BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS139D03

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796447.1|  PREDICTED: monosaccharide-sensing protein 2-...    265   4e-80   Nicotiana sylvestris
ref|XP_006342166.1|  PREDICTED: monosaccharide-sensing protein 2-...    265   4e-80   Solanum tuberosum [potatoes]
ref|NP_001289848.1|  monosaccharide-sensing protein 2                   264   8e-80   Solanum lycopersicum
ref|XP_011074068.1|  PREDICTED: monosaccharide-sensing protein 2-...    264   1e-79   Sesamum indicum [beniseed]
ref|XP_009595864.1|  PREDICTED: monosaccharide-sensing protein 2        264   1e-79   Nicotiana tomentosiformis
gb|KDO85211.1|  hypothetical protein CISIN_1g004673mg                   260   2e-79   Citrus sinensis [apfelsine]
ref|XP_011100175.1|  PREDICTED: monosaccharide-sensing protein 2-...    260   3e-78   Sesamum indicum [beniseed]
gb|KDO85208.1|  hypothetical protein CISIN_1g004673mg                   259   4e-78   Citrus sinensis [apfelsine]
ref|XP_006435423.1|  hypothetical protein CICLE_v10000400mg             259   6e-78   Citrus clementina [clementine]
ref|XP_010094525.1|  Monosaccharide-sensing protein 2                   259   8e-78   Morus notabilis
ref|XP_003527273.1|  PREDICTED: monosaccharide-sensing protein 2-...    258   3e-77   Glycine max [soybeans]
gb|KJB14183.1|  hypothetical protein B456_002G113400                    253   4e-77   Gossypium raimondii
gb|KHN33775.1|  Monosaccharide-sensing protein 2                        257   4e-77   Glycine soja [wild soybean]
ref|XP_006577928.1|  PREDICTED: monosaccharide-sensing protein 2-...    257   5e-77   Glycine max [soybeans]
gb|KJB14182.1|  hypothetical protein B456_002G113400                    253   5e-77   Gossypium raimondii
ref|XP_007135975.1|  hypothetical protein PHAVU_009G007600g             257   5e-77   Phaseolus vulgaris [French bean]
ref|XP_007018122.1|  Tonoplast monosaccharide transporter2 isoform 4    256   2e-76   
ref|XP_007018119.1|  Tonoplast monosaccharide transporter2 isoform 1    255   2e-76   
emb|CDP07261.1|  unnamed protein product                                255   2e-76   Coffea canephora [robusta coffee]
ref|XP_010061214.1|  PREDICTED: monosaccharide-sensing protein 2-...    255   3e-76   Eucalyptus grandis [rose gum]
gb|KHG10189.1|  Monosaccharide-sensing 2 -like protein                  254   5e-76   Gossypium arboreum [tree cotton]
dbj|BAK00015.1|  predicted protein                                      240   6e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP36756.1|  hypothetical protein JCGZ_08047                         253   1e-75   Jatropha curcas
gb|KJB14177.1|  hypothetical protein B456_002G113400                    252   4e-75   Gossypium raimondii
ref|XP_002510716.1|  sugar transporter, putative                        250   2e-74   Ricinus communis
ref|XP_003603868.1|  Monosaccharide-sensing protein                     249   2e-74   Medicago truncatula
gb|EAY85098.1|  hypothetical protein OsI_06450                          247   1e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_004500833.1|  PREDICTED: monosaccharide-sensing protein 2-...    247   2e-73   Cicer arietinum [garbanzo]
gb|EAZ22316.1|  hypothetical protein OsJ_05971                          248   3e-73   Oryza sativa Japonica Group [Japonica rice]
emb|CBI21577.3|  unnamed protein product                                244   3e-73   Vitis vinifera
emb|CBI40753.3|  unnamed protein product                                245   4e-73   Vitis vinifera
emb|CAN59780.1|  hypothetical protein VITISV_024656                     246   8e-73   Vitis vinifera
ref|NP_001267873.1|  hexose transporter-like                            246   8e-73   Vitis vinifera
ref|XP_004300112.1|  PREDICTED: monosaccharide-sensing protein 2        246   9e-73   Fragaria vesca subsp. vesca
gb|AAX47312.1|  hexose transporter 6                                    246   9e-73   Vitis vinifera
emb|CDY31497.1|  BnaC05g16060D                                          243   9e-73   Brassica napus [oilseed rape]
gb|EYU43534.1|  hypothetical protein MIMGU_mgv1a001953mg                245   1e-72   Erythranthe guttata [common monkey flower]
ref|XP_011034826.1|  PREDICTED: monosaccharide-sensing protein 2-...    245   1e-72   Populus euphratica
ref|XP_002276373.1|  PREDICTED: monosaccharide-sensing protein 2        245   1e-72   Vitis vinifera
ref|XP_010539774.1|  PREDICTED: monosaccharide-sensing protein 1-...    244   2e-72   Tarenaya hassleriana [spider flower]
dbj|BAJ33724.1|  unnamed protein product                                244   2e-72   Eutrema halophilum
ref|XP_006416357.1|  hypothetical protein EUTSA_v10006916mg             244   2e-72   Eutrema salsugineum [saltwater cress]
ref|XP_010537220.1|  PREDICTED: monosaccharide-sensing protein 1-...    244   2e-72   Tarenaya hassleriana [spider flower]
emb|CDY29502.1|  BnaA06g14680D                                          243   3e-72   Brassica napus [oilseed rape]
ref|XP_009149562.1|  PREDICTED: monosaccharide-sensing protein 1        243   4e-72   Brassica rapa
ref|NP_001046359.1|  Os02g0229400                                       243   6e-72   
gb|EMS49950.1|  Monosaccharide-sensing protein 2                        242   9e-72   Triticum urartu
ref|XP_010686712.1|  PREDICTED: monosaccharide-sensing protein 2        243   1e-71   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY33650.1|  BnaC08g19500D                                          242   1e-71   Brassica napus [oilseed rape]
ref|XP_002307812.1|  hypothetical protein POPTR_0005s27680g             243   1e-71   Populus trichocarpa [western balsam poplar]
ref|XP_003571780.1|  PREDICTED: monosaccharide-sensing protein 2-...    243   1e-71   Brachypodium distachyon [annual false brome]
ref|XP_002300629.1|  hypothetical protein POPTR_0002s00760g             243   1e-71   Populus trichocarpa [western balsam poplar]
