BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS139F01

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    402   4e-134   Solanum tuberosum [potatoes]
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    409   1e-133   Cucurbita maxima [Boston marrow]
gb|KCW88792.1|  hypothetical protein EUGRSUZ_A01129                     403   2e-133   Eucalyptus grandis [rose gum]
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        408   1e-132   Cucumis melo [Oriental melon]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    408   1e-132   
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   403   1e-132   Citrus sinensis [apfelsine]
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     403   2e-132   Eucalyptus grandis [rose gum]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg             405   2e-132   
gb|ADZ57218.1|  aconitase protein                                       405   2e-132   Litchi chinensis [litchi]
gb|AAO62410.1|  aconitase                                               405   3e-132   Solanum pennellii
emb|CBE71058.1|  aconitate hydratase 2                                  404   4e-132   Citrus clementina [clementine]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    406   7e-132   Cucumis sativus [cucumbers]
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                   404   7e-132   Citrus sinensis [apfelsine]
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                   404   7e-132   Citrus sinensis [apfelsine]
gb|AAP30039.1|  aconitase                                               404   1e-131   Solanum pennellii
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                   404   1e-131   Citrus sinensis [apfelsine]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        405   3e-131   Solanum lycopersicum
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    405   3e-131   Solanum tuberosum [potatoes]
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             405   3e-131   Citrus clementina [clementine]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    404   8e-131   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   404   8e-131   Citrus sinensis [apfelsine]
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         404   9e-131   Jatropha curcas
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   404   9e-131   Citrus sinensis [apfelsine]
ref|XP_002524184.1|  aconitase, putative                                404   1e-130   Ricinus communis
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    404   1e-130   Sesamum indicum [beniseed]
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    402   3e-130   Nicotiana tomentosiformis
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           399   4e-130   Nicotiana tabacum [American tobacco]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        402   4e-130   Eucalyptus grandis [rose gum]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        402   4e-130   Nicotiana tomentosiformis
ref|NP_001136484.1|  uncharacterized protein LOC100216599               389   5e-130   
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        402   6e-130   Nicotiana sylvestris
dbj|BAG16527.1|  putative aconitase                                     401   8e-130   Capsicum chinense [bonnet pepper]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        400   1e-129   Vitis vinifera
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    400   2e-129   Nicotiana sylvestris
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    400   3e-129   Nelumbo nucifera [Indian lotus]
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    399   3e-129   Cicer arietinum [garbanzo]
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    400   4e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    398   8e-129   Solanum tuberosum [potatoes]
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    389   1e-128   
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   393   1e-128   Citrus sinensis [apfelsine]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    398   2e-128   Populus euphratica
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    395   2e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006830449.1|  hypothetical protein AMTR_s00115p00015570          394   2e-128   
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        397   2e-128   Nelumbo nucifera [Indian lotus]
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    397   3e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             397   4e-128   Populus trichocarpa [western balsam poplar]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                   393   6e-128   Citrus sinensis [apfelsine]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        396   6e-128   Vitis vinifera
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    391   7e-128   
gb|EEE68177.1|  hypothetical protein OsJ_26310                          395   7e-128   Oryza sativa Japonica Group [Japonica rice]
gb|ADD62592.1|  cytosolic aconitase                                     380   8e-128   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    393   1e-127   
ref|XP_004974379.1|  PREDICTED: putative aconitate hydratase, cyt...    393   1e-127   
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        395   1e-127   Solanum lycopersicum
gb|KJB60837.1|  hypothetical protein B456_009G327800                    392   2e-127   Gossypium raimondii
gb|AAC26045.1|  aconitase-iron regulated protein 1                      393   2e-127   Citrus limon [lemon]
emb|CBE71057.1|  aconitate hydratase 3                                  392   2e-127   Citrus clementina [clementine]
gb|KJB62848.1|  hypothetical protein B456_009G440000                    392   2e-127   Gossypium raimondii
gb|KJB60836.1|  hypothetical protein B456_009G327800                    391   2e-127   Gossypium raimondii
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    395   2e-127   Phoenix dactylifera
ref|XP_003605929.1|  Aconitate hydratase                                394   2e-127   Medicago truncatula
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g            390   3e-127   Phaseolus vulgaris [French bean]
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    394   4e-127   Elaeis guineensis
gb|KJB30565.1|  hypothetical protein B456_005G149700                    391   5e-127   Gossypium raimondii
gb|EEC83021.1|  hypothetical protein OsI_28098                          384   5e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             394   6e-127   Prunus persica
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             393   1e-126   Citrus clementina [clementine]
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        393   1e-126   Populus euphratica
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        390   1e-126   Glycine soja [wild soybean]
gb|KJB50479.1|  hypothetical protein B456_008G173400                    393   1e-126   Gossypium raimondii
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                393   1e-126   Erythranthe guttata [common monkey flower]
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          392   2e-126   Sorghum bicolor [broomcorn]
gb|KJB30569.1|  hypothetical protein B456_005G149700                    392   2e-126   Gossypium raimondii
gb|KJB60835.1|  hypothetical protein B456_009G327800                    392   2e-126   Gossypium raimondii
gb|KJB30566.1|  hypothetical protein B456_005G149700                    392   3e-126   Gossypium raimondii
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    391   4e-126   
emb|CDP10817.1|  unnamed protein product                                392   4e-126   Coffea canephora [robusta coffee]
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         392   4e-126   Jatropha curcas
gb|KJB62847.1|  hypothetical protein B456_009G440000                    391   4e-126   Gossypium raimondii
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    391   5e-126   Glycine max [soybeans]
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    391   6e-126   
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    390   6e-126   Camelina sativa [gold-of-pleasure]
dbj|BAJ85661.1|  predicted protein                                      390   7e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    390   7e-126   Brachypodium distachyon [annual false brome]
ref|XP_003596988.1|  Aconitate hydratase                                390   7e-126   Medicago truncatula
ref|XP_007045642.1|  Aconitase 3                                        390   1e-125   
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...    388   1e-125   Glycine max [soybeans]
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          390   1e-125   Amborella trichopoda
gb|KHG08189.1|  hypothetical protein F383_11434                         387   1e-125   Gossypium arboreum [tree cotton]
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        388   1e-125   Glycine soja [wild soybean]
ref|XP_006376779.1|  aconitate hydratase family protein                 390   2e-125   Populus trichocarpa [western balsam poplar]
gb|KHG02134.1|  hypothetical protein F383_25649                         389   2e-125   Gossypium arboreum [tree cotton]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    388   5e-125   Gossypium arboreum [tree cotton]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    389   5e-125   Tarenaya hassleriana [spider flower]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    388   7e-125   Glycine max [soybeans]
ref|XP_002532564.1|  aconitase, putative                                387   2e-124   
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    387   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        386   5e-124   Fragaria vesca subsp. vesca
emb|CDP05740.1|  unnamed protein product                                386   5e-124   Coffea canephora [robusta coffee]
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        384   6e-124   Gossypium arboreum [tree cotton]
ref|XP_002870438.1|  predicted protein                                  385   6e-124   Arabidopsis lyrata subsp. lyrata
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        385   7e-124   
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    385   9e-124   Elaeis guineensis
gb|EPS60517.1|  hypothetical protein M569_14286                         382   1e-123   Genlisea aurea
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    384   2e-123   Cicer arietinum [garbanzo]
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             384   4e-123   Eutrema salsugineum [saltwater cress]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         381   6e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    383   6e-123   
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    383   8e-123   Phoenix dactylifera
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    382   8e-123   Arabis alpina [alpine rockcress]
gb|ADM34980.1|  cytosolic aconitase                                     380   1e-122   Pyrus pyrifolia [sha li]
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    382   1e-122   Camelina sativa [gold-of-pleasure]
ref|XP_002530635.1|  aconitase, putative                                380   1e-122   Ricinus communis
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               381   1e-122   
ref|XP_007046597.1|  Aconitase 1                                        380   1e-122   
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     380   2e-122   Cucumis melo [Oriental melon]
gb|KGN48958.1|  Aconitase                                               379   2e-122   Cucumis sativus [cucumbers]
gb|KJB48278.1|  hypothetical protein B456_008G061900                    379   2e-122   Gossypium raimondii
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like              379   2e-122   Cucumis sativus [cucumbers]
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        381   2e-122   Pyrus x bretschneideri [bai li]
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    381   3e-122   Elaeis guineensis
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             381   3e-122   Phaseolus vulgaris [French bean]
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    380   4e-122   Glycine max [soybeans]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        380   5e-122   Glycine soja [wild soybean]
ref|NP_178634.2|  aconitate hydratase 3                                 380   5e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CAN83844.1|  hypothetical protein VITISV_003004                     378   5e-122   Vitis vinifera
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   378   7e-122   Vitis vinifera
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     375   7e-122   Eucalyptus grandis [rose gum]
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    380   9e-122   Camelina sativa [gold-of-pleasure]
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    380   1e-121   Glycine max [soybeans]
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    380   1e-121   Phoenix dactylifera
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...    375   1e-121   Nicotiana sylvestris
emb|CBI24446.3|  unnamed protein product                                378   1e-121   Vitis vinifera
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             379   2e-121   
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   367   2e-121   Citrus sinensis [apfelsine]
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        379   2e-121   Sesamum indicum [beniseed]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             379   2e-121   Capsella rubella
gb|ABK25210.1|  unknown                                                 366   5e-121   Picea sitchensis
emb|CDY18054.1|  BnaC07g04160D                                          378   5e-121   Brassica napus [oilseed rape]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    377   1e-120   Solanum tuberosum [potatoes]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   375   1e-120   Nelumbo nucifera [Indian lotus]
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...    374   1e-120   Nicotiana tomentosiformis
emb|CDX93088.1|  BnaA03g38100D                                          377   1e-120   
emb|CDX97969.1|  BnaA06g07200D                                          377   2e-120   
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   375   2e-120   Populus euphratica
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             375   2e-120   Populus trichocarpa [western balsam poplar]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   375   2e-120   Eucalyptus grandis [rose gum]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     374   2e-120   Eucalyptus grandis [rose gum]
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    376   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    377   2e-120   Brassica rapa
emb|CDY50945.1|  BnaC03g74450D                                          377   2e-120   Brassica napus [oilseed rape]
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         374   2e-120   Jatropha curcas
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   369   2e-120   Citrus sinensis [apfelsine]
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    376   3e-120   Brassica rapa
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              371   3e-120   
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   373   6e-120   Prunus mume [ume]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             373   6e-120   Prunus persica
dbj|BAE98476.1|  aconitase like protein                                 355   7e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    370   1e-119   
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    375   1e-119   Nicotiana sylvestris
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    374   2e-119   Setaria italica
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   372   2e-119   Fragaria vesca subsp. vesca
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   369   3e-119   Citrus sinensis [apfelsine]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   370   5e-119   Tarenaya hassleriana [spider flower]
gb|KDO71346.1|  hypothetical protein CISIN_1g002610mg                   368   5e-119   Citrus sinensis [apfelsine]
ref|XP_010113288.1|  Aconitate hydratase 1                              372   9e-119   
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    374   9e-119   Nicotiana tomentosiformis
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              370   1e-118   Pyrus x bretschneideri [bai li]
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              363   1e-118   
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    372   1e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   369   2e-118   Pyrus x bretschneideri [bai li]
gb|KHN41868.1|  Aconitate hydratase 1                                   369   2e-118   Glycine soja [wild soybean]
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    369   2e-118   Glycine max [soybeans]
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              363   2e-118   
ref|XP_006383042.1|  aconitate hydratase family protein                 369   3e-118   Populus trichocarpa [western balsam poplar]
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              369   3e-118   Pyrus x bretschneideri [bai li]
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   368   3e-118   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   369   3e-118   Citrus sinensis [apfelsine]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             369   3e-118   Citrus clementina [clementine]
ref|XP_006412054.1|  hypothetical protein EUTSA_v10024358mg             365   3e-118   
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   368   3e-118   Citrus sinensis [apfelsine]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   369   3e-118   Citrus sinensis [apfelsine]
emb|CBE71056.1|  aconitate hydratase 1                                  369   4e-118   Citrus clementina [clementine]
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                370   6e-118   Erythranthe guttata [common monkey flower]
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    365   7e-118   Medicago truncatula
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   367   8e-118   Citrus sinensis [apfelsine]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             367   1e-117   Phaseolus vulgaris [French bean]
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        368   1e-117   Gossypium arboreum [tree cotton]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              367   1e-117   Camelina sativa [gold-of-pleasure]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    367   2e-117   Arabis alpina [alpine rockcress]
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        366   3e-117   Glycine soja [wild soybean]
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   366   4e-117   Glycine max [soybeans]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             365   4e-117   Eutrema salsugineum [saltwater cress]
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   365   5e-117   
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              365   6e-117   Cicer arietinum [garbanzo]
gb|EEE58288.1|  hypothetical protein OsJ_09326                          365   6e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   365   1e-116   Camelina sativa [gold-of-pleasure]
ref|XP_003612247.1|  Aconitate hydratase                                364   1e-116   Medicago truncatula
emb|CDY41626.1|  BnaC03g62580D                                          364   1e-116   Brassica napus [oilseed rape]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             364   2e-116   Capsella rubella
emb|CDY24823.1|  BnaA08g14870D                                          365   2e-116   Brassica napus [oilseed rape]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    364   2e-116   
ref|NP_001048898.1|  Os03g0136900                                       366   2e-116   
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              364   2e-116   Camelina sativa [gold-of-pleasure]
gb|EEC74472.1|  hypothetical protein OsI_09921                          366   2e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        366   2e-116   Prunus mume [ume]
ref|NP_001119125.1|  aconitate hydratase 1                              360   4e-116   Arabidopsis thaliana [mouse-ear cress]
emb|CDX75532.1|  BnaA01g01700D                                          362   1e-115   
ref|NP_001159229.1|  uncharacterized protein LOC100304315               356   1e-115   
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              361   2e-115   Brassica rapa
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          363   2e-115   Sorghum bicolor [broomcorn]
emb|CDX69174.1|  BnaC01g02790D                                          361   3e-115   
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    363   4e-115   Brachypodium distachyon [annual false brome]
ref|NP_195308.1|  aconitate hydratase 1                                 360   5e-115   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ92965.1|  predicted protein                                      362   5e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    357   5e-115   Cucumis melo var. conomon [snake cucumber]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   360   6e-115   Brassica rapa
emb|CAA58046.1|  aconitase                                              360   1e-114   Arabidopsis thaliana [mouse-ear cress]
gb|ACR36825.1|  unknown                                                 349   3e-114   Zea mays [maize]
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   355   4e-114   
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             360   5e-114   
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    353   2e-113   Camelina sativa [gold-of-pleasure]
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    348   2e-113   
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          358   2e-113   Sorghum bicolor [broomcorn]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    357   4e-113   Zea mays [maize]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    357   4e-113   Zea mays [maize]
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    357   6e-113   
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    357   7e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    357   8e-113   Camelina sativa [gold-of-pleasure]
emb|CDY66424.1|  BnaAnng22230D                                          356   1e-112   Brassica napus [oilseed rape]
