago truncatula]
Length=531

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  477  YTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  531



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KDO73788.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=783

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  729  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  783



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  746  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  746  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  746  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  746  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  750  YTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  804



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  746  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>emb|CAB39757.2| sucrose synthase [Lotus japonicus]
Length=233

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  178  YTWKIYSDRLLTLTGVYGFWKHVTNLDRRENKRYLEMFYALKYSKLAESVPLAVE  232



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLL LA VYGFWK+VSKLDRLEI+RYLEM YALK RKLAE VPLA+E
Sbjct  812  YTWQIYSERLLNLAGVYGFWKYVSKLDRLEIKRYLEMLYALKLRKLAEAVPLAVE  866



>ref|XP_008391777.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
 ref|XP_008391781.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
Length=806

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSNLDRLECRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_003609946.1| Sucrose synthase [Medicago truncatula]
Length=893

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  839  YTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  893



>ref|XP_008391788.1| PREDICTED: sucrose synthase-like isoform X2 [Malus domestica]
Length=806

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSNLDRLECRRYLEMFYALKFRKLAASVPLAVE  806



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDRLE +RYLEMFYALK+ KLAE VPL +E
Sbjct  755  YTWQIYSQRLLTLTGVYGFWKHVSKLDRLESKRYLEMFYALKYHKLAESVPLTVE  809



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  748  YTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  748  YTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_007138617.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 ref|XP_007138618.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10611.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10612.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
Length=806

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  751  YTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA++
Sbjct  751  YTWQIYSERLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEAVPLAVD  805



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  751  YTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  751  YTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  751  YTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  751  YTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSNLDRLENRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  751  YTWQIYSGRLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEMVPLAVE  805



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSNLDRLENRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  758  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  812



>ref|XP_008338289.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAAE  805



>dbj|BAA89232.1| wsus [Citrullus lanatus]
Length=806

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPQAVD  805



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  805



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>gb|KGN66333.1| hypothetical protein Csa_1G597800 [Cucumis sativus]
Length=783

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  728  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPPAVD  782



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_008450968.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450969.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450970.1| PREDICTED: sucrose synthase [Cucumis melo]
Length=806

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPPAVD  805



>ref|XP_004144053.1| PREDICTED: sucrose synthase-like [Cucumis sativus]
 ref|XP_004159357.1| PREDICTED: sucrose synthase-like [Cucumis sativus]
Length=806

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPPAVD  805



>gb|AEN83999.1| sucrose synthase [Cucumis sativus]
Length=806

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLA+ VP A++
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLADSVPPAVD  805



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  778  YTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  832



>dbj|BAD94975.1| sucrose-UDP glucosyltransferase [Arabidopsis thaliana]
Length=279

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  159
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  224  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  276



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|KEH37657.1| sucrose synthase [Medicago truncatula]
Length=804

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  749  YTWQIYSDRLLTLTGVYGFWKHVTNLDRRESKRYLEMFYALKYSKLAESVPLAVE  803



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_004488146.1| PREDICTED: sucrose synthase-like isoform X6 [Cicer arietinum]
Length=806

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  751  YTWQIYSDRLLTLTGVYGFWKHVTNLDRRESKRYLEMFYALKYNKLAEAVPLAVE  805



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+ KLA  VPLA+E
Sbjct  752  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYSKLAASVPLAVE  806



>gb|AGO61958.1| sucrose synthase, partial [Prunus serrulata]
Length=437

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YT QIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA E
Sbjct  382  YTRQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAEE  436



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  753  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK++KLA+ VPLA E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYKKLADSVPLAEE  806



>tpg|DAA45272.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=282

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  225  YTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  279



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  719  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  773



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  805



>gb|AAK59464.1| putative sucrose synthase [Arabidopsis thaliana]
Length=532

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  477  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  531



>tpg|DAA45273.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=383

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  326  YTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  380



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALK+RKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKYRKLAASVPLAVE  806



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  751  YTWKIYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>ref|XP_010454391.1| PREDICTED: sucrose synthase 1-like isoform X2 [Camelina sativa]
Length=808

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  753  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_010420928.1| PREDICTED: sucrose synthase 1-like [Camelina sativa]
Length=808

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  753  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  751  YTWKIYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>ref|XP_010493195.1| PREDICTED: sucrose synthase 1 [Camelina sativa]
Length=808

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  753  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_010454390.1| PREDICTED: sucrose synthase 1-like isoform X1 [Camelina sativa]
Length=862

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  807  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  861



>ref|XP_010454392.1| PREDICTED: sucrose synthase 1-like isoform X3 [Camelina sativa]
Length=838

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  783  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  837



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  753  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>ref|XP_009120766.1| PREDICTED: LOW QUALITY PROTEIN: sucrose synthase 1 [Brassica 
rapa]
Length=805

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  753  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  807



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  752  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  806



>emb|CAC32462.1| sucrose synthase isoform 3 [Pisum sativum]
Length=804

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  749  YTWQIYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYSKLAESVPLAVE  803



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  751  YTWKIYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AIL23782.1| sucrose synthase [Prunus serrulata]
Length=806

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YT QIYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTRQIYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAQE  805



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+ KLAE VPLA E
Sbjct  751  YTWQIYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYPKLAESVPLAEE  805



>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  159
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  753  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>gb|ACP17902.1| sucrose synthase [Phaseolus vulgaris]
Length=806

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQ+YSDRLLTL  VYGFWKHV+ L+R E +R LEMFYALK+RKLAE VPLAIE
Sbjct  751  YTWQVYSDRLLTLTGVYGFWKHVTNLERRESKRSLEMFYALKYRKLAESVPLAIE  805



>ref|NP_197583.1| sucrose synthase 1 [Arabidopsis thaliana]
 ref|NP_001031915.1| sucrose synthase 1 [Arabidopsis thaliana]
 sp|P49040.3|SUSY1_ARATH RecName: Full=Sucrose synthase 1; Short=AtSUS1; AltName: Full=Sucrose-UDP 
glucosyltransferase 1 [Arabidopsis thaliana]
 dbj|BAH19538.1| AT5G20830 [Arabidopsis thaliana]
 gb|AED92894.1| sucrose synthase 1 [Arabidopsis thaliana]
 gb|AED92895.1| sucrose synthase 1 [Arabidopsis thaliana]
Length=808

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  159
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  753  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>gb|ADM75097.1| sucrose synthase-like protein, partial [Picea sitchensis]
Length=100

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE*MKAG  180
            YTW+IY+++L+TL+ VYGFWK+VSKL+RLE RRYLEMFY LK+R L + VPLA+E   A 
Sbjct  34   YTWKIYAEKLMTLSGVYGFWKYVSKLERLETRRYLEMFYTLKYRDLVKTVPLAVE-ESAN  92

Query  181  GI  186
            GI
Sbjct  93   GI  94



>gb|ADM75093.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75094.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75095.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75096.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75098.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75099.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75100.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75101.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75102.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75103.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75104.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75105.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75106.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75107.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75108.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75109.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75110.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75111.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75112.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75113.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75114.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75115.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75116.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75117.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75118.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75119.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75120.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75121.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75122.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75123.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75124.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75125.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75126.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75127.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75128.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75129.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75130.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75131.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75132.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75133.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM75134.1| sucrose synthase-like protein, partial [Picea sitchensis]
Length=100

 Score = 87.8 bits (216),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE*MKAG  180
            YTW+IY+++L+TL+ VYGFWK+VSKL+RLE RRYLEMFY LK+R L + VPLA+E   A 
Sbjct  34   YTWKIYAEKLMTLSGVYGFWKYVSKLERLETRRYLEMFYTLKYRDLVKTVPLAVE-ESAN  92

Query  181  GI  186
            GI
Sbjct  93   GI  94



>emb|CDX88838.1| BnaA03g08110D [Brassica napus]
Length=743

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  688  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  742