gb|AIQ77649.1|  tonoplastic transporter 1                               242   1e-71   Vitis vinifera
ref|XP_009390770.1|  PREDICTED: monosaccharide-sensing protein 2-...    242   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011041174.1|  PREDICTED: monosaccharide-sensing protein 2-...    242   2e-71   Populus euphratica
ref|XP_009397963.1|  PREDICTED: monosaccharide-sensing protein 2-...    242   2e-71   
gb|EMT06669.1|  Monosaccharide-sensing protein 2                        243   2e-71   
dbj|BAJ89532.1|  predicted protein                                      242   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDI66591.1|  putative sugar transporter type 2a protein             241   3e-71   Saccharum hybrid cultivar R570
emb|CDI66586.1|  putative sugar transporter type 2a protein             241   4e-71   Saccharum hybrid cultivar R570
ref|XP_008373385.1|  PREDICTED: monosaccharide-sensing protein 2-...    241   4e-71   
ref|XP_010063149.1|  PREDICTED: monosaccharide-sensing protein 2-...    241   4e-71   Eucalyptus grandis [rose gum]
ref|XP_006647093.1|  PREDICTED: monosaccharide-sensing protein 2-...    241   7e-71   Oryza brachyantha
ref|XP_008351570.1|  PREDICTED: monosaccharide-sensing protein 2-...    226   8e-71   
ref|XP_010909820.1|  PREDICTED: monosaccharide-sensing protein 2-...    240   8e-71   Elaeis guineensis
ref|XP_009110209.1|  PREDICTED: monosaccharide-sensing protein 1        240   9e-71   Brassica rapa
emb|CAA90628.1|  sugar transporter                                      240   9e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDX96618.1|  BnaA08g21610D                                          240   1e-70   
ref|XP_009372620.1|  PREDICTED: monosaccharide-sensing protein 2        240   1e-70   Pyrus x bretschneideri [bai li]
gb|AAD30608.1|AC007369_18  Sugar transporter                            240   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173508.1|  tonoplast monosaccharide transporter1                 239   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306868.1|  hypothetical protein CARUB_v10008415mg             239   1e-70   
ref|XP_002893133.1|  hypothetical protein ARALYDRAFT_472320             239   2e-70   
gb|AAP54842.2|  hexose transporter, putative, expressed                 232   3e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477336.1|  PREDICTED: monosaccharide-sensing protein 1        238   6e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006855646.1|  hypothetical protein AMTR_s00044p00110510          238   9e-70   
ref|XP_010029562.1|  PREDICTED: monosaccharide-sensing protein 2-...    237   1e-69   Eucalyptus grandis [rose gum]
ref|XP_008242106.1|  PREDICTED: monosaccharide-sensing protein 2-...    237   1e-69   Prunus mume [ume]
ref|XP_009401004.1|  PREDICTED: monosaccharide-sensing protein 2-...    237   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007204446.1|  hypothetical protein PRUPE_ppa026426mg             237   2e-69   Prunus persica
ref|XP_008778122.1|  PREDICTED: monosaccharide-sensing protein 2-...    237   2e-69   
ref|XP_010940242.1|  PREDICTED: monosaccharide-sensing protein 2-...    236   4e-69   Elaeis guineensis
gb|EMS63940.1|  Monosaccharide-sensing protein 2                        236   5e-69   Triticum urartu
gb|EMT29091.1|  Monosaccharide-sensing protein 2                        236   5e-69   
ref|XP_010906859.1|  PREDICTED: monosaccharide-sensing protein 2-...    232   6e-69   
ref|XP_010266258.1|  PREDICTED: monosaccharide-sensing protein 2 ...    234   6e-69   
gb|KJB79727.1|  hypothetical protein B456_013G064200                    232   1e-68   Gossypium raimondii
ref|XP_004951395.1|  PREDICTED: monosaccharide-sensing protein 2-...    234   1e-68   Setaria italica
ref|XP_006364349.1|  PREDICTED: monosaccharide-sensing protein 2-...    222   2e-68   
ref|XP_008237926.1|  PREDICTED: monosaccharide-sensing protein 2        234   2e-68   Prunus mume [ume]
dbj|BAJ90138.1|  predicted protein                                      234   3e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAD58958.1|  hexose transporter                                     234   3e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010266257.1|  PREDICTED: monosaccharide-sensing protein 2 ...    233   5e-68   Nelumbo nucifera [Indian lotus]
ref|XP_011000869.1|  PREDICTED: monosaccharide-sensing protein 2-...    232   9e-68   Populus euphratica
ref|XP_002467580.1|  hypothetical protein SORBIDRAFT_01g030430          232   1e-67   Sorghum bicolor [broomcorn]
gb|EEC67373.1|  hypothetical protein OsI_34495                          232   1e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001065182.1|  Os10g0539900                                       232   1e-67   
gb|KJB79728.1|  hypothetical protein B456_013G064200                    232   1e-67   Gossypium raimondii
ref|XP_007142576.1|  hypothetical protein PHAVU_008G292400g             231   1e-67   Phaseolus vulgaris [French bean]
gb|KHG05233.1|  Monosaccharide-sensing 2 -like protein                  231   1e-67   Gossypium arboreum [tree cotton]
ref|XP_007210337.1|  hypothetical protein PRUPE_ppa001932mg             231   2e-67   Prunus persica
ref|XP_010680636.1|  PREDICTED: monosaccharide-sensing protein 2-...    231   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003574265.1|  PREDICTED: monosaccharide-sensing protein 2-...    231   3e-67   Brachypodium distachyon [annual false brome]
ref|XP_002520608.1|  sugar transporter, putative                        229   8e-67   Ricinus communis
gb|AJO70165.1|  tonoplast monosaccharide transporters 1                 229   1e-66   Camellia sinensis [black tea]
emb|CDP14489.1|  unnamed protein product                                229   1e-66   Coffea canephora [robusta coffee]
ref|XP_008645619.1|  PREDICTED: monosaccharide-sensing protein 2-...    229   1e-66   Zea mays [maize]
gb|EPS65490.1|  hypothetical protein M569_09283                         229   1e-66   Genlisea aurea