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               365   1e-112   
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             354   1e-112   
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             354   2e-112   
ref|XP_001779205.1|  predicted protein                                  353   2e-112   
gb|AAK91447.1|  AT4g26970/F10M23_310                                    355   2e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14291.1|  BnaA08g14220D                                          355   2e-112   Brassica napus [oilseed rape]
ref|NP_567763.2|  aconitase 2                                           355   2e-112   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    355   2e-112   Arabis alpina [alpine rockcress]
gb|KJB62827.1|  hypothetical protein B456_009G438900                    343   3e-112   Gossypium raimondii
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    353   1e-111   Brassica rapa
emb|CAB36543.1|  putative aconitase                                     352   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              351   1e-111   Tarenaya hassleriana [spider flower]
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             353   2e-111   Eutrema salsugineum [saltwater cress]
ref|XP_010100637.1|  Aconitate hydratase                                351   3e-111   
gb|AAL13084.1|  putative aconitase                                      350   3e-111   Prunus avium [gean]
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    349   8e-111   Zea mays [maize]
gb|EEE65577.1|  hypothetical protein OsJ_21080                          343   9e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             351   9e-111   Capsella rubella
gb|KEH38306.1|  cytoplasmic-like aconitate hydratase                    348   1e-110   Medicago truncatula
ref|NP_001147431.1|  aconitase2                                         348   2e-110   Zea mays [maize]
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             349   2e-110   
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             349   2e-110   
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    349   4e-110   Zea mays [maize]
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   348   4e-110   
dbj|BAD62409.1|  putative aconitate hydratase                           343   5e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001780674.1|  predicted protein                                  346   8e-110   
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              345   2e-109   Eucalyptus grandis [rose gum]
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             347   2e-109   
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     345   4e-109   Eucalyptus grandis [rose gum]
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     342   5e-109   Gossypium arboreum [tree cotton]
gb|KJB17578.1|  hypothetical protein B456_003G006000                    344   6e-109   Gossypium raimondii
ref|XP_007020807.1|  Aconitase 3                                        342   4e-108   
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    339   5e-107   Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                339   8e-107   
gb|ACK56135.1|  putative aconitase                                      321   2e-106   Dimocarpus longan [longan]
ref|NP_001057461.2|  Os06g0303400                                       332   1e-105   
ref|XP_001770969.1|  predicted protein                                  335   3e-105   
emb|CDY56501.1|  BnaAnng14360D                                          333   3e-104   Brassica napus [oilseed rape]
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               325   4e-101   Triticum urartu
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               325   8e-101   
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    305   1e-97    
emb|CAN62964.1|  hypothetical protein VITISV_029521                     301   2e-96    Vitis vinifera
tpg|DAA49009.1|  TPA: hypothetical protein ZEAMMB73_412021              303   3e-96    
gb|ACN31879.1|  unknown                                                 284   1e-93    Zea mays [maize]
gb|AFA36529.1|  aconitate hydratase 2                                   287   2e-93    Lolium perenne [perennial ryegrass]
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   296   3e-91    
ref|XP_001462506.1|  hypothetical protein                               290   3e-91    Paramecium tetraurelia strain d4-2
ref|XP_008666591.1|  PREDICTED: putative aconitate hydratase, cyt...    277   3e-90    
ref|XP_010046442.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    273   7e-90    
ref|XP_007020811.1|  Aconitase 3                                        293   3e-89    
gb|KCW81855.1|  hypothetical protein EUGRSUZ_C03206                     279   8e-89    
gb|ACP19662.1|  aconitase                                               270   4e-88    
gb|AFW61052.1|  hypothetical protein ZEAMMB73_482448                    276   4e-88    
ref|XP_006810593.1|  PREDICTED: cytoplasmic aconitate hydratase-like    277   9e-88    
ref|XP_011411874.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    283   3e-86    
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    284   4e-86    
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  281   4e-86    
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    283   8e-86    
ref|XP_001637006.1|  predicted protein                                  281   1e-85    
emb|CDW88502.1|  aconitate hydratase 1 family protein                   282   2e-85    
ref|XP_006823332.1|  PREDICTED: cytoplasmic aconitate hydratase         278   2e-85    
gb|AFI44047.1|  iron regulatory protein                                 280   7e-85    
gb|KFV01523.1|  Cytoplasmic aconitate hydratase                         273   7e-85    
ref|XP_010081789.1|  PREDICTED: cytoplasmic aconitate hydratase         273   9e-85    
gb|EJY70620.1|  Aconitate hydratase 1 family protein                    280   9e-85    
ref|XP_010122172.1|  PREDICTED: cytoplasmic aconitate hydratase         275   1e-84    
ref|XP_010787893.1|  PREDICTED: cytoplasmic aconitate hydratase         273   2e-84    
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         274   3e-84    
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         274   4e-84    
ref|XP_009306687.1|  putative aconitase                                 278   6e-84    
ref|XP_009495769.1|  cytoplasmic aconitate hydratase                    277   1e-83    
ref|XP_007543966.1|  PREDICTED: cytoplasmic aconitate hydratase i...    277   1e-83    
ref|XP_003727326.1|  PREDICTED: cytoplasmic aconitate hydratase i...    276   2e-83    
ref|XP_008433053.1|  PREDICTED: cytoplasmic aconitate hydratase         276   2e-83    
ref|XP_002111662.1|  hypothetical protein TRIADDRAFT_63287              276   2e-83    
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         272   2e-83    
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         274   3e-83    
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         273   3e-83    
ref|XP_008317436.1|  PREDICTED: cytoplasmic aconitate hydratase         276   3e-83    
ref|XP_004575994.1|  PREDICTED: cytoplasmic aconitate hydratase-like    276   3e-83    
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...    276   3e-83    
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               275   4e-83    
ref|XP_003459702.1|  PREDICTED: cytoplasmic aconitate hydratase         276   4e-83    
ref|XP_005754206.1|  PREDICTED: cytoplasmic aconitate hydratase-like    275   4e-83    
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         275   6e-83    
ref|XP_005234855.1|  PREDICTED: cytoplasmic aconitate hydratase         275   6e-83    
ref|XP_005433002.1|  PREDICTED: cytoplasmic aconitate hydratase         275   7e-83    
ref|XP_791082.2|  PREDICTED: cytoplasmic aconitate hydratase isof...    275   8e-83    
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         270   1e-82    
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         270   1e-82    
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         270   1e-82    
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase         274   1e-82    
ref|XP_010288384.1|  PREDICTED: cytoplasmic aconitate hydratase         270   2e-82    
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         273   2e-82    
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         272   2e-82    
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         273   3e-82    
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         273   3e-82    
gb|KFP65041.1|  Cytoplasmic aconitate hydratase                         272   4e-82    
ref|XP_009698540.1|  PREDICTED: cytoplasmic aconitate hydratase         272   4e-82    
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         273   4e-82    
gb|EAR86332.2|  cytoplasmic-like aconitate hydratase                    273   4e-82    
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         273   4e-82    
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         273   5e-82    
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase         273   5e-82    
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase         272   6e-82    
ref|XP_009573519.1|  PREDICTED: cytoplasmic aconitate hydratase         272   6e-82    
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         272   7e-82    
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         272   7e-82    
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         272   7e-82    
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...    272   7e-82    
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase         272   7e-82    
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         272   8e-82    
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         272   1e-81    
ref|XP_005172430.1|  PREDICTED: cytoplasmic aconitate hydratase i...    272   1e-81    
ref|XP_977148.1|  aconitate hydratase 1 family protein                  273   1e-81    
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         271   1e-81    
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase         271   1e-81    
ref|NP_001030155.1|  cytoplasmic aconitate hydratase                    271   1e-81    
ref|XP_002194651.1|  PREDICTED: cytoplasmic aconitate hydratase         271   1e-81    
ref|XP_009283305.1|  PREDICTED: cytoplasmic aconitate hydratase         271   1e-81    
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         271   1e-81    
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase         271   1e-81    
gb|KFW89360.1|  Cytoplasmic aconitate hydratase                         271   1e-81    
ref|XP_009499933.1|  PREDICTED: cytoplasmic aconitate hydratase         271   2e-81    
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         271   2e-81    
ref|XP_009942226.1|  PREDICTED: cytoplasmic aconitate hydratase         271   2e-81    
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    271   2e-81    
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         271   2e-81    
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    271   2e-81    
gb|EFA77648.1|  putative iron regulatory protein                        271   2e-81    
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    271   3e-81    
ref|XP_009044065.1|  hypothetical protein LOTGIDRAFT_181349             270   3e-81    
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         270   3e-81    
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    270   3e-81    
ref|XP_001451848.1|  hypothetical protein                               270   3e-81    
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    270   3e-81    
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    270   4e-81    
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase         270   4e-81    
ref|XP_010307150.1|  PREDICTED: cytoplasmic aconitate hydratase         270   4e-81    
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    270   6e-81    
ref|XP_010197370.1|  PREDICTED: cytoplasmic aconitate hydratase         270   6e-81    
ref|XP_006014028.1|  PREDICTED: cytoplasmic aconitate hydratase-like    263   7e-81    
emb|CAB41634.1|  iron regulatory protein 1-like protein                 269   8e-81    
ref|XP_010169631.1|  PREDICTED: cytoplasmic aconitate hydratase         269   8e-81    
ref|XP_009872328.1|  PREDICTED: cytoplasmic aconitate hydratase         269   8e-81    
gb|KFP02434.1|  Cytoplasmic aconitate hydratase                         269   8e-81    
ref|XP_008494051.1|  PREDICTED: cytoplasmic aconitate hydratase         269   9e-81    
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase         269   9e-81    
ref|XP_008303429.1|  PREDICTED: cytoplasmic aconitate hydratase         269   1e-80    
ref|XP_009030486.1|  hypothetical protein HELRODRAFT_189761             269   1e-80    
ref|XP_641837.1|  hypothetical protein DDB_G0279159                     269   1e-80    
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    268   1e-80    
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    268   2e-80    
emb|CAF93695.1|  unnamed protein product                                268   2e-80    
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase         268   2e-80    
gb|EFZ14973.1|  hypothetical protein SINV_01110                         268   2e-80    
gb|AGC69746.1|  putative iron regulatory protein                        268   2e-80    
ref|NP_509898.1|  Protein ACO-1                                         268   3e-80    
ref|NP_001135643.1|  cytoplasmic aconitate hydratase                    268   3e-80    
ref|XP_001365420.1|  PREDICTED: cytoplasmic aconitate hydratase         268   3e-80    
emb|CDW89012.1|  aconitate hydratase 1 family protein                   267   5e-80    
ref|XP_007440358.1|  PREDICTED: cytoplasmic aconitate hydratase-like    265   5e-80    
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         266   8e-80    
ref|XP_008166967.1|  PREDICTED: cytoplasmic aconitate hydratase         266   1e-79    
ref|XP_010177495.1|  PREDICTED: cytoplasmic aconitate hydratase         266   1e-79    
ref|XP_003966778.1|  PREDICTED: cytoplasmic aconitate hydratase-like    266   1e-79    
ref|XP_007255248.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    266   1e-79    
gb|EJY64435.1|  Aconitate hydratase 1 family protein                    266   2e-79    
ref|XP_011312352.1|  PREDICTED: cytoplasmic aconitate hydratase-like    265   2e-79    
ref|XP_005184263.1|  PREDICTED: cytoplasmic aconitate hydratase         265   2e-79    
emb|CDI83859.1|  aconitate hydratase, putative                          266   3e-79    
emb|CCW61236.1|  unnamed protein product                                265   3e-79    
gb|ACJ70654.1|  cytoplasmic aconitase/iron-regulatory protein           265   4e-79    
gb|AAF29446.1|AF127456_1  aconitase                                     263   5e-79    
ref|XP_007904798.1|  PREDICTED: cytoplasmic aconitate hydratase         265   5e-79    
gb|EGT30572.1|  CBN-ACO-1 protein                                       264   5e-79    
ref|XP_007065257.1|  PREDICTED: cytoplasmic aconitate hydratase         264   5e-79    
gb|EMP30789.1|  Cytoplasmic aconitate hydratase                         264   5e-79    
ref|XP_003747109.1|  PREDICTED: cytoplasmic aconitate hydratase         264   6e-79    
ref|XP_004712473.1|  PREDICTED: cytoplasmic aconitate hydratase         264   6e-79    
ref|XP_004031131.1|  hypothetical protein IMG5_146680                   264   7e-79    
ref|XP_821896.1|  aconitase                                             264   8e-79    
emb|CBH16617.1|  aconitase, putative                                    264   9e-79    
ref|XP_827883.1|  aconitase                                             264   9e-79    
ref|XP_003109738.1|  CRE-ACO-1 protein                                  264   9e-79    
ref|XP_002071941.1|  GK22582                                            264   1e-78    
gb|EKF31280.1|  aconitase, putative                                     264   1e-78    
ref|XP_011192810.1|  PREDICTED: cytoplasmic aconitate hydratase-like    264   1e-78    
gb|EKG02789.1|  aconitase, putative                                     263   1e-78    
emb|CBY22746.1|  unnamed protein product                                264   1e-78    
gb|AAR15297.1|  iron regulatory protein                                 263   1e-78    
ref|XP_001659032.1|  AAEL008216-PA                                      263   1e-78    
emb|CCW69174.1|  unnamed protein product                                263   2e-78    
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              263   2e-78    
emb|CDQ69390.1|  unnamed protein product                                263   2e-78    
ref|XP_001843386.1|  iron-responsive element-binding protein 1          263   2e-78    
ref|XP_002429734.1|  aconitase, putative                                263   2e-78    
gb|AAH05454.1|  Aconitase 1                                             263   2e-78    
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         261   2e-78    
ref|NP_001133702.1|  Iron-responsive element-binding protein 1          263   2e-78    
ref|XP_011198599.1|  PREDICTED: cytoplasmic aconitate hydratase-like    263   2e-78    
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         261   2e-78    
ref|XP_001682457.1|  putative aconitase                                 263   2e-78    
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         263   2e-78    
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   2e-78    
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         263   2e-78    
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase         262   3e-78    
ref|XP_006025029.1|  PREDICTED: cytoplasmic aconitate hydratase         262   3e-78    
gb|ESS68845.1|  aconitase                                               263   3e-78    
gb|KFB40343.1|  AGAP007258-PA-like protein                              263   3e-78    
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    259   3e-78    
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         262   3e-78    
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         262   3e-78    
gb|EDL98627.1|  rCG55067                                                262   3e-78    
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         262   4e-78    
ref|XP_004530707.1|  PREDICTED: cytoplasmic aconitate hydratase-like    262   4e-78    
ref|NP_001080577.1|  aconitase 1, soluble                               262   4e-78    
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       262   5e-78    
ref|XP_008882045.1|  aconitate hydratase ACN/IRP                        263   5e-78    
gb|EFN64547.1|  Cytoplasmic aconitate hydratase                         264   5e-78    
ref|XP_002643981.1|  C. briggsae CBR-ACO-1 protein                      261   6e-78    
ref|XP_008200453.1|  PREDICTED: cytoplasmic aconitate hydratase-like    261   6e-78    
gb|KFG42597.1|  aconitate hydratase ACN/IRP                             263   6e-78    
gb|ESS32610.1|  aconitate hydratase ACN/IRP                             263   7e-78    
ref|XP_006629784.1|  PREDICTED: cytoplasmic aconitate hydratase-like    261   7e-78    
ref|XP_002069487.1|  GK11552                                            263   7e-78    
gb|KFG60936.1|  aconitate hydratase ACN/IRP                             263   7e-78    
emb|CAD20353.1|  cytoplasmic aconitase                                  261   7e-78    
gb|KFH13093.1|  aconitate hydratase ACN/IRP                             263   7e-78    
ref|XP_007614514.1|  PREDICTED: cytoplasmic aconitate hydratase         261   7e-78    
gb|EPR62226.1|  aconitate hydratase ACN/IRP                             263   7e-78    
ref|XP_002366326.1|  aconitate hydratase, putative                      263   8e-78    
emb|CAP35039.2|  Protein CBR-ACO-1                                      261   8e-78    
ref|XP_004362727.1|  putative iron regulatory protein                   261   8e-78    
gb|KDR18766.1|  Cytoplasmic aconitate hydratase                         261   8e-78    
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein            261   9e-78    
dbj|BAN16539.1|  ADB0003847                                             261   9e-78    
ref|XP_003761451.1|  PREDICTED: cytoplasmic aconitate hydratase         261   9e-78    
emb|CAA43455.1|  iron response element binding protein                  261   1e-77    
ref|XP_003506017.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    261   1e-77    
emb|CEF64620.1|  Cytoplasmic aconitate hydratase                        261   1e-77    
ref|XP_011261917.1|  PREDICTED: cytoplasmic aconitate hydratase-like    263   1e-77    
gb|EPY75099.1|  cytoplasmic aconitate hydratase                         259   1e-77    
ref|XP_004600431.1|  PREDICTED: cytoplasmic aconitate hydratase         260   1e-77    
gb|EGI63266.1|  Cytoplasmic aconitate hydratase                         260   1e-77    
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_003470870.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_004658446.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_004677765.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   2e-77    
ref|XP_004482427.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_011058028.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    260   2e-77    
ref|XP_001464867.1|  putative aconitase                                 260   2e-77    
ref|XP_001952939.1|  GF17523                                            260   2e-77    
ref|XP_005078925.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   2e-77    
ref|XP_006123150.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   2e-77    
ref|WP_024299351.1|  aconitate hydratase                                260   2e-77    
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         260   2e-77    
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    260   2e-77    
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    260   2e-77    
ref|XP_008545838.1|  PREDICTED: cytoplasmic aconitate hydratase-like    260   2e-77    
gb|KFM82338.1|  hypothetical protein X975_14216                         261   3e-77    
ref|XP_001509375.1|  PREDICTED: cytoplasmic aconitate hydratase         259   3e-77    
ref|XP_004329499.1|  PREDICTED: cytoplasmic aconitate hydratase-like    259   3e-77    
ref|XP_005326228.1|  PREDICTED: cytoplasmic aconitate hydratase         260   3e-77    
ref|XP_308544.4|  AGAP007258-PA                                         260   3e-77    
ref|XP_003699654.1|  PREDICTED: cytoplasmic aconitate hydratase         259   3e-77    