>gb|ACF78506.1| unknown [Zea mays]
Length=560

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  503  YTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  557



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  159
            YTWQIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  795  YTWQIYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  847



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  V  FWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  749  YTWKIYSERLLTLTGVTAFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  803



>gb|EPS58089.1| sucrose synthase, partial [Genlisea aurea]
Length=472

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKLDRLE RRYLEMFY LK+R L +DVPLA E
Sbjct  418  YTWKIYSERLMTLAGVYGFWKYVSKLDRLETRRYLEMFYILKYRNLVKDVPLAEE  472



>gb|ADM77484.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77490.1| sucrose synthase-like protein, partial [Picea sitchensis]
Length=163

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RL+TLA VYGFWK+VSKL R E RRYLEMFY LK+R L + VPLA+E
Sbjct  97   YTWQIYSERLMTLAGVYGFWKYVSKLGRRETRRYLEMFYILKYRDLVKTVPLAVE  151



>gb|ADM77474.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77475.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77476.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77477.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77478.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77479.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77480.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77481.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77482.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77483.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77485.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77486.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77487.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77488.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77489.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77491.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77492.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77493.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77494.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77495.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77496.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77497.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77498.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77499.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77500.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77501.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77502.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77503.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77504.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77505.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77506.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77507.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77508.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77509.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77510.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77511.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77512.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77513.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77514.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77515.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77516.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77517.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77518.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM77519.1| sucrose synthase-like protein, partial [Picea sitchensis]
Length=163

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RL+TLA VYGFWK+VSKL R E RRYLEMFY LK+R L + VPLA+E
Sbjct  97   YTWQIYSERLMTLAGVYGFWKYVSKLGRRETRRYLEMFYILKYRDLVKTVPLAVE  151



>gb|AFA36485.1| putative sucrose synthase 2, partial [Lolium perenne]
Length=249

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+R E RRYLEMFY LKFR+LA+ VPLA++
Sbjct  192  YTWKIYSERLMTLAGVYGFWKYVSKLERRETRRYLEMFYILKFRELAKSVPLAVD  246



>dbj|BAE06059.1| sucrose synthase [Potamogeton distinctus]
Length=842

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW++YS+RL+TL+ VYGFWK+VS LDR E RRYLEMFYALK+R LA+ VPLA++
Sbjct  752  YTWKLYSERLMTLSGVYGFWKYVSNLDRRETRRYLEMFYALKYRNLAKSVPLAVD  806



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  752  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  806



>gb|AGW23638.1| sucrose synthase [Lilium davidii]
Length=846

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW++YS+RL+TLA VYGFWK+VS LDRLE +RYLEMFYALK+RKLA+ VPLA++
Sbjct  755  YTWKLYSERLMTLAGVYGFWKYVSNLDRLETKRYLEMFYALKYRKLAKSVPLAVD  809



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_010482198.1| PREDICTED: sucrose synthase 2-like [Camelina sativa]
Length=125

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+ YS+RLLTLA VY FWKHVSKL+R E RRYLEMFY+LKFR LA  +PLA +
Sbjct  69   YTWKKYSERLLTLAGVYSFWKHVSKLERRETRRYLEMFYSLKFRDLANSIPLATD  123



>gb|AAL27096.1| sucrose synthase [Zea mays]
Length=796

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  739  YTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  793



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|NP_001105194.1| sucrose synthase2 [Zea mays]
 gb|AAM89473.1| sucrose synthase 3 [Zea mays]
Length=809

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  752  YTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  806



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_008655408.1| PREDICTED: sucrose synthase 4-like [Zea mays]
Length=809

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  752  YTWKIYSERLMTLAGVYGFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  806



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  751  YTWKIYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADM74146.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74156.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74177.1| sucrose synthase-like protein, partial [Picea sitchensis]
Length=106

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIY++RL+TL+ VYGFWK+VSKL+R E RRYLEMFY LK+R L + VPLA+E
Sbjct  40   YTWQIYAERLMTLSGVYGFWKYVSKLERRETRRYLEMFYTLKYRDLVKTVPLAVE  94