gb|EMT28528.1|  Monosaccharide-sensing protein 3                        225   2e-66   
ref|XP_010548175.1|  PREDICTED: monosaccharide-sensing protein 2        229   2e-66   Tarenaya hassleriana [spider flower]
gb|KDP47010.1|  hypothetical protein JCGZ_10737                         228   3e-66   Jatropha curcas
ref|XP_002312798.1|  transporter-related family protein                 228   3e-66   
ref|XP_007043079.1|  Tonoplast monosaccharide transporter2              228   4e-66   
ref|XP_008349018.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   5e-66   
ref|NP_195256.3|  monosaccharide-sensing protein 2                      227   7e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151936.1|  LOC100285573                                       227   8e-66   Zea mays [maize]
ref|XP_004144248.1|  PREDICTED: monosaccharide-sensing protein 2-...    227   8e-66   Cucumis sativus [cucumbers]
gb|KDO68405.1|  hypothetical protein CISIN_1g004750mg                   224   8e-66   Citrus sinensis [apfelsine]
gb|KJB77474.1|  hypothetical protein B456_012G139000                    225   8e-66   Gossypium raimondii
gb|AAO37640.1|  putative sugar transporter type 2a                      227   8e-66   Saccharum hybrid cultivar Q117
ref|XP_006384856.1|  transporter-related family protein                 227   9e-66   
ref|NP_849565.1|  monosaccharide-sensing protein 2                      227   9e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090703.1|  Monosaccharide-sensing protein 2                   227   9e-66   Morus notabilis
ref|XP_002867077.1|  hypothetical protein ARALYDRAFT_491117             226   1e-65   
ref|XP_006283193.1|  hypothetical protein CARUB_v10004225mg             226   1e-65   Capsella rubella
ref|NP_001190054.1|  tonoplast monosaccharide transporter3              226   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007201798.1|  hypothetical protein PRUPE_ppa001957mg             226   1e-65   Prunus persica
ref|NP_190717.1|  tonoplast monosaccharide transporter3                 226   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235816.1|  PREDICTED: monosaccharide-sensing protein 2        226   2e-65   Prunus mume [ume]
gb|KFK34392.1|  hypothetical protein AALP_AA5G139300                    226   2e-65   Arabis alpina [alpine rockcress]
emb|CBI37732.3|  unnamed protein product                                224   2e-65   Vitis vinifera
ref|XP_008464819.1|  PREDICTED: monosaccharide-sensing protein 2-...    225   3e-65   Cucumis melo [Oriental melon]
ref|XP_009763350.1|  PREDICTED: monosaccharide-sensing protein 2-...    225   3e-65   Nicotiana sylvestris
ref|XP_008812559.1|  PREDICTED: monosaccharide-sensing protein 2-...    225   3e-65   Phoenix dactylifera
gb|AFP89954.1|  tonoplastic transporter 2                               225   3e-65   Vitis vinifera
ref|XP_009333794.1|  PREDICTED: monosaccharide-sensing protein 2-...    225   3e-65   
ref|XP_002282975.1|  PREDICTED: monosaccharide-sensing protein 2        225   3e-65   Vitis vinifera
ref|XP_002877807.1|  predicted protein                                  225   4e-65   
emb|CAN80213.1|  hypothetical protein VITISV_042076                     225   4e-65   Vitis vinifera
ref|XP_009341490.1|  PREDICTED: monosaccharide-sensing protein 2-...    225   4e-65   Pyrus x bretschneideri [bai li]
ref|XP_009103100.1|  PREDICTED: monosaccharide-sensing protein 2        225   4e-65   
gb|KJB77472.1|  hypothetical protein B456_012G139000                    225   5e-65   Gossypium raimondii
gb|AIN39841.1|  hypothetical protein                                    224   6e-65   Zoysia matrella [Japanese carpet grass]
gb|KJB12352.1|  hypothetical protein B456_002G014400                    222   6e-65   Gossypium raimondii
ref|XP_006486570.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   6e-65   Citrus sinensis [apfelsine]
ref|XP_006422393.1|  hypothetical protein CICLE_v10027893mg             224   7e-65   
gb|KDO68402.1|  hypothetical protein CISIN_1g004750mg                   224   7e-65   Citrus sinensis [apfelsine]
gb|KCW64229.1|  hypothetical protein EUGRSUZ_G01880                     224   7e-65   Eucalyptus grandis [rose gum]
ref|XP_010066352.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   7e-65   Eucalyptus grandis [rose gum]
ref|XP_010678631.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   1e-64   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX69128.1|  BnaC01g03250D                                          223   1e-64   
ref|XP_009392211.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004983796.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   1e-64   Setaria italica
ref|XP_009340799.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   1e-64   Pyrus x bretschneideri [bai li]
gb|KHG04801.1|  Monosaccharide-sensing protein 2                        223   1e-64   Gossypium arboreum [tree cotton]
emb|CDY65623.1|  BnaCnng48010D                                          223   2e-64   Brassica napus [oilseed rape]
ref|XP_009608796.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   2e-64   Nicotiana tomentosiformis
emb|CDP01766.1|  unnamed protein product                                222   3e-64   Coffea canephora [robusta coffee]
gb|KJB12354.1|  hypothetical protein B456_002G014400                    222   5e-64   Gossypium raimondii
gb|KJB12351.1|  hypothetical protein B456_002G014400                    222   6e-64   Gossypium raimondii
ref|XP_010270527.1|  PREDICTED: monosaccharide-sensing protein 2        222   6e-64   Nelumbo nucifera [Indian lotus]
ref|XP_011099908.1|  PREDICTED: monosaccharide-sensing protein 2-...    221   7e-64   Sesamum indicum [beniseed]
ref|XP_011040809.1|  PREDICTED: monosaccharide-sensing protein 2-...    221   8e-64   Populus euphratica
ref|XP_010446942.1|  PREDICTED: monosaccharide-sensing protein 2        221   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010437493.1|  PREDICTED: monosaccharide-sensing protein 2-...    221   1e-63   