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   402 bits (1032),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+ LDNKVGFKGFAVPKE Q
Sbjct  72   QQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHALLDNKVGFKGFAVPKEVQ  131

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT
Sbjct  132  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  191

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  192  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAA  251

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  252  AVLSGNRNFEGRVHALTRANYLASPP  277



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   409 bits (1050),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/206 (94%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQE+VYSS LQLDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA+PKEAQ
Sbjct  354  QQEKVYSSYLQLDLTDVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAIPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  414  ENVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESVS+AISDNDIVAA
Sbjct  474  SLAPGSGVVTKYLLKSGLQPYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISDNDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KCW88792.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=708

 Score =   403 bits (1035),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q
Sbjct  251  QQERVYSSYLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  311  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+NDI+AA
Sbjct  371  SLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISENDIIAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/206 (94%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS LQLDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA+PKEAQ
Sbjct  445  QQERVYSSYLQLDLADVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAIPKEAQ  504

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAK+A ELGL VKPWVKT
Sbjct  505  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKRACELGLQVKPWVKT  564

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESVS+AIS+NDIVAA
Sbjct  565  SLAPGSGVVTKYLLKSGLQPYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAA  624

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  625  AVLSGNRNFEGRVHPLTRANYLASPP  650



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 194/206 (94%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS LQLDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA+PKEAQ
Sbjct  445  QQERVYSSYLQLDLADVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAIPKEAQ  504

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  505  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWVKT  564

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ YLNQQGF+IVGYGCTTCIGNSGDLDESVS+AISDNDIVAA
Sbjct  565  SLAPGSGVVTKYLLKSGLQPYLNQQGFNIVGYGCTTCIGNSGDLDESVSAAISDNDIVAA  624

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  625  AVLSGNRNFEGRVHPLTRANYLASPP  650



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   403 bits (1036),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  251  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  311  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAA
Sbjct  371  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   403 bits (1035),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q
Sbjct  251  QQERVYSSYLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  311  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+NDI+AA
Sbjct  371  SLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISENDIIAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score =   405 bits (1041),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  456  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  515

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  516  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  575

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+DNDIVAA
Sbjct  576  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAA  635

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  636  AVLSGNRNFEGRVHPLTRANYLASPP  661



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   405 bits (1040),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKEAQ
Sbjct  339  QQERVYSSYLELNLAEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKEAQ  398

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  399  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  458

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSG+LDESV+SAIS+ND+VAA
Sbjct  459  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGELDESVASAISENDVVAA  518

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  519  AVLSGNRNFEGRVHPLTRANYLASPP  544



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   405 bits (1040),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/206 (94%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  354  QQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT
Sbjct  414  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  474  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHALTRANYLASPP  559



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   404 bits (1039),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  354  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  414  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+DNDIVAA
Sbjct  474  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   406 bits (1044),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 193/206 (94%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS LQLDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA+PKEAQ
Sbjct  445  QQERVYSSYLQLDLADVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAIPKEAQ  504

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  505  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWVKT  564

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ YLNQQGF+IVGYGCTTCIGNSGDLDESVS+AIS+NDIVAA
Sbjct  565  SLAPGSGVVTKYLLKSGLQPYLNQQGFNIVGYGCTTCIGNSGDLDESVSAAISENDIVAA  624

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  625  AVLSGNRNFEGRVHPLTRANYLASPP  650



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score =   404 bits (1037),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  452  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  512  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAA
Sbjct  572  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHPLTRANYLASPP  657



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score =   404 bits (1038),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  452  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  512  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAA
Sbjct  572  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHPLTRANYLASPP  657



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   404 bits (1037),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  354  QQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVA+FSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT
Sbjct  414  DKVAEFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  474  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHALTRANYLASPP  559



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score =   404 bits (1037),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  452  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  512  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAA
Sbjct  572  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHPLTRANYLASPP  657



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   405 bits (1040),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/206 (94%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  451  QQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT
Sbjct  511  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  571  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHALTRANYLASPP  656



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   405 bits (1040),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/206 (94%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQE+VYSS L LDL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  453  QQEKVYSSYLNLDLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQ  512

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT
Sbjct  513  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  572

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  573  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAA  632

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  633  AVLSGNRNFEGRVHALTRANYLASPP  658



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   405 bits (1040),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  456  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  515

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  516  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  575

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+DNDIVAA
Sbjct  576  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAA  635

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  636  AVLSGNRNFEGRVHPLTRANYLASPP  661



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   404 bits (1037),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+ERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPK++Q
Sbjct  447  QKERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKDSQ  506

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPWVKT
Sbjct  507  EKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACQLGLQVKPWVKT  566

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESV++AISDNDIVAA
Sbjct  567  SLAPGSGVVTKYLLKSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVAAAISDNDIVAA  626

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  627  AVLSGNRNFEGRVHPLTRANYLASPP  652



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   404 bits (1037),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  452  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  512  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAA
Sbjct  572  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHPLTRANYLASPP  657



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   404 bits (1037),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS LQL+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCL+NKVGFKGFAVP E+Q
Sbjct  454  QQERVYSSYLQLNLADVEPCISGPKRPHDRVPLKEMKADWHSCLNNKVGFKGFAVPNESQ  513

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  514  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  573

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSG+LDE+V+SAISDNDI+AA
Sbjct  574  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGELDETVASAISDNDIIAA  633

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  634  AVLSGNRNFEGRVHPLTRANYLASPP  659



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   404 bits (1037),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  452  QQERVYSSYLELNLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  512  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAA
Sbjct  572  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHPLTRANYLASPP  657



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   404 bits (1037),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS LQLDL +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PKE Q
Sbjct  452  QQERVYSSYLQLDLGEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKEVQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  512  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  572  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHALTRANYLASPP  657



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   404 bits (1037),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+LDL DVEPC+SGPKRPHDRVPLK+MK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  467  QQDRVYSSYLELDLADVEPCISGPKRPHDRVPLKDMKADWHSCLDNKVGFKGFAVPKEQQ  526

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  527  EKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  586

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAI+DND+VAA
Sbjct  587  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAIADNDLVAA  646

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  647  AVLSGNRNFEGRVHPLTRANYLASPP  672



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   402 bits (1033),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYS+SL LDL DVEPC+SGPKRPHDRVPLKEMK DWHSCLDNKVGFKGFAVPK+AQ
Sbjct  441  QHEKVYSASLHLDLADVEPCVSGPKRPHDRVPLKEMKPDWHSCLDNKVGFKGFAVPKDAQ  500

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+KPWVKT
Sbjct  501  EKVVKFSFHGQDAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHIKPWVKT  560

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  561  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIVAA  620

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  621  AVLSGNRNFEGRVHPLTRANYLASPP  646



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   399 bits (1026),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS L LDL  VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK+AQ
Sbjct  354  QHEKVYSSCLHLDLAGVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKDAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+KPWVKT
Sbjct  414  EKVVKFSFHGQDAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHIKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  474  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   402 bits (1033),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q
Sbjct  452  QQERVYSSYLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  512  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+NDI+AA
Sbjct  572  SLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISENDIIAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHPLTRANYLASPP  657



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   402 bits (1033),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQE+VYSS L LDLV+VEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  453  QQEKVYSSYLDLDLVNVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQ  512

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT
Sbjct  513  DKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  572

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  573  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAA  632

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  633  AVLSGNRNFEGRVHALTRANYLASPP  658



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   389 bits (1000),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    ERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEK  187
            ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+K
Sbjct  21   ERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDK  80

Query  188  VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSL  367
            V KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSL
Sbjct  81   VVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSL  140

Query  368  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAV  547
            APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAV
Sbjct  141  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITENDVVAAAV  200

Query  548  LSGNRNFEGRVHPLTRANYLASPP  619
            LSGNRNFEGRVHPLTRANYLASPP
Sbjct  201  LSGNRNFEGRVHPLTRANYLASPP  224



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   402 bits (1032),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQE+VYSS L LDLV+VEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  452  QQEKVYSSYLDLDLVNVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT
Sbjct  512  DKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  572  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHALTRANYLASPP  657



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   401 bits (1031),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS L LDL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  451  QTEKVYSSYLNLDLADVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT
Sbjct  511  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  571  SLAPGSGVVTKYLLRSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHALTRANYLASPP  656



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   400 bits (1029),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER YSS L+LDLV+VEPC+SGPKRPHDRV LKEMK DWHSCLDNKVGFKGFAVPKEAQ
Sbjct  443  QQERAYSSYLELDLVNVEPCVSGPKRPHDRVTLKEMKVDWHSCLDNKVGFKGFAVPKEAQ  502

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  503  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  562

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSG++DESV+SAI++NDIVAA
Sbjct  563  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGEIDESVASAITENDIVAA  622

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  623  AVLSGNRNFEGRVHPLTRANYLASPP  648



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS L LDL  VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK+AQ
Sbjct  445  QHEKVYSSCLHLDLAGVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKDAQ  504

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+KPWVKT
Sbjct  505  EKVVKFSFHGQDAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHIKPWVKT  564

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  565  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIVAA  624

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  625  AVLSGNRNFEGRVHPLTRANYLASPP  650



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   400 bits (1027),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DW SCLDNKVGFKGF+VPKE+Q
Sbjct  453  QQERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKADWRSCLDNKVGFKGFSVPKESQ  512

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  513  NKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKT  572

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  573  SLAPGSGVVTKYLFQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAA  632

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  633  AVLSGNRNFEGRVHPLTRANYLASPP  658



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   399 bits (1026),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ
Sbjct  435  QQDRVYSSYLELNLSEVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQ  494

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL +KPWVKT
Sbjct  495  EKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLRIKPWVKT  554

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSGDLDESV+SAIS+NDIVAA
Sbjct  555  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGDLDESVASAISENDIVAA  614

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  615  AVLSGNRNFEGRVHPLTRANYLASPP  640



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   400 bits (1027),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK DWHSCL++KVGFKGFA+PKE Q
Sbjct  471  QQERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKDDWHSCLNSKVGFKGFAIPKEEQ  530

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKT
Sbjct  531  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLEVKPWVKT  590

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YL+QQGF+IVGYGCTTCIGNSGDLDESVS+AI++NDIVAA
Sbjct  591  SLAPGSGVVTKYLLKSGLQKYLDQQGFNIVGYGCTTCIGNSGDLDESVSAAITENDIVAA  650

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  651  AVLSGNRNFEGRVHPLTRANYLASPP  676



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   398 bits (1023),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS L LDL +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK+AQ
Sbjct  437  QHEKVYSSCLYLDLAEVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKDAQ  496

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL+VKPWVKT
Sbjct  497  EKVVKFSFHGQDAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLNVKPWVKT  556

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESVSSAIS+NDIVAA
Sbjct  557  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVSSAISENDIVAA  616

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  617  AVLSGNRNFEGRVHPLTRANYLASPP  642



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   389 bits (999),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+LDL  VEPC+SGPKRPHDRVPLKEMK+DWHSCLDN VGFKGFA+PKEAQ
Sbjct  114  QQERVYSSYLELDLSGVEPCISGPKRPHDRVPLKEMKADWHSCLDNTVGFKGFAIPKEAQ  173

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  174  DKVAKFSFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWIKT  233

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQEYLN+QGFHIVGYGCTTCIGNSG+++ESV +AIS+NDIVAA
Sbjct  234  SLAPGSGVVTKYLAKSGLQEYLNEQGFHIVGYGCTTCIGNSGEINESVGAAISENDIVAA  293

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  294  AVLSGNRNFEGRVHPLTRANYLASPP  319



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   393 bits (1009),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            +QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q
Sbjct  251  EQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  311  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAA
Sbjct  371  SLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   398 bits (1022),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS LQLDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CL+NKVGFKGFAVPKEAQ
Sbjct  451  QPERVYSSYLQLDLADVEPCISGPKRPHDRVPLKEMKADWHACLNNKVGFKGFAVPKEAQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  511  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWIKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV S IS+NDI+AA
Sbjct  571  SLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVGSVISENDILAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPLTRANYLASPP  656



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   395 bits (1015),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDN+VGFKGFAVPKE Q
Sbjct  354  QTERVYSSYLELDLNEVEPCISGPKRPHDRVLLKEMKSDWHSCLDNRVGFKGFAVPKEQQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  414  DKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFH+VGYGCTTCIGNSGDLDESVS+AIS+ND+VAA
Sbjct  474  SLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISENDVVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_006830449.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
 gb|ERM97865.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
Length=854

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS LQLDL DVE CLSGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q
Sbjct  332  QTERVYSSYLQLDLADVETCLSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQ  391

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KFSFHG+PAE+KHGSVVIAAITSCTNTSNPSVMLGAAL AKKA ELGL VKPW+KT
Sbjct  392  DKVVKFSFHGKPAEIKHGSVVIAAITSCTNTSNPSVMLGAALSAKKACELGLEVKPWIKT  451

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YL+QQGFHIVGYGCTTCIGNSG+LDESV+SAI+DND+VA+
Sbjct  452  SLAPGSGVVTKYLLQSGLQKYLDQQGFHIVGYGCTTCIGNSGELDESVASAIADNDLVAS  511

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  512  AVLSGNRNFEGRVHPLTRANYLASPP  537



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 201/206 (98%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAVPK++Q
Sbjct  448  QQERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKADWHACLDNQVGFKGFAVPKDSQ  507

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  508  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKT  567

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGL++YL+QQGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  568  SLAPGSGVVTKYLLQSGLKKYLDQQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAA  627

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  628  AVLSGNRNFEGRVHPLTRANYLASPP  653



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   397 bits (1020),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+ERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFAVPKE+Q
Sbjct  457  QKERVYSSYLELDLADVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAVPKESQ  516

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EK+ KF FHGQPAELKHGS+VIAAITSCTNTSNP+VMLGA LVAKKA ELGL VKPW+KT
Sbjct  517  EKIVKFDFHGQPAELKHGSLVIAAITSCTNTSNPNVMLGAGLVAKKACELGLQVKPWIKT  576

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSGDLDESV++AISDNDIVAA
Sbjct  577  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGDLDESVAAAISDNDIVAA  636

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  637  AVLSGNRNFEGRVHPLTRANYLASPP  662



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   397 bits (1019),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS LQLDL DVEPC+SGPKRPHDRVPL+EMK+DWHSCL NKVGFKGFAVPKEAQ
Sbjct  455  QAERVYSSYLQLDLADVEPCVSGPKRPHDRVPLREMKADWHSCLSNKVGFKGFAVPKEAQ  514

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  515  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLKVKPWIKT  574

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+Y N+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDI+AA
Sbjct  575  SLAPGSGVVTKYLQKSGLQKYFNEQGFHIVGYGCTTCIGNSGDLDESVASAISENDILAA  634

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  635  AVLSGNRNFEGRVHPLTRANYLASPP  660



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score =   393 bits (1010),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            +QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q
Sbjct  458  EQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQ  517

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  518  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  577

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAA
Sbjct  578  SLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAA  637

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  638  AVLSGNRNFEGRVHPLTRANYLASPP  663



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   396 bits (1018),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER YSS LQL+L DVEPC+SGPKRPHDRVPLKEMK+DW +CLDNKVGFKGFAVPKEAQ
Sbjct  465  QVERFYSSYLQLNLEDVEPCMSGPKRPHDRVPLKEMKTDWKACLDNKVGFKGFAVPKEAQ  524

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKASELGL VKPW+KT
Sbjct  525  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASELGLEVKPWIKT  584

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDI+AA
Sbjct  585  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIIAA  644

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  645  AVLSGNRNFEGRVHALTRANYLASPP  670



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   391 bits (1004),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    ERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEK  187
            ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+K
Sbjct  253  ERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDK  312

Query  188  VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSL  367
            V KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSL
Sbjct  313  VVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSL  372

Query  368  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAV  547
            APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAV
Sbjct  373  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITENDVVAAAV  432

Query  548  LSGNRNFEGRVHPLTRANYLASPP  619
            LSGNRNFEGRVHPLTRANYLASPP
Sbjct  433  LSGNRNFEGRVHPLTRANYLASPP  456



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   395 bits (1015),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDN+VGFKGFAVPKE Q
Sbjct  412  QTERVYSSYLELDLNEVEPCISGPKRPHDRVLLKEMKSDWHSCLDNRVGFKGFAVPKEQQ  471

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  472  DKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKT  531

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFH+VGYGCTTCIGNSGDLDESVS+AIS+ND+VAA
Sbjct  532  SLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISENDVVAA  591

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  592  AVLSGNRNFEGRVHPLTRANYLASPP  617