>gb|ADM74135.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74136.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74137.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74138.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74139.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74140.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74141.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74142.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74143.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74144.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74145.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74147.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74148.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74149.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74150.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74151.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74152.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74153.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74154.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74155.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74157.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74158.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74159.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74160.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74161.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74162.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74163.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74164.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74165.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74166.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74167.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74168.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74169.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74170.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74171.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74172.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74173.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74174.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74175.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74176.1| sucrose synthase-like protein, partial [Picea sitchensis]
 gb|ADM74178.1| sucrose synthase-like protein, partial [Picea sitchensis]
Length=106

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIY++RL+TL+ VYGFWK+VSKL+R E RRYLEMFY LK+R L + VPLA+E
Sbjct  40   YTWQIYAERLMTLSGVYGFWKYVSKLERRETRRYLEMFYTLKYRDLVKTVPLAVE  94



>gb|ABK23178.1| unknown [Picea sitchensis]
Length=135

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE*MKAG  180
            YTW+IY+++L+TL+ VYGFWK+VSKL+RLE RRYLEMFY LK+R L + VPLA+E   A 
Sbjct  69   YTWKIYAEKLMTLSGVYGFWKYVSKLERLETRRYLEMFYTLKYRDLVKTVPLAVE-ESAN  127

Query  181  GI  186
            GI
Sbjct  128  GI  129



>gb|AGV22112.1| sucrose synthase 2 [Betula luminifera]
Length=807

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RLLTL  VYGFWKHVS LDRLE RRY+ MFYALK+RKLAE VP  +E
Sbjct  753  YTWKIYSERLLTLTGVYGFWKHVSNLDRLESRRYIGMFYALKYRKLAESVPPVVE  807



>ref|XP_009343357.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=807

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RLLTL  VYGFWK VS LDR E RRYLEMFYALK+RKLA  VPLA+E
Sbjct  752  YTWQIYSERLLTLTGVYGFWKDVSTLDRRESRRYLEMFYALKYRKLAASVPLAVE  806



>ref|XP_009410254.1| PREDICTED: sucrose synthase 1-like [Musa acuminata subsp. malaccensis]
Length=816

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW++YS+RL+TLA VYGFWKHVS L+R E RRYLEMFYALK+RKLA  VPLA++
Sbjct  752  YTWKLYSERLMTLAGVYGFWKHVSNLERRETRRYLEMFYALKYRKLAASVPLAVD  806



>ref|XP_006400648.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
 gb|ESQ42101.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
Length=806

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS RLLTL  VYGFWKHVS LD LE RRYLEMFYALK+R LA+ VPLA E
Sbjct  751  YTWQIYSQRLLTLTGVYGFWKHVSNLDHLESRRYLEMFYALKYRPLAQAVPLAQE  805



>tpg|DAA45279.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=431

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+R E RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  374  YTWKIYSERLMTLAGVYGFWKYVSKLERRETRRYLEMFYILKFRELAKTVPLAID  428



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTWQIYS+RL+TL+ VYGFWK+VSKL+R E RRYLEMFYALK+RKLA+ VPLA++
Sbjct  751  YTWQIYSERLMTLSGVYGFWKYVSKLERRETRRYLEMFYALKYRKLAQMVPLAVD  805



>emb|CAA57881.1| sucrose synthase [Oxybasis rubra]
Length=803

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++K AE VPL +E
Sbjct  748  YTWKIYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKPAESVPLLVE  802



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  749  YTWKIYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AAM22755.1| sucrose synthase [Deschampsia antarctica]
Length=159

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +1

Query  1    YTWQIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  165
            YTW+IYS+RL+TLA VYGFWK+VSKL+R E RRYLEMFY LKFR+L + VPLA++
Sbjct  102  YTWKIYSERLMTLAGVYGFWKYVSKLERRETRRYLEMFYILKFRELVKSVPLALD  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490