ref|XP_011098017.1|  PREDICTED: monosaccharide-sensing protein 2-...    220   1e-63   Sesamum indicum [beniseed]
ref|XP_010432297.1|  PREDICTED: monosaccharide-sensing protein 2-...    220   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009359631.1|  PREDICTED: monosaccharide-sensing protein 2-...    221   2e-63   
ref|XP_006412119.1|  hypothetical protein EUTSA_v10024517mg             220   2e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009359629.1|  PREDICTED: monosaccharide-sensing protein 2-...    220   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_009359630.1|  PREDICTED: monosaccharide-sensing protein 2-...    220   2e-63   
gb|KHN33643.1|  Monosaccharide-sensing protein 2                        219   4e-63   Glycine soja [wild soybean]
ref|XP_003543932.1|  PREDICTED: monosaccharide-sensing protein 2-...    219   4e-63   
ref|XP_004289029.1|  PREDICTED: monosaccharide-sensing protein 2-...    220   4e-63   Fragaria vesca subsp. vesca
ref|XP_011022133.1|  PREDICTED: monosaccharide-sensing protein 2-...    219   4e-63   Populus euphratica
ref|XP_002306419.1|  hypothetical protein POPTR_0005s10180g             219   5e-63   
dbj|BAI94493.1|  sugar transporter                                      219   5e-63   Dianthus caryophyllus [carnation]
ref|XP_009776539.1|  PREDICTED: monosaccharide-sensing protein 2-...    219   5e-63   Nicotiana sylvestris
ref|XP_008382498.1|  PREDICTED: monosaccharide-sensing protein 2-...    218   9e-63   
ref|XP_003526737.1|  PREDICTED: monosaccharide-sensing protein 2-...    218   2e-62   Glycine max [soybeans]
ref|XP_004139974.1|  PREDICTED: monosaccharide-sensing protein 2-...    217   2e-62   
ref|NP_001067890.1|  Os11g0475600                                       218   3e-62   
gb|EAY80902.1|  hypothetical protein OsI_36080                          217   3e-62   Oryza sativa Indica Group [Indian rice]
gb|EYU30848.1|  hypothetical protein MIMGU_mgv1a001984mg                216   5e-62   Erythranthe guttata [common monkey flower]
ref|XP_009622210.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   7e-62   Nicotiana tomentosiformis
ref|NP_001280690.1|  monosaccharide-sensing protein 2-like              216   7e-62   Solanum lycopersicum
ref|XP_009775817.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   7e-62   Nicotiana sylvestris
ref|XP_009589978.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   7e-62   Nicotiana tomentosiformis
ref|XP_008448165.1|  PREDICTED: monosaccharide-sensing protein 2        216   8e-62   Cucumis melo [Oriental melon]
ref|XP_006343319.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   8e-62   Solanum tuberosum [potatoes]
ref|XP_007137297.1|  hypothetical protein PHAVU_009G115500g             216   9e-62   Phaseolus vulgaris [French bean]
ref|XP_010690557.1|  PREDICTED: monosaccharide-sensing protein 2        216   9e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008377843.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   1e-61   
ref|XP_004154526.1|  PREDICTED: monosaccharide-sensing protein 2-...    215   2e-61   
gb|KHN46863.1|  Monosaccharide-sensing protein 2                        213   5e-61   Glycine soja [wild soybean]
ref|XP_004500684.1|  PREDICTED: monosaccharide-sensing protein 2-...    212   2e-60   
ref|XP_003560303.1|  PREDICTED: monosaccharide-sensing protein 2-...    212   3e-60   Brachypodium distachyon [annual false brome]
ref|XP_004954530.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   4e-60   Setaria italica
gb|KGN49001.1|  hypothetical protein Csa_6G509700                       211   5e-60   
ref|XP_003518591.1|  PREDICTED: monosaccharide-sensing protein 2-...    210   1e-59   Glycine max [soybeans]
gb|EYU40481.1|  hypothetical protein MIMGU_mgv1a001997mg                209   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_010028861.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    209   3e-59   
ref|XP_004134823.1|  PREDICTED: monosaccharide-sensing protein 2-...    207   1e-58   
ref|XP_008440928.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    206   2e-58   
ref|XP_006403910.1|  hypothetical protein EUTSA_v10011113mg             206   3e-58   Eutrema salsugineum [saltwater cress]
ref|XP_004289030.1|  PREDICTED: monosaccharide-sensing protein 2        206   3e-58   Fragaria vesca subsp. vesca
ref|XP_004169167.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    206   4e-58   
ref|XP_009148978.1|  PREDICTED: monosaccharide-sensing protein 3        205   6e-58   Brassica rapa
gb|KJB31963.1|  hypothetical protein B456_005G216600                    205   6e-58   Gossypium raimondii
ref|XP_006292750.1|  hypothetical protein CARUB_v10018997mg             205   7e-58   
ref|XP_010097645.1|  Monosaccharide-sensing protein 3                   205   7e-58   Morus notabilis
emb|CDY33276.1|  BnaA01g19430D                                          204   8e-58   Brassica napus [oilseed rape]
ref|XP_010515555.1|  PREDICTED: monosaccharide-sensing protein 3        204   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010503840.1|  PREDICTED: monosaccharide-sensing protein 3-...    204   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010426703.1|  PREDICTED: monosaccharide-sensing protein 3-...    204   1e-57   Camelina sativa [gold-of-pleasure]
emb|CDX78009.1|  BnaA09g32040D                                          203   2e-57   
emb|CDY16303.1|  BnaC01g23380D                                          203   2e-57   Brassica napus [oilseed rape]
ref|XP_004290074.1|  PREDICTED: monosaccharide-sensing protein 2        203   3e-57   Fragaria vesca subsp. vesca
ref|XP_009115837.1|  PREDICTED: monosaccharide-sensing protein 3        203   3e-57   Brassica rapa
emb|CDX73717.1|  BnaC08g22860D                                          203   3e-57   
gb|KDP43790.1|  hypothetical protein JCGZ_22417                         202   5e-57   Jatropha curcas