>gb|ADD62592.1| cytosolic aconitase [Triticum aestivum]
Length=456

 Score =   380 bits (976),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L LDL +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  44   QLERVYSSYLALDLDEVEPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAVPKEQQ  103

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KF F+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  104  DKVVKFDFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKT  163

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGCTTCIGNSG+L ESVS+AI++ND+VAA
Sbjct  164  SLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGCTTCIGNSGELHESVSAAITENDVVAA  223

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  224  AVLSGNRNFEGRVHPLTRANYLASPP  249



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   393 bits (1010),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+LDL DVEPC+SGPKRPHDRVPL++MK+DWHS LD+KVGFKGFAVPKE Q
Sbjct  354  QQERVYSSYLELDLGDVEPCVSGPKRPHDRVPLRDMKADWHSSLDSKVGFKGFAVPKEEQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  414  DKVVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDL+ESV+SAI+DND++AA
Sbjct  474  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLEESVASAIADNDLIAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_004974379.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=892

 Score =   393 bits (1009),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER+YSS L+LDL +VEP +SGPKRPHDRVPLK+MKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  439  QPERIYSSYLELDLDEVEPSISGPKRPHDRVPLKDMKSDWHACLDNKVGFKGFAVPKEQQ  498

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  499  GKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  558

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AIS+ND+VAA
Sbjct  559  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISENDVVAA  618

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  619  AVLSGNRNFEGRVHPLTRANYLASPP  644



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   395 bits (1015),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS L LDL +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK+AQ
Sbjct  437  QHEKVYSSCLYLDLAEVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKDAQ  496

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSFHGQ AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL+VKPWVKT
Sbjct  497  EKVVKFSFHGQHAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLNVKPWVKT  556

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESVSSAIS+NDIVAA
Sbjct  557  SLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVSSAISENDIVAA  616

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  617  AVLSGNRNFEGRVHPLTRANYLASPP  642



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFAVPKEAQ
Sbjct  446  QQERVYSSYLELNLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFAVPKEAQ  505

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  506  DKVAKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  565

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDIVA+
Sbjct  566  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIVAS  625

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  626  AVLSGNRNFEGRVHALTRANYLASPP  651



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   393 bits (1009),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            +QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q
Sbjct  354  EQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  414  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            +QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q
Sbjct  354  EQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  414  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score =   392 bits (1006),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER YSS LQLDL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  449  QQERAYSSYLQLDLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAVPKEEQ  508

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF+FHG PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  509  NKVAKFTFHGLPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKT  568

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  569  SLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISENDIIAA  628

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  629  AVLSGNRNFEGRVHPLTRANYLASPP  654



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score =   391 bits (1005),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFAVPKEAQ
Sbjct  446  QQERVYSSYLELNLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFAVPKEAQ  505

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  506  DKVAKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  565

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDIVA+
Sbjct  566  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIVAS  625

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  626  AVLSGNRNFEGRVHALTRANYLASPP  651



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   395 bits (1015),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPK++Q
Sbjct  464  QVERVYSSYLELDLTDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKDSQ  523

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA E+GL VKPW+KT
Sbjct  524  DKVVKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACEVGLEVKPWIKT  583

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESV++A+S+NDIVAA
Sbjct  584  SLAPGSGVVTKYLLKSGLQNYLNQQGFHIVGYGCTTCIGNSGDLDESVAAAVSENDIVAA  643

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  644  AVLSGNRNFEGRVHPLTRANYLASPP  669



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   394 bits (1013),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ
Sbjct  435  QQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQ  494

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF F+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  495  GKVAKFDFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKT  554

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSGDL+ESV+SAIS+NDIVAA
Sbjct  555  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGDLNESVASAISENDIVAA  614

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  615  AVLSGNRNFEGRVHPLTRANYLASPP  640



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score =   390 bits (1003),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK DWH+CLDN VGFKGFA+PKEAQ
Sbjct  438  QQERVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKDDWHACLDNNVGFKGFAIPKEAQ  497

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF+FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  498  GKVAKFNFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKT  557

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESVSSAIS+NDIVAA
Sbjct  558  SLAPGSGVVTKYLHQSGLQKYLNEQGFHIVGFGCTTCIGNSGELNESVSSAISENDIVAA  617

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  618  AVLSGNRNFEGRVHPLTRANYLASPP  643



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   394 bits (1013),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPK++Q
Sbjct  463  QVERVYSSYLELDLTDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKDSQ  522

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  523  DKVVKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKT  582

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGL+ YLNQQGFH+VGYGCTTCIGNSGDLDESV++AIS+NDIVAA
Sbjct  583  SLAPGSGVVTKYLLKSGLENYLNQQGFHLVGYGCTTCIGNSGDLDESVAAAISENDIVAA  642

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  643  AVLSGNRNFEGRVHPLTRANYLASPP  668



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   391 bits (1005),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEAQ
Sbjct  354  QQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSFHG+PAELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  414  EKVAKFSFHGKPAELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  474  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHALTRANYLASPP  559



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   384 bits (985),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 194/206 (94%), Gaps = 4/206 (2%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDN+    GFAVPKE Q
Sbjct  81   QTERVYSSYLELDLNEVEPCISGPKRPHDRVPLKEMKSDWHSCLDNR----GFAVPKEQQ  136

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  137  DKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKT  196

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFH+VGYGCTTCIGNSGDLDESVS+AIS+ND+VAA
Sbjct  197  SLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISENDVVAA  256

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  257  AVLSGNRNFEGRVHPLTRANYLASPP  282



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   394 bits (1011),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRVPLK+MK DWH+CLDNKVGFKGFA+PKE Q
Sbjct  452  QSERVYSSYLELNLSEVEPCMSGPKRPHDRVPLKDMKVDWHACLDNKVGFKGFAIPKEVQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKT
Sbjct  512  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+Y +QQGFHIVGYGCTTCIGNSGDLDE+V+SAI++NDIVAA
Sbjct  572  SLAPGSGVVTKYLLKSGLQKYFDQQGFHIVGYGCTTCIGNSGDLDETVASAIAENDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHPLTRANYLASPP  657



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            +QER YSS LQLDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q
Sbjct  458  EQERSYSSYLQLDLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQ  517

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  518  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  577

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAA
Sbjct  578  SLAPGSGVVTKYLQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAA  637

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  638  AVLSGNRNFEGRVHPLTRANYLASPP  663



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS LQLDL DVEPC+SGPKRPHDRVPL+EMK+DWHSCL NKVGFKGFAVPKEAQ
Sbjct  457  QAERVYSSYLQLDLADVEPCVSGPKRPHDRVPLREMKADWHSCLSNKVGFKGFAVPKEAQ  516

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHG PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  517  DKVAKFSFHGLPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLKVKPWIKT  576

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+Y N+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDI+AA
Sbjct  577  SLAPGSGVVTKYLQKSGLQKYFNEQGFHIVGYGCTTCIGNSGDLDESVASAISENDILAA  636

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  637  AVLSGNRNFEGRVHPLTRANYLASPP  662



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   390 bits (1003),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ
Sbjct  359  QQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQ  418

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  419  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKVKPWVKT  478

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+LDESV+SAIS+ND+VAA
Sbjct  479  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELDESVASAISENDVVAA  538

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  539  AVLSGNRNFEGRVHALTRANYLASPP  564



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   393 bits (1009),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L +VEPC+SGPKRPHDRVPL+EMK+DW+SCL+NKVGFKGFAVPKEAQ
Sbjct  452  QQKRVYSSYLELNLAEVEPCISGPKRPHDRVPLREMKADWNSCLNNKVGFKGFAVPKEAQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  512  GKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDI+AA
Sbjct  572  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGDLDESVASAISENDIIAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHALTRANYLASPP  657



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+E+VYSS L L+L DVEPC+SGPKRPHDRVPLK+MK DWHSCLDNK+GFKGFA+PKE Q
Sbjct  466  QEEKVYSSYLDLELSDVEPCISGPKRPHDRVPLKDMKDDWHSCLDNKIGFKGFAIPKEKQ  525

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  526  EKVVKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  585

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAI+DND+VAA
Sbjct  586  SLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAIADNDLVAA  645

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  646  AVLSGNRNFEGRVHPLTRANYLASPP  671



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   392 bits (1008),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    ERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEK  187
            ER+YSS L+LDL +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+K
Sbjct  452  ERIYSSYLELDLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDK  511

Query  188  VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSL  367
            V KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSL
Sbjct  512  VVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSL  571

Query  368  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAV  547
            APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAV
Sbjct  572  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAITENDVVAAAV  631

Query  548  LSGNRNFEGRVHPLTRANYLASPP  619
            LSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  LSGNRNFEGRVHPLTRANYLASPP  655



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   392 bits (1006),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEAQ
Sbjct  441  QQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAQ  500

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSFHG+PAELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  501  EKVAKFSFHGKPAELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLVKPWIKT  560

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  561  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAA  620

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  621  AVLSGNRNFEGRVHALTRANYLASPP  646



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFAVPKEAQ
Sbjct  446  QQERVYSSYLELNLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFAVPKEAQ  505

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  506  DKVAKFSFHGQPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  565

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDIVA+
Sbjct  566  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIVAS  625

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  626  AVLSGNRNFEGRVHALTRANYLASPP  651



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   392 bits (1006),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEAQ
Sbjct  448  QQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAQ  507

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSFHG+PAELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  508  EKVAKFSFHGKPAELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLVKPWIKT  567

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  568  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAA  627

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  628  AVLSGNRNFEGRVHALTRANYLASPP  653



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   391 bits (1005),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    ERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEK  187
            ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+K
Sbjct  443  ERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDK  502

Query  188  VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSL  367
            V KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSL
Sbjct  503  VVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSL  562

Query  368  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAV  547
            APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAV
Sbjct  563  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITENDVVAAAV  622

Query  548  LSGNRNFEGRVHPLTRANYLASPP  619
            LSGNRNFEGRVHPLTRANYLASPP
Sbjct  623  LSGNRNFEGRVHPLTRANYLASPP  646



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   392 bits (1006),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER YSS L LDL DVEPC+SGPKRPHDRVPLK+MK+DWH+CLDNKVGFKGFA+PKE Q
Sbjct  466  QQERAYSSYLSLDLADVEPCISGPKRPHDRVPLKDMKADWHACLDNKVGFKGFAIPKEEQ  525

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K AKFSFHG+PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKASELGL VKPWVKT
Sbjct  526  GKAAKFSFHGEPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASELGLQVKPWVKT  585

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LD++V+SAIS+NDIVAA
Sbjct  586  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDDTVASAISENDIVAA  645

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  646  AVLSGNRNFEGRVHALTRANYLASPP  671



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   392 bits (1006),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+ER Y+S LQLDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGF VPKE Q
Sbjct  455  QEERAYTSYLQLDLADVEPCVSGPKRPHDRVPLKEMKTDWHSCLDSRVGFKGFGVPKEEQ  514

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  515  DKVAKFSFHGQPAELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKT  574

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LD  V+SAISDNDI+AA
Sbjct  575  SLAPGSGVVTKYLEQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDSEVASAISDNDIIAA  634

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  635  AVLSGNRNFEGRVHPLTRANYLASPP  660



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   391 bits (1005),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER YSS LQLDL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  449  QQERAYSSYLQLDLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAVPKEEQ  508

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF+FHG PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  509  NKVAKFTFHGLPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKT  568

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  569  SLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISENDIIAA  628

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  629  AVLSGNRNFEGRVHPLTRANYLASPP  654



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   391 bits (1004),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ
Sbjct  435  QQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQ  494

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  495  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKVKPWVKT  554

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+LDESV+SAIS+ND+VAA
Sbjct  555  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELDESVASAISENDVVAA  614

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  615  AVLSGNRNFEGRVHALTRANYLASPP  640



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   391 bits (1004),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  447  QQERVYSSYLELNLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAIPKEAQ  506

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL VKPW+KT
Sbjct  507  EKVAKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQVKPWIKT  566

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLN QGFHIVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  567  SLAPGSGVVTKYLLKSGLQEYLNHQGFHIVGYGCTTCIGNSGEINESVGAAITENDIVAA  626

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  627  AVLSGNRNFEGRVHPLTRANYLASPP  652



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   390 bits (1003),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  436  QQERVYSSYLELNLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAIPKEAQ  495

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW KT
Sbjct  496  EKVAKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWTKT  555

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSG++DESV +AI++NDIVAA
Sbjct  556  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITENDIVAA  615

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  616  AVLSGNRNFEGRVHPLTRANYLASPP  641



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   390 bits (1003),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS+L LDL DVEPC+SGPKRPHDRV LKEMKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  438  QAERVYSSNLALDLDDVEPCISGPKRPHDRVTLKEMKSDWHACLDNKVGFKGFAVPKEQQ  497

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  498  DKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKT  557

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGCTTCIGNSGDLDESVS+ I++ND+VAA
Sbjct  558  SLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGCTTCIGNSGDLDESVSAVITENDVVAA  617

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  618  AVLSGNRNFEGRVHPLTRANYLASPP  643



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   390 bits (1003),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L LDL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDNKVGFKGFAVPKE Q
Sbjct  441  QLERVYSSYLALDLDEVEPCISGPKRPHDRVTLKEMKSDWHSCLDNKVGFKGFAVPKEQQ  500

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  501  DKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKT  560

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGCTTCIGNSGDLDESVS+AI++ND+VAA
Sbjct  561  SLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGCTTCIGNSGDLDESVSAAITENDVVAA  620

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  621  AVLSGNRNFEGRVHPLTRANYLASPP  646



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   390 bits (1003),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA+PKEAQ
Sbjct  435  QQDRAYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAIPKEAQ  494

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPWVKT
Sbjct  495  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLKVKPWVKT  554

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVG+GCTTCIGNSGDLDESV+SAIS+NDIVA+
Sbjct  555  SLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGFGCTTCIGNSGDLDESVASAISENDIVAS  614

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  615  AVLSGNRNFEGRVHPLTRANYLASPP  640



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   390 bits (1003),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEAQ
Sbjct  451  QQERVYSSYLELNLAEVEPCISGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHG+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  511  DKVAKFSFHGKPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGF+IVGYGCTTCIGNSG+LDESV+SAIS+ND++AA
Sbjct  571  SLAPGSGVVTKYLLQSGLQEYLNKQGFNIVGYGCTTCIGNSGELDESVASAISENDVIAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHALTRANYLASPP  656



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score =   388 bits (996),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ
Sbjct  440  QQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQ  499

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PWVKT
Sbjct  500  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVNPWVKT  559

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+NDIVAA
Sbjct  560  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISENDIVAA  619

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  620  AVLSGNRNFEGRVHALTRANYLASPP  645



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   390 bits (1001),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER+YSS LQL+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q
Sbjct  431  QTERIYSSYLQLNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQ  490

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +FSFHG PA+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  491  NKVVEFSFHGAPAQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  550

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQQGFHIVGYGCTTCIGNSGD+DE+V+S ISDNDIVAA
Sbjct  551  SLAPGSGVVTKYLQKSGLQKYLNQQGFHIVGYGCTTCIGNSGDIDETVASVISDNDIVAA  610

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  611  AVLSGNRNFEGRVHPLTRANYLASPP  636



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEA 
Sbjct  335  QQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAL  394

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSF G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  395  EKVAKFSFDGKPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  454

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  455  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAA  514

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  515  AVLSGNRNFEGRVHALTRANYLASPP  540



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   388 bits (997),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ
Sbjct  354  QQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PWVKT
Sbjct  414  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVNPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+NDIVAA
Sbjct  474  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHALTRANYLASPP  559



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   390 bits (1001),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYS+ LQLDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CL+NKVGFKGFAVPKEAQ
Sbjct  451  QPERVYSAYLQLDLADVEPCISGPKRPHDRVPLKEMKADWHACLNNKVGFKGFAVPKEAQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  511  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWIKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV + I++NDI+AA
Sbjct  571  SLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVGAVITENDILAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHALTRANYLASPP  656



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   389 bits (1000),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER YSS LQLDL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  449  QQERAYSSYLQLDLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAVPKEEQ  508

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV+KF+FHG PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  509  NKVSKFTFHGLPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKT  568

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  569  SLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISENDIIAA  628

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  629  AVLSGNRNFEGRVHPLTRANYLASPP  654



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   388 bits (997),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEA 
Sbjct  429  QQERVYSSYLELNLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAL  488

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSF G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  489  EKVAKFSFDGKPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  548

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AA
Sbjct  549  SLAPGSGVVTKYLLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAA  608

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  609  AVLSGNRNFEGRVHALTRANYLASPP  634