gb|EPS57524.1|  hypothetical protein M569_17293                         202   6e-57   Genlisea aurea
ref|XP_009359632.1|  PREDICTED: monosaccharide-sensing protein 2-...    202   8e-57   Pyrus x bretschneideri [bai li]
ref|XP_010029563.1|  PREDICTED: monosaccharide-sensing protein 2-...    202   8e-57   Eucalyptus grandis [rose gum]
gb|KHG14026.1|  Monosaccharide-sensing 2 -like protein                  202   9e-57   Gossypium arboreum [tree cotton]
ref|XP_008786687.1|  PREDICTED: monosaccharide-sensing protein 2-...    201   2e-56   Phoenix dactylifera
ref|XP_002532480.1|  sugar transporter, putative                        197   5e-56   
ref|XP_004978456.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   6e-56   
ref|XP_007203009.1|  hypothetical protein PRUPE_ppa017631mg             199   8e-56   Prunus persica
ref|XP_008242155.1|  PREDICTED: monosaccharide-sensing protein 2-...    199   9e-56   Prunus mume [ume]
gb|KHN20087.1|  Monosaccharide-sensing protein 2                        191   5e-53   Glycine soja [wild soybean]
ref|XP_004964709.1|  PREDICTED: monosaccharide-sensing protein 2-...    191   6e-53   Setaria italica
gb|KEH36403.1|  tonoplast monosaccharide transporter 2                  190   8e-53   Medicago truncatula
gb|EMS60524.1|  Monosaccharide-sensing protein 3                        186   1e-52   Triticum urartu
ref|XP_002439068.1|  hypothetical protein SORBIDRAFT_10g031000          190   1e-52   Sorghum bicolor [broomcorn]
ref|XP_003604104.1|  Monosaccharide-sensing protein                     189   2e-52   Medicago truncatula
ref|XP_006649210.1|  PREDICTED: monosaccharide-sensing protein 2-...    188   5e-52   
dbj|BAK02857.1|  predicted protein                                      189   5e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002453100.1|  hypothetical protein SORBIDRAFT_04g038460          186   6e-52   
gb|KHN19961.1|  Monosaccharide-sensing protein 2                        188   9e-52   Glycine soja [wild soybean]
ref|NP_001147067.1|  hexose transporter                                 187   1e-51   Zea mays [maize]
gb|ACG25339.1|  hexose transporter                                      187   1e-51   Zea mays [maize]
gb|EAY88138.1|  hypothetical protein OsI_09573                          186   3e-51   Oryza sativa Indica Group [Indian rice]
dbj|BAD23011.1|  putative hexose transporter                            186   4e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003537696.1|  PREDICTED: monosaccharide-sensing protein 2-...    186   5e-51   Glycine max [soybeans]
ref|XP_003517121.1|  PREDICTED: monosaccharide-sensing protein 2-...    186   6e-51   
ref|XP_003603869.1|  Monosaccharide-sensing protein                     183   5e-50   
ref|XP_003573173.1|  PREDICTED: monosaccharide-sensing protein 2-...    182   9e-50   Brachypodium distachyon [annual false brome]
ref|XP_007156262.1|  hypothetical protein PHAVU_003G271500g             181   2e-49   Phaseolus vulgaris [French bean]
gb|KJB14185.1|  hypothetical protein B456_002G113400                    179   8e-49   Gossypium raimondii
gb|EYU43535.1|  hypothetical protein MIMGU_mgv1a002513mg                179   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_007158028.1|  hypothetical protein PHAVU_002G118100g             178   2e-48   Phaseolus vulgaris [French bean]
ref|XP_006662557.1|  PREDICTED: monosaccharide-sensing protein 2-...    177   4e-48   
ref|XP_003629095.1|  Monosaccharide-sensing protein                     176   1e-47   
ref|XP_004509464.1|  PREDICTED: monosaccharide-sensing protein 2-...    173   1e-46   Cicer arietinum [garbanzo]
gb|KHG00737.1|  Monosaccharide-sensing 2 -like protein                  172   3e-46   Gossypium arboreum [tree cotton]
dbj|BAA85398.1|  unnamed protein product                                172   4e-46   Oryza sativa Japonica Group [Japonica rice]
gb|AAN17390.1|  Putative sugar transporter protein                      172   4e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562146.1|  PREDICTED: monosaccharide-sensing protein 2-...    171   8e-46   
gb|EAY88374.1|  hypothetical protein OsI_09831                          171   1e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_003548779.1|  PREDICTED: monosaccharide-sensing protein 3-...    169   3e-45   Glycine max [soybeans]
gb|KHG04802.1|  Monosaccharide-sensing protein 2                        169   3e-45   Gossypium arboreum [tree cotton]
ref|XP_004512287.1|  PREDICTED: monosaccharide-sensing protein 2-...    169   5e-45   Cicer arietinum [garbanzo]
gb|AES95370.2|  tonoplast monosaccharide transporter 2                  169   6e-45   Medicago truncatula
ref|XP_002986014.1|  hypothetical protein SELMODRAFT_182142             167   2e-44   Selaginella moellendorffii
ref|XP_002981894.1|  hypothetical protein SELMODRAFT_179271             167   2e-44   Selaginella moellendorffii
ref|XP_003614108.1|  Monosaccharide-sensing protein                     167   2e-44   Medicago truncatula
ref|XP_009387331.1|  PREDICTED: monosaccharide-sensing protein 1-...    166   3e-44   
gb|EMS63099.1|  Monosaccharide-sensing protein 3                        165   1e-43   Triticum urartu
gb|EMT02609.1|  Monosaccharide-sensing protein 3                        164   2e-43   
ref|XP_002982939.1|  hypothetical protein SELMODRAFT_445340             162   1e-42   Selaginella moellendorffii
ref|XP_002981960.1|  hypothetical protein SELMODRAFT_179172             162   1e-42   Selaginella moellendorffii
ref|XP_001761207.1|  predicted protein                                  157   1e-40   
ref|XP_002979533.1|  hypothetical protein SELMODRAFT_111167             156   2e-40   
ref|XP_002977746.1|  hypothetical protein SELMODRAFT_10582              156   3e-40   
emb|CDY33275.1|  BnaA01g19420D                                          144   7e-40   Brassica napus [oilseed rape]
ref|XP_001773057.1|  predicted protein                                  150   3e-38   
ref|XP_003612412.1|  Monosaccharide-sensing protein                     148   2e-37   
ref|XP_006653836.1|  PREDICTED: monosaccharide-sensing protein 2-...    147   3e-37   Oryza brachyantha
ref|NP_001173250.1|  Os03g0128900                                       136   7e-36   
ref|XP_010237535.1|  PREDICTED: monosaccharide-sensing protein 2-...    141   8e-36   
ref|XP_001784511.1|  predicted protein                                  143   1e-35   
ref|XP_003577342.1|  PREDICTED: monosaccharide-sensing protein 2-...    142   2e-35   
ref|XP_002978337.1|  hypothetical protein SELMODRAFT_268165             138   9e-34   
ref|XP_002970170.1|  hypothetical protein SELMODRAFT_231525             137   1e-33   
gb|KHN35942.1|  Monosaccharide-sensing protein 3                        133   2e-32   
gb|AAM94321.1|  putative sugar transporter                              129   8e-31   
ref|XP_002449882.1|  hypothetical protein SORBIDRAFT_05g024860          129   8e-31   
ref|XP_008676723.1|  PREDICTED: uncharacterized protein LOC100272...    127   2e-30   
ref|XP_001754179.1|  predicted protein                                  124   8e-29   
gb|ABA94777.1|  Sugar transporter, putative, expressed                  122   2e-28   
gb|ABA94776.1|  Sugar transporter, putative, expressed                  122   2e-28   
gb|EEC68553.1|  hypothetical protein OsI_36866                          119   2e-27   
ref|XP_006663052.1|  PREDICTED: monosaccharide-sensing protein 2-...    119   3e-27   
ref|XP_004979746.1|  PREDICTED: monosaccharide-sensing protein 3-...    118   6e-27   
emb|CAD58959.1|  sugar transporter                                      116   4e-26   
ref|XP_010459775.1|  PREDICTED: monosaccharide-sensing protein 1-...    114   1e-25   
ref|XP_006584348.1|  PREDICTED: monosaccharide-sensing protein 3-...    101   1e-23   
gb|AGT16371.1|  hexose transporter                                      107   3e-23   
gb|KHN26180.1|  Cyanogenic beta-glucosidase                             101   6e-23   
ref|WP_041063194.1|  MFS transporter                                    104   1e-22   
ref|WP_006431848.1|  sugar transporter                                99.4    3e-21   
ref|WP_022021988.1|  sugar transporter                                  100   4e-21   
ref|WP_018631168.1|  hypothetical protein                               100   4e-21   
ref|WP_012945178.1|  major facilitator transporter                      100   5e-21   
ref|WP_014679839.1|  sugar:proton symporter                             100   5e-21   
ref|WP_006165530.1|  sugar transporter                                99.8    7e-21   
ref|WP_010332110.1|  major facilitator transporter                    99.4    9e-21   
ref|WP_038109522.1|  major facilitator transporter                    99.0    9e-21   
gb|AHG00573.1|  major facilitator transporter                         99.4    1e-20   
ref|WP_021946815.1|  d-xylose-proton symporter                        99.0    1e-20   
gb|ETI82942.1|  MFS transporter, sugar porter family protein          99.0    1e-20   
gb|KDE57191.1|  major facilitator transporter                         99.4    1e-20   
emb|CDR33502.1|  putative D-xylose-proton symporter                   99.0    2e-20   
ref|WP_007141639.1|  major facilitator transporter                    99.0    2e-20   
ref|WP_012945458.1|  major facilitator transporter                    98.6    2e-20   
ref|WP_024123064.1|  major facilitator transporter                    98.2    2e-20   
ref|WP_008420814.1|  sugar transporter                                98.2    2e-20   
ref|XP_006347568.1|  PREDICTED: D-xylose-proton symporter-like 2-...  98.2    3e-20   
ref|WP_003326676.1|  MULTISPECIES: major facilitator transporter      97.8    3e-20   
ref|NP_001288106.1|  D-xylose-proton symporter-like 2-like            98.2    3e-20   
ref|WP_010790115.1|  Major myo-inositol transporter IolT              97.8    3e-20   
ref|WP_041017256.1|  major facilitator transporter                    97.8    3e-20   
ref|WP_013644894.1|  major facilitator transporter                    97.4    4e-20   
ref|WP_019853934.1|  hypothetical protein                             97.4    4e-20   
ref|WP_006665058.1|  sugar transporter                                97.4    5e-20   
ref|WP_044159562.1|  major facilitator transporter                    97.1    6e-20   
ref|WP_008385733.1|  sugar transporter                                97.1    6e-20   
ref|XP_004509557.1|  PREDICTED: inositol transporter 1-like           96.3    6e-20   
ref|WP_005555141.1|  sugar transporter                                97.1    6e-20   
ref|WP_044170325.1|  sugar:proton symporter                           96.7    8e-20   
ref|WP_029372974.1|  major facilitator transporter                    97.1    8e-20   
ref|WP_007109838.1|  sugar transporter                                95.9    1e-19   
dbj|BAI87225.1|  hypothetical protein BSNT_10227                      95.5    1e-19   
ref|XP_003533841.1|  PREDICTED: probable inositol transporter 2-l...  97.1    1e-19   
emb|CCC56913.1|  D-xylose proton-symporter                            96.3    1e-19   
ref|WP_041351268.1|  major facilitator transporter                    96.3    1e-19   
ref|WP_021480749.1|  major facilitator transporter                    96.3    1e-19   
ref|WP_013201166.1|  major facilitator transporter                    96.3    1e-19   
ref|WP_038429742.1|  MULTISPECIES: major facilitator transporter      95.9    1e-19   
ref|WP_015251080.1|  hypothetical protein                             95.9    1e-19   
ref|WP_029318758.1|  major facilitator transporter                    95.9    1e-19   
ref|XP_010686705.1|  PREDICTED: inositol transporter 4-like isofo...  97.1    1e-19   
ref|WP_032726992.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_003243731.1|  major facilitator transporter                    95.9    1e-19   