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   389 bits (998),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+LDL  VEPC+SGPKRPHDRVPLKEMK+DWHSCLDN VGFKGFA+PKEAQ
Sbjct  454  QQERVYSSYLELDLSGVEPCISGPKRPHDRVPLKEMKADWHSCLDNTVGFKGFAIPKEAQ  513

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  514  DKVAKFSFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWIKT  573

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQEYLN+QGFHIVGYGCTTCIGNSG+++ESV +AIS+NDIVAA
Sbjct  574  SLAPGSGVVTKYLAKSGLQEYLNEQGFHIVGYGCTTCIGNSGEINESVGAAISENDIVAA  633

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  634  AVLSGNRNFEGRVHPLTRANYLASPP  659



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   388 bits (996),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ
Sbjct  440  QQDRVYSSYLELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQ  499

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PWVKT
Sbjct  500  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVNPWVKT  559

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+NDIVAA
Sbjct  560  SLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISENDIVAA  619

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  620  AVLSGNRNFEGRVHALTRANYLASPP  645



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   387 bits (994),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+E+VY+S LQLDL DVEPC+SGPKRPHDRVPLKEMK+DW  CLDN+ GFKGF VPKE Q
Sbjct  446  QEEQVYTSYLQLDLADVEPCVSGPKRPHDRVPLKEMKADWQKCLDNRAGFKGFGVPKEEQ  505

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  506  DKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKT  565

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ YLN+ GFHIVGYGCTTCIGNSG+LD SV+SAISDNDI+AA
Sbjct  566  SLAPGSGVVTKYLLQSGLQRYLNELGFHIVGYGCTTCIGNSGELDPSVASAISDNDIIAA  625

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  626  AVLSGNRNFEGRVHPLTRANYLASPP  651



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L  VEPC+SGPKRPHDRVPLKEMK+DWH CLD+KVGFKGFA+PKEAQ
Sbjct  437  QQERVYSSYLELNLDSVEPCISGPKRPHDRVPLKEMKADWHYCLDSKVGFKGFAIPKEAQ  496

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW KT
Sbjct  497  EKVAKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWTKT  556

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ++LNQQGF+IVGYGCTTCIGNSG++DESV +AI++NDIVAA
Sbjct  557  SLAPGSGVVTKYLLKSGLQKFLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITENDIVAA  616

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  617  AVLSGNRNFEGRVHPLTRANYLASPP  642



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   386 bits (991),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+LDL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDNKVGFKGFA+PKE Q
Sbjct  446  ESERVYSSYLELDLSQVEPCISGPKRPHDRVTLKDMKADWHACLDNKVGFKGFAIPKEVQ  505

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +K  KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPWVKT
Sbjct  506  DKEVKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLRVKPWVKT  565

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV+SAI++NDIVAA
Sbjct  566  SLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVASAITENDIVAA  625

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  626  AVLSGNRNFEGRVHPLTRANYLASPP  651



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   386 bits (992),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+LDL  VEPC+SGPKRPHDRVPL++MK DWHSCLDNK+GFKGF VPKE Q
Sbjct  467  QQERVYSSYLELDLAGVEPCVSGPKRPHDRVPLRQMKDDWHSCLDNKIGFKGFGVPKEEQ  526

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKFSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  527  SKVAKFSFSGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKT  586

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDL ESV+SAI+++D++AA
Sbjct  587  SLAPGSGVVTKYLLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLQESVASAITEHDLIAA  646

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  647  AVLSGNRNFEGRVHPLTRANYLASPP  672



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   384 bits (985),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS LQL L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKE+Q
Sbjct  354  QIEKVYSSYLQLKLEEVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHG PAEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  DKVAKFSFHGTPAELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQRYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENDMVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   385 bits (990),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+ VGFKGFA+PKEAQ
Sbjct  433  QQERVYSSYLELNLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSNVGFKGFAIPKEAQ  492

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KFSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW KT
Sbjct  493  EKVVKFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQVKPWTKT  552

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLNQQGF+IVGYGCTTCIGNSG++DESV +AI++NDIVAA
Sbjct  553  SLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITENDIVAA  612

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  613  AVLSGNRNFEGRVHPLTRANYLASPP  638



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   385 bits (990),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA+PKE Q
Sbjct  450  QSERVYSSYLELNLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAIPKEVQ  509

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF F+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKT
Sbjct  510  NKVAKFQFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLEVKPWVKT  569

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+NDIVAA
Sbjct  570  SLAPGSGVVTKYLLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISENDIVAA  629

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  630  AVLSGNRNFEGRVHPLTRANYLASPP  655



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   385 bits (989),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPLK MK+DWHSCLDNKVGFKGFAVPKEAQ
Sbjct  449  QTERVYSSYLELNLEDVEPCVSGPKRPHDRVPLKVMKADWHSCLDNKVGFKGFAVPKEAQ  508

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  509  NKVAEFSFHGTPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  568

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGDLDE+VS+AIS+NDIVAA
Sbjct  569  SLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDLDETVSAAISENDIVAA  628

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  629  AVLSGNRNFEGRVHPLTRANYLASPP  654



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+LDL  VEPC+SGPKRPHDRVPLK+MK+DWHSCLD+KVGFKGFA+ KE Q
Sbjct  421  QQERVYSSYLELDLTSVEPCISGPKRPHDRVPLKDMKADWHSCLDSKVGFKGFAISKEQQ  480

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  KFSF+G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  481  NKTVKFSFNGEPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKT  540

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDL++SV++AI+DND+VAA
Sbjct  541  SLAPGSGVVTKYLLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLNDSVAAAIADNDLVAA  600

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  601  AVLSGNRNFEGRVHPLTRANYLASPP  626



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   384 bits (987),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q++R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ
Sbjct  441  QKDRAYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQ  500

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  501  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKT  560

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+YLN+QGF+IVG+GCTTCIGNSGDLDESV+SAI++NDI+AA
Sbjct  561  SLAPGSGVVTKYLLQSGLQKYLNEQGFNIVGFGCTTCIGNSGDLDESVASAITENDILAA  620

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  621  AVLSGNRNFEGRVHALTRANYLASPP  646



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   384 bits (985),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  451  QQDRVYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAIPKEAQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  511  EKVANFSFNGKPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLEVKPWIKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  571  SLAPGSGVVTKYLLQSGLQEYLNKQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPLTRANYLASPP  656



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   381 bits (978),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  354  QQDRVYSSYLELNLDDVEPCISGPKRPHDRVTLKEMKADWHSCLDSKVGFKGFAIPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV  FSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  414  EKVVNFSFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLLKSGLQEYLNEQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   383 bits (983),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER YSS L+L+L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA+PKE Q
Sbjct  448  QTERAYSSYLELNLSEVEPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAIPKEVQ  507

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF F GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKT
Sbjct  508  NKVAKFQFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKT  567

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLLQSGLQ+Y +QQGF+IVGYGCTTCIGNSGDL ESV+SAIS+NDIVAA
Sbjct  568  SLAPGSGVVTKYLLQSGLQKYFDQQGFNIVGYGCTTCIGNSGDLHESVASAISENDIVAA  627

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  628  AVLSGNRNFEGRVHPLTRANYLASPP  653



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   383 bits (983),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            ++ERVYSS L+L+L D EPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKEAQ
Sbjct  452  ERERVYSSYLELNLEDAEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKEAQ  511

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  512  NKVAEFSFHGTPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  571

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGDL E+VS+AIS+NDIVAA
Sbjct  572  SLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDLHETVSAAISENDIVAA  631

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  632  AVLSGNRNFEGRVHPLTRANYLASPP  657



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   382 bits (982),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  442  QQERVYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAIPKEAQ  501

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAEL HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  502  EKVANFSFNGKPAELHHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  561

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  562  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  621

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  622  AVLSGNRNFEGRVHPLTRANYLASPP  647



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER YSS L+L+L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA+PKE Q
Sbjct  354  QIERAYSSYLELNLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAIPKEVQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF F GQPAEL HGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKT
Sbjct  414  NKVAKFQFDGQPAELNHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+NDIVAA
Sbjct  474  SLAPGSGVVTKYLLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   382 bits (982),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q +RVYSS L+L+L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  447  QIDRVYSSYLELNLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFAIPKEAQ  506

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL VKPW+KT
Sbjct  507  EKVANFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQVKPWIKT  566

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGFHIVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  567  SLAPGSGVVTKYLLKSGLQEYLNQQGFHIVGYGCTTCIGNSGEINESVGAAITENDIVAA  626

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  627  AVLSGNRNFEGRVHPLTRANYLASPP  652



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC++GPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKE+Q
Sbjct  354  QIERVYSSYLELNLEDVEPCIAGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITENDLVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   381 bits (978),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L LDL +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFAVPKE Q
Sbjct  391  QLERVYSSYLALDLDEVEPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAVPKEQQ  450

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KF F+GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  451  DKVVKFDFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKT  510

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEY N+QGFH+VGYGCTTCIGNSG+L ESVS+AI++ND+VAA
Sbjct  511  SLAPGSGVVTKYLLKSGLQEYFNKQGFHLVGYGCTTCIGNSGELHESVSAAITENDVVAA  570

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  571  AVLSGNRNFEGRVHPLTRANYLASPP  596



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYS+ L L L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKE+Q
Sbjct  354  QTEKVYSTYLDLKLEDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKFSF G PAEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  NKVAKFSFRGTPAELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENDMVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   380 bits (975),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS ++L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKEAQ
Sbjct  354  QVERVYSSHIELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  VKVAEFNFHGSPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS ++L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKEAQ
Sbjct  335  QVERVYSSHIELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKEAQ  394

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  395  VKVAEFNFHGSPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  454

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++NDIVAA
Sbjct  455  SLAPGSGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDIVAA  514

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  515  AVLSGNRNFEGRVHPLTRANYLASPP  540



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   379 bits (974),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS LQL L +VEPC+SGPKRPHDRVPLKEMK+DW +CLDN+VGFKGFA+PKE+Q
Sbjct  354  QIEKVYSSYLQLKLEEVEPCISGPKRPHDRVPLKEMKADWQACLDNRVGFKGFAIPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +K AKFSFHG PAEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  DKAAKFSFHGTPAELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENDMVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score =   379 bits (974),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS ++L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKEAQ
Sbjct  354  QVERVYSSHIELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  VKVAEFNFHGSPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   381 bits (979),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRV LK+MKSDWH+CLD+KVGFKGFA+PKE Q
Sbjct  450  QSERVYSSYLELNLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDSKVGFKGFAIPKEVQ  509

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV KF F GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKT
Sbjct  510  NKVVKFQFEGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKT  569

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+NDIVAA
Sbjct  570  SLAPGSGVVTKYLLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISENDIVAA  629

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  630  AVLSGNRNFEGRVHPLTRANYLASPP  655



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   381 bits (979),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  446  QTERVYSSYLELNLEEVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  505

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  506  NKVAEFSFHGMPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  565

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVT+YL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+NDIVAA
Sbjct  566  SLAPGSGVVTRYLEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDETVSAAISENDIVAA  625

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  626  AVLSGNRNFEGRVHPLTRANYLASPP  651



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   381 bits (979),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q +RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PK+ Q
Sbjct  439  QPDRVYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKDVQ  498

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  499  GKVAKFDFHGQPAEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKVKPWVKT  558

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+NDIVA+
Sbjct  559  SLAPGSGVVTKYLLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISENDIVAS  618

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  619  AVLSGNRNFEGRVHPLTRANYLASPP  644



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   380 bits (977),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q +RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA+PK+ Q
Sbjct  440  QPDRVYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAIPKDVQ  499

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  500  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKT  559

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+NDIVAA
Sbjct  560  SLAPGSGVVTKYLLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISENDIVAA  619

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  620  AVLSGNRNFEGRVHPLTRANYLASPP  645



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   380 bits (977),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q +RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA+PK+ Q
Sbjct  440  QPDRVYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAIPKDVQ  499

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKT
Sbjct  500  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKT  559

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+NDIVAA
Sbjct  560  SLAPGSGVVTKYLLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISENDIVAA  619

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  620  AVLSGNRNFEGRVHPLTRANYLASPP  645



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   380 bits (977),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  446  QQDRVYSSYLELNLDDVEPCISGPKRPHDRVTLKEMKADWHSCLDSKVGFKGFAIPKEAQ  505

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV  FSF GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  506  EKVVNFSFDGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  565

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  566  SLAPGSGVVTKYLLKSGLQEYLNEQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  625

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  626  AVLSGNRNFEGRVHPLTRANYLASPP  651



>emb|CAN83844.1| hypothetical protein VITISV_003004 [Vitis vinifera]
Length=885

 Score =   378 bits (970),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PKE+Q
Sbjct  307  QVEKVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKESQ  366

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +FS+HG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  367  SKVVEFSYHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  426

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD++ESV+SAIS+ND+VAA
Sbjct  427  SLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDINESVASAISENDMVAA  486

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  487  AVLSGNRNFEGRVHPLTRANYLASPP  512



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   378 bits (971),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PKE+Q
Sbjct  354  QVEKVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +FS+HG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVVEFSYHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD++ESV+SAIS+ND+VAA
Sbjct  474  SLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDINESVASAISENDMVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   375 bits (964),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER YSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  251  QVERTYSSYLELDLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAVPKESQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL VKPW+KT
Sbjct  311  GKVAEFTFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEVKPWIKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++ND+VAA
Sbjct  371  SLAPGSGVVTKYLQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDLVAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   380 bits (976),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q +RVYSS L+L+L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  450  QIDRVYSSYLELNLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFAIPKEAQ  509

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL VKPW+KT
Sbjct  510  EKVANFSFNGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQVKPWIKT  569

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  570  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  629

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  630  AVLSGNRNFEGRVHPLTRANYLASPP  655



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   380 bits (975),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q +RVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA+PK+ Q
Sbjct  440  QPDRVYSSYLELNLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAIPKDVQ  499

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPWVKT
Sbjct  500  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLQVKPWVKT  559

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+NDIVAA
Sbjct  560  SLAPGSGVVTKYLLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISENDIVAA  619

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  620  AVLSGNRNFEGRVHPLTRANYLASPP  645



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   380 bits (975),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q
Sbjct  451  QTERVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA E GL VKPW+KT
Sbjct  511  NKVAEFSFHGLPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACEQGLEVKPWIKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVT+YL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+NDIVAA
Sbjct  571  SLAPGSGVVTRYLERSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDETVSAAISENDIVAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPLTRANYLASPP  656



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score =   375 bits (964),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+ERVYSS   LDL DVEPC+SGPKRP+DRV LK+MK+DWH+CLDNK GFKGFAVPK+ Q
Sbjct  473  QEERVYSSYSGLDLADVEPCISGPKRPNDRVALKDMKADWHACLDNKHGFKGFAVPKQEQ  532

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKF+FHG PAELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  533  DKVAKFTFHGLPAELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKT  592

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSG VTKYL +SGLQ+YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+DNDIVAA
Sbjct  593  SLAPGSGAVTKYLHKSGLQKYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITDNDIVAA  652

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  653  AVLSGNRNFEGRVHPQTRANYLASPP  678



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   378 bits (970),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PKE+Q
Sbjct  372  QVEKVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKESQ  431

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +FS+HG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  432  SKVVEFSYHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  491

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD++ESV+SAIS+ND+VAA
Sbjct  492  SLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDINESVASAISENDMVAA  551

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  552  AVLSGNRNFEGRVHPLTRANYLASPP  577



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   379 bits (974),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA+PKEAQ
Sbjct  449  QQDRVYSSYLELNLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFAIPKEAQ  508

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  509  EKVANFSFNGEPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  568

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  569  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  628

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  629  AVLSGNRNFEGRVHPLTRANYLASPP  654



>gb|KDO71349.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=565

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  19   QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  78

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  79   SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  138

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  139  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  198

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  199  AVLSGNRNFEGRVHPLTRANYLASPP  224



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   379 bits (974),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 189/197 (96%), Gaps = 0/197 (0%)
 Frame = +2

Query  29   LQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFH  208
            L LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKEAQ+KVA FSFH
Sbjct  466  LHLDLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKEAQQKVASFSFH  525

Query  209  GQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVV  388
            GQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVV
Sbjct  526  GQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVV  585

Query  389  TKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNF  568
            TKYL +SGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV++ IS+NDIVAAAVLSGNRNF
Sbjct  586  TKYLQKSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVAATISENDIVAAAVLSGNRNF  645

Query  569  EGRVHPLTRANYLASPP  619
            EGRVHPLTRANYLASPP
Sbjct  646  EGRVHPLTRANYLASPP  662



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   379 bits (973),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+RVYSS L+L+L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA+PKEA 
Sbjct  444  QQDRVYSSYLELNLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFAIPKEAH  503