emb|CAB07473.1|  ywtG                                                 95.9    1e-19   
ref|NP_001065505.1|  Os10g0579200                                     96.7    1e-19   
ref|WP_015384820.1|  hypothetical protein                             95.9    1e-19   
ref|WP_024571920.1|  major facilitator transporter                    95.9    1e-19   
gb|EQB38059.1|  major facilitator transporter                         96.3    1e-19   
ref|WP_002460768.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_002492575.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_042975185.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_041333343.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_017697351.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_014478156.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_003227903.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_035888480.1|  hypothetical protein                             95.9    1e-19   
ref|WP_006110627.1|  sugar transporter                                96.3    1e-19   
gb|EMT01868.1|  Monosaccharide-sensing protein 2                      96.7    1e-19   
ref|WP_014115401.1|  major facilitator transporter                    95.9    1e-19   
ref|WP_006185197.1|  sugar transporter                                96.3    1e-19   
ref|WP_033884193.1|  major facilitator transporter                    95.9    2e-19   
ref|WP_043367946.1|  major facilitator transporter                    94.0    2e-19   
gb|AAF91431.1|  putative Na+/myo-inositol symporter                   96.7    2e-19   
emb|CDQ38429.1|  putative metabolite transport protein CsbC           95.9    2e-19   
ref|WP_014665603.1|  major facilitator transporter                    95.9    2e-19   
ref|WP_006826745.1|  sugar transporter                                95.9    2e-19   
ref|WP_040081624.1|  major facilitator transporter                    95.9    2e-19   
ref|WP_032876096.1|  major facilitator transporter                    95.9    2e-19   
gb|KFF55288.1|  major facilitator transporter                         95.5    2e-19   
ref|WP_013879135.1|  major facilitator transporter                    95.9    2e-19   
ref|WP_014305946.1|  MULTISPECIES: major facilitator transporter      95.5    2e-19   
ref|WP_034881951.1|  hypothetical protein                             95.5    2e-19   
ref|WP_035895259.1|  hypothetical protein                             95.5    2e-19   
ref|WP_035174295.1|  MFS transporter                                  92.8    2e-19   
ref|WP_021494857.1|  major facilitator transporter                    95.5    2e-19   
ref|WP_007407509.1|  MULTISPECIES: major facilitator transporter      95.5    2e-19   
ref|WP_025285372.1|  major facilitator transporter                    95.5    2e-19   
ref|WP_015418357.1|  putative carbohydrate transporter                95.5    2e-19   
ref|WP_032867483.1|  major facilitator transporter                    95.5    2e-19   
ref|WP_017418788.1|  MULTISPECIES: major facilitator transporter      95.5    2e-19   
ref|WP_003880298.1|  MULTISPECIES: major facilitator transporter      95.9    2e-19   
ref|WP_013353817.1|  MULTISPECIES: major facilitator transporter      95.5    2e-19   
ref|XP_004509515.1|  PREDICTED: inositol transporter 1-like           95.9    2e-19   
ref|WP_032857593.1|  major facilitator transporter                    95.1    2e-19   
ref|WP_026588992.1|  major facilitator transporter                    95.5    2e-19   
ref|WP_003151349.1|  major facilitator transporter                    95.5    2e-19   
ref|WP_038460090.1|  MULTISPECIES: major facilitator transporter      95.5    2e-19   
ref|WP_015321733.1|  MFS transporter, sugar porter family             95.5    2e-19   
ref|WP_037956567.1|  major facilitator transporter                    95.1    2e-19   
ref|WP_039479104.1|  sugar:proton symporter                           95.5    2e-19   
gb|ACJ85869.1|  unknown                                               95.1    2e-19   
ref|WP_015021297.1|  sugar transporter                                95.1    2e-19   
ref|WP_039075310.1|  major facilitator transporter                    95.1    3e-19   
ref|WP_003235555.1|  sugar transporter family protein                 95.1    3e-19   
ref|WP_019259642.1|  major facilitator transporter                    95.1    3e-19   
ref|WP_008893404.1|  sugar transporter                                95.5    3e-19   
ref|WP_044801938.1|  major facilitator transporter                    95.1    3e-19   
ref|XP_004983521.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...  95.9    3e-19   
ref|XP_009777282.1|  PREDICTED: D-xylose-proton symporter-like 2 ...  95.5    3e-19   
dbj|BAM76462.1|  putative sugar transporter                           95.1    3e-19   
ref|WP_037544280.1|  major facilitator transporter                    94.7    3e-19   
ref|WP_031379305.1|  MULTISPECIES: major facilitator transporter      95.1    3e-19   
ref|XP_008644913.1|  PREDICTED: D-xylose-proton symporter-like 2 ...  95.5    3e-19   
ref|XP_002308798.1|  sugar transporter family protein                 95.9    3e-19   
ref|WP_025853557.1|  major facilitator transporter                    95.1    3e-19   
ref|WP_033195997.1|  major facilitator transporter                    94.7    3e-19   
ref|XP_008644912.1|  PREDICTED: D-xylose-proton symporter-like 2 ...  95.5    3e-19   
ref|WP_041094490.1|  major facilitator transporter                    94.7    3e-19   
ref|XP_009777281.1|  PREDICTED: D-xylose-proton symporter-like 2 ...  95.5    3e-19   
ref|WP_019715918.1|  major facilitator transporter                    94.7    3e-19   
ref|WP_012944770.1|  major facilitator transporter                    95.1    3e-19   
ref|WP_035166342.1|  major facilitator transporter                    95.1    4e-19   
ref|WP_003219605.1|  MULTISPECIES: major facilitator transporter      94.7    4e-19   
ref|WP_008455808.1|  sugar transporter                                95.1    4e-19   