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKFSF+G+PAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL VKPWVKT
Sbjct  504  EKVAKFSFNGEPAEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQVKPWVKT  563

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLN QGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  564  SLAPGSGVVTKYLLKSGLQEYLNHQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  623

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  624  AVLSGNRNFEGRVHPLTRANYLASPP  649



>gb|ABK25210.1| unknown [Picea sitchensis]
Length=565

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER YSS L+LDL  VEPC+SGPKRPHDRV LKEMK+DWHSCLDNKVGFKGFA+PKE Q
Sbjct  19   QIERTYSSYLELDLSSVEPCISGPKRPHDRVTLKEMKADWHSCLDNKVGFKGFAIPKEKQ  78

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKV KF+++G PAEL+HG VVIAAITSCTNTSNP+VMLGA LVAKKA ELGL VKPWVKT
Sbjct  79   EKVVKFTYNGTPAELRHGDVVIAAITSCTNTSNPNVMLGAGLVAKKACELGLEVKPWVKT  138

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGL +YL+QQGF +VGYGCTTCIGNSGDL ESVSSAI++ND+VA+
Sbjct  139  SLAPGSGVVTKYLKKSGLDKYLDQQGFQLVGYGCTTCIGNSGDLHESVSSAITENDLVAS  198

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  199  AVLSGNRNFEGRVHPLTRANYLASPP  224



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   378 bits (970),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLDNKVGFKGFA+PK+AQ
Sbjct  442  QQERAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDNKVGFKGFAIPKKAQ  501

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  502  EKVANFSFNGKPAEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  561

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV  AI++NDIV A
Sbjct  562  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGVAITENDIVVA  621

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  622  AVLSGNRNFEGRVHPLTRANYLASPP  647



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   377 bits (967),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+ERVYSS L+L+L DVEPC+SGPKRP+DRVPLK+MK+DWH+CLDNK GFKGFAVPKE Q
Sbjct  436  QEERVYSSYLELELADVEPCVSGPKRPNDRVPLKDMKADWHACLDNKQGFKGFAVPKEEQ  495

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKF+FHG PAELKHGSVVIAAITSCTNTSNP+VMLGA LVAKKA ELGL VKPW+KT
Sbjct  496  DKVAKFTFHGLPAELKHGSVVIAAITSCTNTSNPNVMLGAGLVAKKACELGLEVKPWIKT  555

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSG VTKYL +SGL++YLNQQGF++VGYGCTTCIGNSGDLDESV+SAI+DNDIVAA
Sbjct  556  SLAPGSGAVTKYLHKSGLEKYLNQQGFNLVGYGCTTCIGNSGDLDESVASAITDNDIVAA  615

Query  542  AVLSGNRNFEGRVHPLTRANYLASP  616
            AVLSGNRNFEGRVHPLTRANYLASP
Sbjct  616  AVLSGNRNFEGRVHPLTRANYLASP  640



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRVPLKEMK DWH+CLDNKVGFKGFA+PK++Q
Sbjct  354  QTERVYSSYLELNLEEVEPCVSGPKRPHDRVPLKEMKVDWHACLDNKVGFKGFAIPKDSQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +FSFH  PA+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVVEFSFHETPAQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ +LNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+NDIVAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQNHLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+ERVYSS L LDL DVEPC+SGPKRP+DRV L +MK+DWH+CLDNK GFKGFAVPK+ Q
Sbjct  520  QEERVYSSYLGLDLADVEPCVSGPKRPNDRVALNDMKADWHACLDNKHGFKGFAVPKQEQ  579

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVA F+FHG PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  580  DKVATFTFHGLPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKT  639

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSG VTKYL +SGLQ YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+DNDIVAA
Sbjct  640  SLAPGSGAVTKYLHKSGLQTYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITDNDIVAA  699

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  700  AVLSGNRNFEGRVHPQTRANYLASPP  725



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   377 bits (968),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQ
Sbjct  450  QQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQ  509

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  510  EKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  569

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  570  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  629

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  630  AVLSGNRNFEGRVHPLTRANYLASPP  655



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   377 bits (967),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQ
Sbjct  447  QQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQ  506

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  507  EKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  566

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  567  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  626

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  627  AVLSGNRNFEGRVHPLTRANYLASPP  652



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER+YSS L L+L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDN+VGFKGFA+PKE+Q
Sbjct  353  QIERMYSSYLALNLEDVEPCISGPKRPHDRVPLREMKADWHACLDNRVGFKGFAIPKESQ  412

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSF G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  413  SKVAEFSFRGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  472

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++ND+VAA
Sbjct  473  SLAPGSGVVTKYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITENDLVAA  532

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  533  AVLSGNRNFEGRVHPLTRANYLASPP  558



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q +RVYSS + L+L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDNKVGFKGFA+PKE+Q
Sbjct  353  QIDRVYSSYIALNLRDVEPCISGPKRPHDRVPLREMKADWHACLDNKVGFKGFAIPKESQ  412

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLG+ALVAKKA ELGL VKPW+KT
Sbjct  413  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGSALVAKKACELGLEVKPWIKT  472

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKY+ +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++ND+VAA
Sbjct  473  SLAPGSGVVTKYMEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITENDVVAA  532

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  533  AVLSGNRNFEGRVHPLTRANYLASPP  558



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER YSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  354  QVERTYSSYLELDLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL VKPW+KT
Sbjct  414  GKVAEFTFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDLVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER YSS L+LDL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  352  QVERTYSSYLELDLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAVPKESQ  411

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL VKPW+KT
Sbjct  412  GKVAEFTFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEVKPWIKT  471

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++ND+VAA
Sbjct  472  SLAPGSGVVTKYLQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDLVAA  531

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  532  AVLSGNRNFEGRVHPLTRANYLASPP  557



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   376 bits (966),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DW SCLDNKVGFKGFAVPKE+Q
Sbjct  431  QTERVYSSYLELNLGDVEPCVSGPKRPHDRVPLKEMKADWQSCLDNKVGFKGFAVPKESQ  490

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +K+A+FSFHG   ++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  491  DKIAEFSFHGTTTQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  550

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+NDIVAA
Sbjct  551  SLAPGSGVVTKYLEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDEAVSAAISENDIVAA  610

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  611  AVLSGNRNFEGRVHPLTRANYLASPP  636



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   377 bits (967),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQ
Sbjct  447  QQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQ  506

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  507  EKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  566

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  567  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  626

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  627  AVLSGNRNFEGRVHPLTRANYLASPP  652



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   377 bits (967),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQ
Sbjct  451  QQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  511  EKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  571  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPLTRANYLASPP  656



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVY+S L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFA+PKE+Q
Sbjct  354  QIERVYTSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFAIPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F+FHG PA+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKT
Sbjct  414  SKVVEFNFHGTPAQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKAFELGLEVKPWVKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLN  GFHIVGYGCTTCIGNSGD+DE+V+SAI++ND+VAA
Sbjct  474  SLAPGSGVVTKYLEKSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDEAVASAITENDLVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   369 bits (947),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  156  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  215

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  216  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  275

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  276  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  335

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  336  AVLSGNRNFEGRVHPLTRANYLASPP  361



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   376 bits (966),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+R YSS L+L+L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQ
Sbjct  451  QQDRAYSSYLELNLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVA FSF+G+PAE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KT
Sbjct  511  EKVANFSFNGKPAEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAA
Sbjct  571  SLAPGSGVVTKYLLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPLTRANYLASPP  656



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVP+E+Q
Sbjct  251  QIERVYSSYLELNLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFAVPEESQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  311  SKVVEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAA
Sbjct  371  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDLVAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   373 bits (957),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  354  QVERVYSSYLELNLNEVEPCISGPKRPHDRVTLKEMKVDWHACLDNRVGFKGFAVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  NKVVEFTFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQQYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   373 bits (957),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  354  QVERVYSSYLELNLNEVEPCISGPKRPHDRVTLKEMKVDWHACLDNRVGFKGFAVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  NKVVEFTFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQQYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>dbj|BAE98476.1| aconitase like protein [Arabidopsis thaliana]
Length=325

 Score =   355 bits (911),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  66   QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  125

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKT
Sbjct  126  EEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKVKPWVKT  185

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ A
Sbjct  186  SLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPA  245

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  246  AVLSGNRNFEGRVHPQTRANYLASPP  271



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  251  QIERVYSSYLELNLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFAVPKESQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  311  SKVVEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAA
Sbjct  371  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDLVAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNR FEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRXFEGRVHPLTRANYLASPP  456



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   375 bits (962),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+ERVYSS   LDL DVEPC+SGPKRP+DRV LK+MK+DWH+CLDNK GFKGFAVPK+ Q
Sbjct  473  QEERVYSSYSGLDLADVEPCISGPKRPNDRVALKDMKADWHACLDNKHGFKGFAVPKQEQ  532

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKF+FHG PAELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  533  DKVAKFTFHGLPAELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKT  592

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSG VTKYL +SGLQ+YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+DNDIVAA
Sbjct  593  SLAPGSGAVTKYLHKSGLQKYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITDNDIVAA  652

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  653  AVLSGNRNFEGRVHPQTRANYLASPP  678



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   374 bits (959),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDWHSCLDN VGFKGFAVPKE+Q
Sbjct  442  EAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWHSCLDNDVGFKGFAVPKESQ  501

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  502  SKVAEFSFHGAPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  561

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSGDLDESVS+AIS+NDIVAA
Sbjct  562  SLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAA  621

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  622  AVLSGNRNFEGRVHPLTRANYLASPP  647



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYS+SL+L L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  354  QLERVYSASLELKLEDVEPCISGPKRPHDRVSLKEMKVDWHACLDNRVGFKGFAVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +FSFHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  414  TKVVEFSFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+D++V+SAI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDDAVASAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  251  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  311  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  371  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   370 bits (951),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E VYSS L+L L DVEPC+SGPKRPHDRVP+KEMK+DWH+CLDN+VGFKGFA+PKEAQ
Sbjct  354  QSEIVYSSCLELKLEDVEPCISGPKRPHDRVPIKEMKADWHACLDNRVGFKGFAIPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV  F FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  NKVVDFDFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DE+V+ AI+DND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDEAVALAIADNDMVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KDO71346.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=807

 Score =   368 bits (945),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  354  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   372 bits (954),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAV KE+Q
Sbjct  414  QVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAVAKESQ  473

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  474  SKVVEFTFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACKLGLEVKPWIKT  533

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYLL+SGLQ+YLN  GF+IVGYGCTTCIGNSGD+DE+V SAI++NDIVAA
Sbjct  534  SLAPGSGVVTKYLLKSGLQKYLNHLGFYIVGYGCTTCIGNSGDIDEAVGSAITENDIVAA  593

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  594  AVLSGNRNFEGRVHPLTRANYLASPP  619



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   374 bits (959),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q+ERVYSS L LDL DVEPC+SGPKRP+DRV L +MK+DWH+CLDNK GFKGFAVPK+ Q
Sbjct  520  QEERVYSSYLGLDLADVEPCVSGPKRPNDRVALNDMKADWHACLDNKHGFKGFAVPKQEQ  579

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVA F+FHG PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KT
Sbjct  580  DKVATFTFHGLPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKT  639

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSG VTKYL +SGLQ YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+DNDIVAA
Sbjct  640  SLAPGSGAVTKYLHKSGLQTYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITDNDIVAA  699

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  700  AVLSGNRNFEGRVHPQTRANYLASPP  725



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   370 bits (949),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  354  QIERVYSSYLELNLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFAVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  414  SKVVEFDFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITENDVVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>tpg|DAA43248.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=664

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    ERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEK  187
            ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q K
Sbjct  143  ERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQGK  202

Query  188  VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSL  367
            VA+FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSL
Sbjct  203  VAEFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSL  262

Query  368  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAV  547
            APGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++NDIVAAAV
Sbjct  263  APGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITENDIVAAAV  322

Query  548  LSGNRNFEGRVHPLTRANYLASPP  619
            LSGNRNFEGRVHPLTRANYLASPP
Sbjct  323  LSGNRNFEGRVHPLTRANYLASPP  346



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   372 bits (954),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPLK MKSDW +CLDNKVGFKGFAVPKE+Q
Sbjct  440  QTERVYSSYLELNLEDVEPCISGPKRPHDRVPLKGMKSDWQTCLDNKVGFKGFAVPKESQ  499

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K+A+FSF G PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  500  NKIAEFSFRGTPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  559

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDE+VS+AIS+NDIVAA
Sbjct  560  SLAPGSGVVTKYLEKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDEAVSAAISENDIVAA  619

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  620  AVLSGNRNFEGRVHPLTRANYLASPP  645



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   369 bits (948),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q  RVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  354  QIVRVYSSYLELNLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFAVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVVEFDFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDLVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   369 bits (948),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFAVPKE+Q
Sbjct  355  QVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFAVPKESQ  414

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  415  NKVAEFTFQGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  474

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAA
Sbjct  475  SLAPGSGVVTKYLQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAA  534

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  535  AVLSGNRNFEGRVHPLTRANYLASPP  560



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   369 bits (947),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFAVPKE+Q
Sbjct  355  QVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFAVPKESQ  414

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  415  NKVAEFTFQGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  474

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAA
Sbjct  475  SLAPGSGVVTKYLQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAA  534

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  535  AVLSGNRNFEGRVHPLTRANYLASPP  560



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +2

Query  8    ERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEK  187
            ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q K
Sbjct  143  ERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQGK  202

Query  188  VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSL  367
            VA+FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSL
Sbjct  203  VAEFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSL  262

Query  368  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAV  547
            APGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++NDIVAAAV
Sbjct  263  APGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITENDIVAAAV  322

Query  548  LSGNRNFEGRVHPLTRANYLASPP  619
            LSGNRNFEGRVHPLTRANYLASPP
Sbjct  323  LSGNRNFEGRVHPLTRANYLASPP  346



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   369 bits (947),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER+YSS L L+L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDN+VGFKGFA+PKE+Q
Sbjct  353  QIERMYSSYLALNLEDVEPCISGPKRPHDRVPLREMKADWHACLDNRVGFKGFAIPKESQ  412

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSF G  A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  413  SKVAEFSFRGTSAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  472

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DE+V+SAI++ND+VAA
Sbjct  473  SLAPGSGVVTKYLEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDEAVASAITENDLVAA  532

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  533  AVLSGNRNFEGRVHPLTRANYLASPP  558



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q
Sbjct  354  QIERVYSSYLELNLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFAVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  414  SKVVEFDFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDVVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  335  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  394

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  395  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  454

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  455  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  514

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  515  AVLSGNRNFEGRVHPLTRANYLASPP  540



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  354  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  354  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_006412054.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 ref|XP_006412055.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53507.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53508.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=763

 Score =   365 bits (937),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSS+L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSSNLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKAVEFNFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  343  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  402

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  403  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  462

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  463  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  522

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  523  AVLSGNRNFEGRVHPLTRANYLASPP  548



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  354  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   369 bits (946),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  354  QSERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  474  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   370 bits (950),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 191/207 (92%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQERVYSS L LDL DV PC+SGPKRPHDRVPLK+MK+DWHSCLD+KVGFKGFAVPKE Q
Sbjct  451  QQERVYSSYLHLDLGDVVPCVSGPKRPHDRVPLKDMKADWHSCLDSKVGFKGFAVPKETQ  510

Query  182  EKVAKFSFHGQ-PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVK  358
            EKV KF F G+ PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVK
Sbjct  511  EKVVKFLFKGEEPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWVK  570

Query  359  TSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVA  538
            TSLAPGSGV TKYL +SGLQ+YLN+QGF+IVGYGCTTCIGNSGDL+++V  AI++NDIVA
Sbjct  571  TSLAPGSGVATKYLQESGLQKYLNEQGFNIVGYGCTTCIGNSGDLEKTVGDAITENDIVA  630

Query  539  AAVLSGNRNFEGRVHPLTRANYLASPP  619
            AAVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  631  AAVLSGNRNFEGRVHPLTRANYLASPP  657



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   365 bits (937),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK+DWH+CL+NKVGFKGFAVPKE+Q
Sbjct  251  QVERVYSSYLELNLEDVEPCVSGPKRPHDRVTLKEMKADWHACLNNKVGFKGFAVPKESQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K A+F FH  PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  311  TKFAEFKFHETPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQVKPWIKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAA
Sbjct  371  SLAPGSGVVTKYLQKSGLQPYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAA  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   367 bits (943),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q
Sbjct  352  ESERVYSSYLELNLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQ  411

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  412  SKVAEFNFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  471

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAA
Sbjct  472  SLAPGSGVVTKYLQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAA  531

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  532  AVLSGNRNFEGRVHPLTRANYLASPP  557



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   367 bits (943),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVE C+SGPKRPHDRVPLKEMK+DW +CL+N+VGFKGFAVP E+Q
Sbjct  355  QVERVYSSYLELNLEDVESCVSGPKRPHDRVPLKEMKADWLACLNNRVGFKGFAVPVESQ  414

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA F+FHG PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  415  IKVADFTFHGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  474

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++NDIVAA
Sbjct  475  SLAPGSGVVTKYLQRSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITENDIVAA  534

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  535  AVLSGNRNFEGRVHPLTRANYLASPP  560



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   368 bits (944),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 195/235 (83%), Gaps = 29/235 (12%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q E+VYSS LQL L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKE+Q
Sbjct  354  QIEKVYSSYLQLKLEEVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KVAKFSFHG PAEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  DKVAKFSFHGTPAELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDN-----  526
            SLAPGSGVVTKYL +SGLQ YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+N     
Sbjct  474  SLAPGSGVVTKYLQKSGLQRYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENGKFFN  533

Query  527  ------------------------DIVAAAVLSGNRNFEGRVHPLTRANYLASPP  619
                                    D+VAAAVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  KNILGYTCIRMLEADRLAVFYMRPDMVAAAVLSGNRNFEGRVHPLTRANYLASPP  588



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   367 bits (941),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSSSL+L+L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSSSLELNLADVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F F+G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVVEFDFNGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   367 bits (941),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSS+L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSSNLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  414  SKVVEFDFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI+DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHETVASAITDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   366 bits (940),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFAV KE+Q
Sbjct  362  QVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFAVSKESQ  421

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  422  NKVAEFTFQGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  481

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAA
Sbjct  482  SLAPGSGVVTKYLQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAA  541

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  542  AVLSGNRNFEGRVHPLTRANYLASPP  567



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   366 bits (939),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFAV KE+Q
Sbjct  355  QVERVYSSYLELNLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFAVSKESQ  414

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  415  NKVAEFTFQGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  474

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAA
Sbjct  475  SLAPGSGVVTKYLQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAA  534

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  535  AVLSGNRNFEGRVHPLTRANYLASPP  560



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   365 bits (938),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSS+L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSSNLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKAVEFNFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   365 bits (937),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGF+VPKE+Q
Sbjct  354  QIERVYSSYLELNLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFSVPKESQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F+F G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  414  SKVVEFNFQGSPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAA
Sbjct  474  SLAPGSGVVTKYLQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDVVAA  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   365 bits (937),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK DWH+CL+NKVGFKGFAVPKE+Q
Sbjct  355  QVERVYSSYLELNLEDVEPCVSGPKRPHDRVTLKEMKIDWHACLNNKVGFKGFAVPKESQ  414

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F+  PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  415  TKVAEFTFNETPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKT  474

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAA
Sbjct  475  SLAPGSGVVTKYLQRSGLQKYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAA  534

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  535  AVLSGNRNFEGRVHPLTRANYLASPP  560



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   365 bits (938),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q
Sbjct  363  EAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQ  422

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  423  GKVAEFSFHGTPAKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  482

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISDNDIVAA
Sbjct  483  SLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISDNDIVAA  542

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  543  AVLSGNRNFEGRVHALTRANYLASPP  568



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   365 bits (936),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSSSL+L+L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSSSLELNLEDVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F F+G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  414  SKVVEFDFNGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   364 bits (935),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L DVEPC+SGPKRPHDRV LKEMK+DWH+CL+NKVGFKGFAVPKE+Q
Sbjct  355  QVERVYSSYLELNLEDVEPCVSGPKRPHDRVTLKEMKADWHACLNNKVGFKGFAVPKESQ  414

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K A+F FH  PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  415  TKFAEFKFHETPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQVKPWIKT  474

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAA
Sbjct  475  SLAPGSGVVTKYLQKSGLQPYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAA  534

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  535  AVLSGNRNFEGRVHPLTRANYLASPP  560



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   364 bits (935),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYS++L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  361  ESKTVYSANLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  420

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  421  SKAVEFNFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  480

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF +VGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  481  SLAPGSGVVTKYLAKSGLQKYLNQLGFSVVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  540

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  541  AVLSGNRNFEGRVHPLTRANYLASPP  566



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   364 bits (934),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSS+L+L+L  VEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSSNLELNLEGVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+F+G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKVAEFNFNGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQQYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   365 bits (936),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYS++L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  378  ESKTVYSANLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  437

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  438  SKAVEFNFNGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  497

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  498  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  557

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  558  AVLSGNRNFEGRVHPLTRANYLASPP  583



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   364 bits (935),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q
Sbjct  362  EAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQ  421

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  422  GKVADFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  481

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AI++NDIVAA
Sbjct  482  SLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAIAENDIVAA  541

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  542  AVLSGNRNFEGRVHPLTRANYLASPP  567



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   366 bits (939),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q
Sbjct  442  EAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQ  501

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  502  GKVAEFSFHGTPAKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  561

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISDNDIVAA
Sbjct  562  SLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISDNDIVAA  621

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  622  AVLSGNRNFEGRVHALTRANYLASPP  647



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   364 bits (934),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSSSL+L+L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSSSLELNLEDVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV +F F+G PA L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  NKVVEFDFNGTPAHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLN  GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNHLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   366 bits (939),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/206 (85%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q
Sbjct  442  EAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQ  501

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  502  GKVAEFSFHGTPAKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  561

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISDNDIVAA
Sbjct  562  SLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISDNDIVAA  621

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  622  AVLSGNRNFEGRVHALTRANYLASPP  647



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   366 bits (939),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = +2

Query  53   EPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQPAELKH  232
            +P +SGPKRPHDRVPLK+MK DWH+CLDNKVGFKGFA+PKE Q+KVAKFSFHGQPAELKH
Sbjct  467  QPXMSGPKRPHDRVPLKDMKVDWHACLDNKVGFKGFAIPKEVQDKVAKFSFHGQPAELKH  526

Query  233  GSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKYLLQSG  412
            GSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKTSLAPGSGVVTKYLL+SG
Sbjct  527  GSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKTSLAPGSGVVTKYLLKSG  586

Query  413  LQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGRVHPLT  592
            LQ+Y +QQGF IVGYGCTTCIGNSGDLDE+V+SAIS+NDIVAAAVLSGNRNFEGRVHPLT
Sbjct  587  LQKYFDQQGFQIVGYGCTTCIGNSGDLDETVASAISENDIVAAAVLSGNRNFEGRVHPLT  646

Query  593  RANYLASPP  619
            RANYLASPP
Sbjct  647  RANYLASPP  655



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   360 bits (925),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  251  ESKTVYSSCLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  310

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  +F+F+G  A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  311  SKAVEFNFNGTTAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  370

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  371  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  430

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  431  AVLSGNRNFEGRVHPLTRANYLASPP  456



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   362 bits (930),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  14   VYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVA  193
            +YSS+L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFAVPKEAQ K  
Sbjct  385  IYSSTLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFAVPKEAQSKAV  444

Query  194  KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAP  373
            +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAP
Sbjct  445  EFNFNGTPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAP  504

Query  374  GSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLS  553
            GSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLS
Sbjct  505  GSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLS  564

Query  554  GNRNFEGRVHPLTRANYLASPP  619
            GNRNFEGRVHPLTRANYLASPP
Sbjct  565  GNRNFEGRVHPLTRANYLASPP  586



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   356 bits (914),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q
Sbjct  141  EAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQ  200

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F FHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  201  GKVAEFLFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  260

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV +YL +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDESVS+AI++NDIV+A
Sbjct  261  SLAPGSGVVKQYLDKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDESVSAAITENDIVSA  320

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  321  AVLSGNRNFEGRVHPLTRANYLASPP  346



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   361 bits (927),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYS++L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSANLELNLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  +F+F+G PA+L+HG VVIA ITSCTNTSNP VMLGAALVAKKA ELGL VKPW+KT
Sbjct  414  SKAVEFNFNGTPAQLRHGDVVIAPITSCTNTSNPRVMLGAALVAKKACELGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q
Sbjct  447  EAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQ  506

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  507  GKVAEFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  566

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++ND+VAA
Sbjct  567  SLAPGSGVVKKYLDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITENDVVAA  626

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  627  AVLSGNRNFEGRVHPLTRANYLASPP  652



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   361 bits (926),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  14   VYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVA  193
            VYSS+L+L+L DVEPC+SGPKRPHDR+PLKEMK+DWHSCLD++VGFKGFAVPKEAQ K  
Sbjct  361  VYSSNLELNLEDVEPCVSGPKRPHDRLPLKEMKADWHSCLDSRVGFKGFAVPKEAQSKAV  420

Query  194  KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAP  373
            +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAP
Sbjct  421  EFNFNGTPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAP  480

Query  374  GSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLS  553
            GSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLS
Sbjct  481  GSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLS  540

Query  554  GNRNFEGRVHPLTRANYLASPP  619
            GNRNFEGRVHPLTRANYLASPP
Sbjct  541  GNRNFEGRVHPLTRANYLASPP  562



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   363 bits (931),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q
Sbjct  449  QAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQ  508

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA FSFHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  509  GKVADFSFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  568

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGLQ+YL+Q GF+IVGYGCTTCIGNSGDLDESV++AIS+ND+VAA
Sbjct  569  SLAPGSGVVKKYLDKSGLQKYLDQLGFNIVGYGCTTCIGNSGDLDESVAAAISENDVVAA  628

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  629  AVLSGNRNFEGRVHALTRANYLASPP  654



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   360 bits (924),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  354  ESKTVYSSCLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  413

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  +F+F+G  A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  414  SKAVEFNFNGTTAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  473

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  474  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  533

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  AVLSGNRNFEGRVHPLTRANYLASPP  559



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   362 bits (930),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL +V PCLSGPKRPHDRV LK MKSDW SCLDNKVGFKGFAVPKE+Q
Sbjct  454  QAERVYSSYLELDLDEVGPCLSGPKRPHDRVTLKNMKSDWLSCLDNKVGFKGFAVPKESQ  513

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+FSF G PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA +LGL VKPW+KT
Sbjct  514  GKVAEFSFRGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACDLGLEVKPWIKT  573

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDESV++AI+DND+VAA
Sbjct  574  SLAPGSGVVKKYLDKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDESVAAAITDNDVVAA  633

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  634  AVLSGNRNFEGRVHALTRANYLASPP  659



>sp|Q42669.1|ACOC_CUCMC RecName: Full=Aconitate hydratase; Short=Aconitase; AltName: 
Full=Citrate hydro-lyase, partial [Cucumis melo var. conomon]
 emb|CAA58047.1| aconitase [Cucumis melo]
Length=764

 Score =   357 bits (915),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS ++L+L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKEAQ
Sbjct  220  QVERVYSSHIELNLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKEAQ  279

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F+FHG PA+L+HG VVIAAITSCTNTS+ SVMLGAALVAKKA ELGL VKPW+KT
Sbjct  280  VKVAEFNFHGSPAQLRHGDVVIAAITSCTNTSS-SVMLGAALVAKKACELGLEVKPWIKT  338

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
             L    GVVTKYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI+ NDIVAA
Sbjct  339  VLLQALGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITGNDIVAA  398

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  399  AVLSGNRNFEGRVHPLTRANYLASPP  424



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   360 bits (924),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = +2

Query  14   VYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVA  193
            VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFAVPKEAQ K  
Sbjct  358  VYSSKLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFAVPKEAQSKAV  417

Query  194  KFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAP  373
            +F+F+G PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAP
Sbjct  418  EFNFNGTPAKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAP  477

Query  374  GSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLS  553
            GSGVVTKYL +SGLQ+YL+Q GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLS
Sbjct  478  GSGVVTKYLAKSGLQKYLSQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLS  537

Query  554  GNRNFEGRVHPLTRANYLASPP  619
            GNRNFEGRVHPLTRANYLASPP
Sbjct  538  GNRNFEGRVHPLTRANYLASPP  559



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   360 bits (923),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + + VYSS L+L+L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ
Sbjct  376  ESKTVYSSCLELNLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQ  435

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             K  +F+F+G  A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KT
Sbjct  436  SKAVEFNFNGTTAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKT  495

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+
Sbjct  496  SLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVAS  555

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  556  AVLSGNRNFEGRVHPLTRANYLASPP  581



>gb|ACR36825.1| unknown [Zea mays]
Length=565

 Score =   349 bits (896),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERV+SS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+AVPKE Q
Sbjct  19   ETERVFSSYLELDLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYAVPKEQQ  78

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV KF FHG+PAE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL VKPWVKT
Sbjct  79   GKVVKFDFHGRPAEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEVKPWVKT  138

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SL PGS V T+YL  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++NDIVAA
Sbjct  139  SLTPGSVVATEYLKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITENDIVAA  198

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLS NRNFEGRV+PLTRANYLASPP
Sbjct  199  AVLSANRNFEGRVNPLTRANYLASPP  224



>ref|XP_008344247.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=779

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = +2

Query  47   DVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQPAEL  226
            DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F+FHG PA+L
Sbjct  250  DVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFAVPKESQSKVVEFNFHGTPAQL  309

Query  227  KHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKYLLQ  406
            +HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKYL +
Sbjct  310  RHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKYLQK  369

Query  407  SGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGRVHP  586
            SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAAAVLSGNRNFEGRVHP
Sbjct  370  SGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDLVAAAVLSGNRNFEGRVHP  429

Query  587  LTRANYLASPP  619
            LTRANYLASPP
Sbjct  430  LTRANYLASPP  440



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   360 bits (923),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  451  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKT
Sbjct  511  EEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLEVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+EYL +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ A
Sbjct  571  SLAPGSRVVEKYLDRSGLREYLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPQTRANYLASPP  656



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = +2

Query  5    QERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQE  184
            QER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFAVPKE QE
Sbjct  252  QERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFAVPKEKQE  311

Query  185  KVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTS  364
            +V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ VKPWVKTS
Sbjct  312  EVVKFSYKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEVKPWVKTS  371

Query  365  LAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAA  544
            LAPGS VV KYL +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI   DI+ AA
Sbjct  372  LAPGSRVVEKYLDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEGTDIIPAA  431

Query  545  VLSGNRNFEGRVHPLTRANYLASPP  619
            VLSGNRNFEGRVHP TRANYLASPP
Sbjct  432  VLSGNRNFEGRVHPQTRANYLASPP  456



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  8    ERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEK  187
            ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+K
Sbjct  253  ERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDK  312

Query  188  VAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSL  367
            V KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSL
Sbjct  313  VVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSL  372

Query  368  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAV  547
            APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAV
Sbjct  373  APGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITENDVVAAAV  432

Query  548  LSGNRNFEGR  577
            LSGN     R
Sbjct  433  LSGNDEVMAR  442



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   358 bits (918),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL DVEPC+SGPKRPHDRV LK+MK+DW +CL NKVGFKGF +PKE Q
Sbjct  431  QTERVYSSYLELDLADVEPCVSGPKRPHDRVALKDMKADWRACLRNKVGFKGFGIPKEQQ  490

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +K+ KF+FHGQPAE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PW+KT
Sbjct  491  DKLVKFTFHGQPAEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVNPWIKT  550

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSG VTKYLL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A++DNDI+AA
Sbjct  551  SLAPGSGAVTKYLLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAVTDNDIIAA  610

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGR+H L RANYLASPP
Sbjct  611  AVLSGNRNFEGRIHALVRANYLASPP  636



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   357 bits (916),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL DVEPC+SGPKRPHD V LK+MKSDWHSCL NKVGFKGF VPKE  
Sbjct  435  QTERVYSSYLELDLADVEPCVSGPKRPHDHVALKDMKSDWHSCLGNKVGFKGFGVPKEQH  494

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +K  KF+FHGQPAE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PW+KT
Sbjct  495  DKFVKFTFHGQPAEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVNPWIKT  554

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSG VTKYLL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A++DNDI+AA
Sbjct  555  SLAPGSGAVTKYLLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAVTDNDIIAA  614

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGR+H L RANYLASPP
Sbjct  615  AVLSGNRNFEGRIHALVRANYLASPP  640



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   357 bits (916),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ERVYSS L+LDL DVEPC+SGPKRPHD V LK+MKSDWHSCL NKVGFKGF VPKE  
Sbjct  433  QTERVYSSYLELDLADVEPCVSGPKRPHDHVALKDMKSDWHSCLGNKVGFKGFGVPKEQH  492

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +K  KF+FHGQPAE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PW+KT
Sbjct  493  DKFVKFTFHGQPAEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVNPWIKT  552

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSG VTKYLL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A++DNDI+AA
Sbjct  553  SLAPGSGAVTKYLLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAVTDNDIIAA  612

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGR+H L RANYLASPP
Sbjct  613  AVLSGNRNFEGRIHALVRANYLASPP  638



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   357 bits (915),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 169/206 (82%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERVYSS L+L+L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q
Sbjct  445  EAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQ  504

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVA+F FHG PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KT
Sbjct  505  GKVAEFLFHGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKT  564

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV +YL +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDESVS+AI++NDIV+A
Sbjct  565  SLAPGSGVVKQYLDKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDESVSAAITENDIVSA  624

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  625  AVLSGNRNFEGRVHPLTRANYLASPP  650



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   357 bits (915),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFAVPKE Q
Sbjct  454  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFAVPKEKQ  513

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ VKPWVKT
Sbjct  514  EEVVKFSYKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEVKPWVKT  573

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI   DI+ A
Sbjct  574  SLAPGSRVVEKYLDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEGTDIIPA  633

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  634  AVLSGNRNFEGRVHPQTRANYLASPP  659



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   357 bits (915),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFAVPKE Q
Sbjct  453  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFAVPKEKQ  512

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ VKPWVKT
Sbjct  513  EEVVKFSYKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEVKPWVKT  572

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI   DI+ A
Sbjct  573  SLAPGSRVVEKYLDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEGTDIIPA  632

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  633  AVLSGNRNFEGRVHPQTRANYLASPP  658



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  451  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             +V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL VKPWVKT
Sbjct  511  GEVVKFSYEGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI   DI+ A
Sbjct  571  SLAPGSRVVEKYLDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEGTDIIPA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPQTRANYLASPP  656



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   365 bits (936),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = +2

Query  2     QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
             Q ERVYSS L+LDL +VEPCLSGPKRPHDRV LK MKSDW SCLDNKVGFKGFAVPKE+Q
Sbjct  1422  QAERVYSSYLELDLDEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNKVGFKGFAVPKESQ  1481

Query  182   EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
              KVA+FSF G PA++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA +LGL VKPW+KT
Sbjct  1482  GKVAEFSFRGTPAKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACDLGLEVKPWIKT  1541

Query  362   SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
             SLAPGSGVV KYL +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDESV++AI+DND+VAA
Sbjct  1542  SLAPGSGVVKKYLDKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDESVAAAITDNDVVAA  1601

Query  542   AVLSGNRNFEGRVHPLTRANYLASPP  619
             AVLSGNRNFEGRVH LTRANYLASPP
Sbjct  1602  AVLSGNRNFEGRVHALTRANYLASPP  1627



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   354 bits (908),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + E+VYSS L+LDL  V+PC+SGPKRPHDRV LK+MK DWH+CLD+KVGFKGF VPK+ Q
Sbjct  362  ETEKVYSSYLELDLDSVQPCVSGPKRPHDRVNLKDMKEDWHNCLDSKVGFKGFGVPKDEQ  421

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
              +AKF F G+PAEL+HG VVIAAITSCTNTSNPSVMLGA LVAKKA+ELGL VKPW+KT
Sbjct  422  SAIAKFKFEGKPAELRHGDVVIAAITSCTNTSNPSVMLGAGLVAKKATELGLQVKPWIKT  481

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGL EYL++QGF +VGYGCTTCIGNSG++ E V+SAI+DND++AA
Sbjct  482  SLAPGSGVVTKYLKQSGLTEYLDKQGFSLVGYGCTTCIGNSGEIHEDVASAIADNDMIAA  541

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGR+HPLTRANYLASPP
Sbjct  542  AVLSGNRNFEGRIHPLTRANYLASPP  567



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   354 bits (908),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + E+VYSS L+LDL  V+PC+SGPKRPHDRV LK+MK DWH+CLD+KVGFKGF VPK+ Q
Sbjct  362  ETEKVYSSYLELDLDSVQPCVSGPKRPHDRVNLKDMKEDWHNCLDSKVGFKGFGVPKDEQ  421

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
              +AKF F G+PAEL+HG VVIAAITSCTNTSNPSVMLGA LVAKKA+ELGL VKPW+KT
Sbjct  422  SAIAKFKFEGKPAELRHGDVVIAAITSCTNTSNPSVMLGAGLVAKKATELGLQVKPWIKT  481

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL QSGL EYL++QGF +VGYGCTTCIGNSG++ E V+SAI+DND++AA
Sbjct  482  SLAPGSGVVTKYLKQSGLTEYLDKQGFSLVGYGCTTCIGNSGEIHEDVASAIADNDMIAA  541

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGR+HPLTRANYLASPP
Sbjct  542  AVLSGNRNFEGRIHPLTRANYLASPP  567



>ref|XP_001779205.1| predicted protein [Physcomitrella patens]
 gb|EDQ55968.1| predicted protein, partial [Physcomitrella patens]
Length=896

 Score =   353 bits (907),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            +++  YS+ L+LDL  VEPC+SGPKRPHDRV +K+MK DW SCLDNKVGFKGFA+PK+ Q
Sbjct  353  RKDNTYSAYLELDLDTVEPCISGPKRPHDRVAIKDMKQDWQSCLDNKVGFKGFAIPKDQQ  412

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            EKVAKF++ G+PAEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA+ELGL VKPWVKT
Sbjct  413  EKVAKFTYEGKPAELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKATELGLEVKPWVKT  472

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVVTKYL +SGL +YL++QGF +VGYGCTTCIGNSGD+ E+V+ AI+ ND+VAA
Sbjct  473  SLAPGSGVVTKYLEKSGLNKYLDKQGFSLVGYGCTTCIGNSGDVHEAVAEAIAANDMVAA  532

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  533  AVLSGNRNFEGRVHPLTRANYLASPP  558



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  451  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKT
Sbjct  511  EEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ A
Sbjct  571  SLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPQTRANYLASPP  656



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  451  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             +V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL VKPWVKT
Sbjct  511  GEVVKFSYDGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI   DI+ A
Sbjct  571  SLAPGSRVVEKYLDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEGTDIIPA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPQTRANYLASPP  656



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  451  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKT
Sbjct  511  EEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ A
Sbjct  571  SLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPQTRANYLASPP  656



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  455  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVALKDMKADWHACLDNPVGFKGFAVPKEKQ  514

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+  KFSF GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL VKPWVKT
Sbjct  515  EEFVKFSFKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLEVKPWVKT  574

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+EYL +QGF IVGYGCTTCIGNSGDL++SV++AI  +DI+ A
Sbjct  575  SLAPGSRVVEKYLDRSGLREYLTKQGFEIVGYGCTTCIGNSGDLEKSVAAAIEGSDIIPA  634

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  635  AVLSGNRNFEGRVHPQTRANYLASPP  660



>gb|KJB62827.1| hypothetical protein B456_009G438900 [Gossypium raimondii]
Length=522

 Score =   343 bits (879),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = +2

Query  74   KRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQPAELKHGSVVIAA  253
            +RPHDRVPLKEMK+DWH+CLDN VGFKGFAVPKE Q KVAKF+FHG PAEL+HGSVVIAA
Sbjct  79   RRPHDRVPLKEMKADWHACLDNNVGFKGFAVPKEEQNKVAKFTFHGLPAELRHGSVVIAA  138

Query  254  ITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQ  433
            ITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKYLL+SGLQ+YLNQ
Sbjct  139  ITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKTSLAPGSGVVTKYLLRSGLQKYLNQ  198

Query  434  QGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGRVHPLTRANYLAS  613
            QGF++VGY CTTCIGNSG+LDESV+S IS+NDI+AAAVLSGNRNFEGRVHPLTRANYLAS
Sbjct  199  QGFNLVGYDCTTCIGNSGELDESVASGISENDIIAAAVLSGNRNFEGRVHPLTRANYLAS  258

Query  614  PP  619
            PP
Sbjct  259  PP  260



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  451  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             +V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL VKPWVKT
Sbjct  511  GEVVKFSYDGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI   +I+ A
Sbjct  571  SLAPGSRVVEKYLDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEGTEIIPA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPQTRANYLASPP  656



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            +QER Y+S LQL+L  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  363  KQERAYTSYLQLELGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  422

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+V KFS++GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKT
Sbjct  423  EEVVKFSYNGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKVKPWVKT  482

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ A
Sbjct  483  SLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPA  542

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  543  AVLSGNRNFEGRVHPQTRANYLASPP  568



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + E VYS SL+L L DVEPC+SGPKRPHDRVPL++MK+DW +CL+N++GFKGFA+PKEAQ
Sbjct  356  RDEIVYSCSLELKLEDVEPCISGPKRPHDRVPLRDMKADWGTCLNNRLGFKGFAIPKEAQ  415

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV  F F G  A+L+HG+VVIAAITSCTNTSNPSV+LGAALVAKKA ELGL VKPW+KT
Sbjct  416  NKVVNFVFRGTRAQLRHGAVVIAAITSCTNTSNPSVVLGAALVAKKAYELGLEVKPWIKT  475

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGSGVV KYL +SGL++YLNQ GFHIV YGCTTCIGNSGD+DESV+SAI++ND+VAA
Sbjct  476  SLAPGSGVVAKYLQKSGLEKYLNQLGFHIVAYGCTTCIGNSGDIDESVASAIAENDLVAA  535

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  536  AVLSGNRNFEGRVHPLTRANYLASPP  561



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   353 bits (905),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQER Y+S LQLDL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDN VGFKGFA+PKE Q
Sbjct  454  QQERAYTSYLQLDLGHVEPCISGPKRPHDRVLLKDMKADWHACLDNPVGFKGFAIPKEKQ  513

Query  182  EKVAKFSFHGQ-PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVK  358
            E   KF F  + PAELK+GSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPWVK
Sbjct  514  EDTVKFLFEEKIPAELKNGSVVIAAITSCTNTSNPSVMLGAALVAKKAYDLGLMVKPWVK  573

Query  359  TSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVA  538
            TSLAPGSGVVTKYL QSGLQEYL++QGF IVGYGCTTCIGNSG+L +SV SAI +ND+V 
Sbjct  574  TSLAPGSGVVTKYLDQSGLQEYLDKQGFQIVGYGCTTCIGNSGNLKKSVESAIKNNDVVV  633

Query  539  AAVLSGNRNFEGRVHPLTRANYLASPP  619
            A+VLSGNRNFEGRVHPLTRANYLASPP
Sbjct  634  ASVLSGNRNFEGRVHPLTRANYLASPP  660



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   351 bits (901),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 184/200 (92%), Gaps = 5/200 (3%)
 Frame = +2

Query  20   SSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKF  199
            ++ + +D  +V  C+     PHDRV LKEMK DWH+CLDNKVGFKGFAVPKEAQ+KVAKF
Sbjct  405  ANKMFVDYSEVMVCV-----PHDRVALKEMKVDWHACLDNKVGFKGFAVPKEAQDKVAKF  459

Query  200  SFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGS  379
            SFHGQPAELKHGS+VIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGS
Sbjct  460  SFHGQPAELKHGSIVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWVKTSLAPGS  519

Query  380  GVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGN  559
            GVVTKYLLQSGLQ+YLN+QGF+IVGYGCTTCIGNSG+LDESV SAI++NDIVAAAVLSGN
Sbjct  520  GVVTKYLLQSGLQKYLNEQGFNIVGYGCTTCIGNSGELDESVGSAITENDIVAAAVLSGN  579

Query  560  RNFEGRVHPLTRANYLASPP  619
            RNFEGRVHPLTRANYLASPP
Sbjct  580  RNFEGRVHPLTRANYLASPP  599



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 187/210 (89%), Gaps = 4/210 (2%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRP----HDRVPLKEMKSDWHSCLDNKVGFKGFAVP  169
            Q ERVYSS L+L+L +VEPC+SGPKRP    HDRV LKEMK DWH+CLDN+VGFKGFAVP
Sbjct  354  QVERVYSSYLELNLNEVEPCISGPKRPTTRPHDRVTLKEMKVDWHACLDNRVGFKGFAVP  413

Query  170  KEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKP  349
            KE+Q KV +F+FHG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKP
Sbjct  414  KESQNKVVEFAFHGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKP  473

Query  350  WVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDND  529
            W+KT L    GVVTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+D++V+SAI++ND
Sbjct  474  WIKTVLLRVLGVVTKYLQKSGLQQYLNQLGFIIVGYGCTTCIGNSGDIDDAVASAITEND  533

Query  530  IVAAAVLSGNRNFEGRVHPLTRANYLASPP  619
            IVAAAVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  534  IVAAAVLSGNRNFEGRVHPLTRANYLASPP  563



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score =   349 bits (896),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERV+SS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+AVPKE Q
Sbjct  359  ETERVFSSYLELDLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYAVPKEQQ  418

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV KF FHG+PAE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL VKPWVKT
Sbjct  419  GKVVKFDFHGRPAEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEVKPWVKT  478

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SL PGS V T+YL  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++NDIVAA
Sbjct  479  SLTPGSVVATEYLKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITENDIVAA  538

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLS NRNFEGRV+PLTRANYLASPP
Sbjct  539  AVLSANRNFEGRVNPLTRANYLASPP  564



>gb|EEE65577.1| hypothetical protein OsJ_21080 [Oryza sativa Japonica Group]
Length=684

 Score =   343 bits (881),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
              ERVYSS L+L+L+DVEPC+SGPKRPHDRVPLKEMKSDWH+CLD++VGFKGFAVP+E Q
Sbjct  236  HTERVYSSYLELNLIDVEPCISGPKRPHDRVPLKEMKSDWHACLDSRVGFKGFAVPRECQ  295

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            +KV KF F GQPAE+KHGSVV+AAI S TNTSNPSV++GA LVAKKA ELGL VKPWVKT
Sbjct  296  DKVVKFDFQGQPAEIKHGSVVLAAICSSTNTSNPSVIVGAGLVAKKACELGLEVKPWVKT  355

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            S   GS V  +YL  S LQ+YLNQQGFH+  +GC TC+GNSGDLDESVS+AI++NDIV+ 
Sbjct  356  SFTHGSAVTREYLKHSHLQDYLNQQGFHLAAFGCATCVGNSGDLDESVSAAITENDIVSV  415

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLS NRNFEGRVHPLTRANYLASPP
Sbjct  416  AVLSANRNFEGRVHPLTRANYLASPP  441



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   351 bits (900),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 183/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            Q ER Y+S LQLDL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q
Sbjct  451  QPERAYTSYLQLDLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQ  510

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
            E+V KFS+ GQPAE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LG+ VKPWVKT
Sbjct  511  EEVVKFSYKGQPAEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALDLGVEVKPWVKT  570

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLAPGS VV KYL +SGL+E LN+QGF IVGYGCTTCIGNSGDL+  V+SAI   DI+ A
Sbjct  571  SLAPGSRVVEKYLDRSGLRECLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEGTDIIPA  630

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLSGNRNFEGRVHP TRANYLASPP
Sbjct  631  AVLSGNRNFEGRVHPQTRANYLASPP  656



>gb|KEH38306.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=865

 Score =   348 bits (893),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/206 (83%), Positives = 184/206 (89%), Gaps = 6/206 (3%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            QQ+  YSS L+L+L +V         PHDRVPLKEMKSDWHSCLDNKVGFKGFA+PKEAQ
Sbjct  451  QQDIAYSSYLELNLDEVRTI------PHDRVPLKEMKSDWHSCLDNKVGFKGFAIPKEAQ  504

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPWVKT
Sbjct  505  GKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLKVKPWVKT  564

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SLA GSGVVTKYLLQSGLQ+YLN+QGF+ V +GCTTCIGNSGDLDESV+SAIS+NDIVA+
Sbjct  565  SLALGSGVVTKYLLQSGLQKYLNEQGFNFVRFGCTTCIGNSGDLDESVASAISENDIVAS  624

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLS NRNFEGRVHPLTRANYLASPP
Sbjct  625  AVLSRNRNFEGRVHPLTRANYLASPP  650



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = +2

Query  2    QQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQ  181
            + ERV+SS L+LDL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+AVPKE Q
Sbjct  358  ETERVFSSHLELDLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYAVPKEQQ  417

Query  182  EKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKT  361
             KV KF FHG+PAE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL VKPWVKT
Sbjct  418  GKVVKFDFHGRPAEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEVKPWVKT  477

Query  362  SLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAA  541
            SL PGS V T+YL  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++ND+VAA
Sbjct  478  SLTPGSVVATEYLKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITENDMVAA  537

Query  542  AVLSGNRNFEGRVHPLTRANYLASPP  619
            AVLS NRNFEGRV+PLTRANYLASPP
Sbjct  538  AVLSANRNFEGRVNPLTRANYLASPP  563



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520