ref|WP_037505586.1|  sugar:proton symporter                           94.7    4e-19   
ref|WP_016937738.1|  major facilitator transporter                    94.7    4e-19   
ref|XP_006662109.1|  PREDICTED: D-xylose-proton symporter-like 2-...  95.1    4e-19   
ref|XP_009777280.1|  PREDICTED: D-xylose-proton symporter-like 2 ...  95.5    4e-19   
ref|XP_003603886.1|  Mannitol transporter                             95.1    4e-19   
ref|XP_009613870.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...  94.7    4e-19   
ref|WP_038244820.1|  major facilitator transporter                    94.4    4e-19   
ref|WP_031335148.1|  major facilitator transporter                    94.4    4e-19   
ref|WP_010328819.1|  major facilitator transporter                    94.7    4e-19   
ref|WP_042737659.1|  major facilitator transporter                    94.4    4e-19   
gb|EPS65606.1|  hypothetical protein M569_09171                       91.7    4e-19   
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g           95.1    5e-19   
ref|WP_018178242.1|  hypothetical protein                             94.7    5e-19   
ref|WP_022793052.1|  major facilitator transporter                    94.4    5e-19   
ref|WP_032437817.1|  hypothetical protein                             94.4    5e-19   
ref|XP_004502238.1|  PREDICTED: inositol transporter 1-like           94.7    5e-19   
ref|WP_031054832.1|  IolT                                             94.4    5e-19   
ref|WP_003557282.1|  MULTISPECIES: major facilitator transporter      94.4    5e-19   
gb|KDL14725.1|  hypothetical protein AF38_04702                       94.4    6e-19   
gb|EMS55132.1|  D-xylose-proton symporter-like 2                      94.7    6e-19   
gb|EMT10196.1|  D-xylose-proton symporter-like protein 2              94.7    6e-19   
ref|WP_017261050.1|  major facilitator transporter                    94.4    6e-19   
ref|WP_025731032.1|  major facilitator transporter                    94.4    6e-19   
ref|XP_006349857.1|  PREDICTED: inositol transporter 4-like           95.1    6e-19   
ref|WP_003551797.1|  major facilitator transporter                    94.4    6e-19   
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like             94.7    6e-19   
ref|WP_014862590.1|  major facilitator transporter                    94.4    6e-19   
ref|WP_034634458.1|  major facilitator transporter                    94.4    6e-19   
ref|WP_018661922.1|  major facilitator transporter                    94.0    7e-19   
ref|WP_035323910.1|  MFS transporter                                  94.0    7e-19   
emb|CEG72789.1|  hypothetical protein RMATCC62417_08279               94.7    7e-19   
ref|WP_036483679.1|  major facilitator transporter                    94.4    7e-19   
ref|WP_041882616.1|  sugar:proton symporter                           94.0    8e-19   
ref|WP_037961191.1|  major facilitator transporter                    94.0    8e-19   
dbj|BAJ88105.1|  predicted protein                                    94.4    8e-19   
gb|EKD78085.1|  hypothetical protein ACD_42C00046G0002                94.0    8e-19   
ref|WP_040615275.1|  major facilitator transporter                    94.0    8e-19   
ref|XP_010780349.1|  PREDICTED: proton myo-inositol cotransporter...  95.1    8e-19   
ref|XP_010780354.1|  PREDICTED: proton myo-inositol cotransporter...  94.7    8e-19   
ref|XP_010780348.1|  PREDICTED: proton myo-inositol cotransporter...  95.1    8e-19   
gb|EDP46643.1|  D-xylose-proton symporter                             94.0    8e-19   
ref|XP_010780353.1|  PREDICTED: proton myo-inositol cotransporter...  94.7    9e-19   
ref|WP_036399841.1|  major facilitator transporter                    94.0    9e-19   
ref|XP_010780347.1|  PREDICTED: proton myo-inositol cotransporter...  95.1    9e-19   
ref|WP_043926519.1|  major facilitator transporter                    93.6    1e-18   
ref|WP_020453166.1|  MULTISPECIES: putative carbohydrate transpor...  93.6    1e-18   
emb|CAG05594.1|  unnamed protein product                              90.1    1e-18   
ref|XP_002464862.1|  hypothetical protein SORBIDRAFT_01g027800        94.0    1e-18   
ref|XP_003595539.1|  Carbohydrate transporter/sugar porter            94.4    1e-18   
ref|WP_014465940.1|  MFS transporter                                  93.6    1e-18   
ref|WP_006639311.1|  sugar transporter YwtG                           93.2    1e-18   
ref|WP_040444514.1|  hypothetical protein                             93.2    1e-18   
ref|XP_010314725.1|  PREDICTED: inositol transporter 4-like           94.4    1e-18   
ref|WP_044523816.1|  major facilitator transporter                    94.0    1e-18   
ref|XP_004293378.1|  PREDICTED: inositol transporter 4-like           94.0    1e-18   
ref|WP_032817496.1|  major facilitator transporter                    93.2    1e-18   
ref|XP_010933397.1|  PREDICTED: D-xylose-proton symporter-like 2 ...  93.2    1e-18   
sp|O52733.1|XYLT_LACBR  RecName: Full=D-xylose-proton symporter; ...  93.2    1e-18   
ref|WP_030183952.1|  sugar transporter                                93.6    1e-18   
ref|WP_003927707.1|  major facilitator transporter                    93.6    1e-18   
ref|WP_006053328.1|  major facilitator transporter                    93.2    1e-18   
emb|CEI96832.1|  hypothetical protein RMCBS344292_10983               94.0    1e-18   
ref|WP_020220851.1|  hypothetical protein                             93.2    1e-18   
ref|WP_022486233.1|  sugar transporter                                93.2    1e-18   
ref|WP_021863576.1|  sugar transporter                                93.2    1e-18   
ref|WP_034318471.1|  major facilitator transporter                    92.8    2e-18   
ref|WP_029240085.1|  major facilitator transporter                    93.2    2e-18   
gb|AES71915.2|  sugar porter (SP) family MFS transporter              93.2    2e-18   
ref|XP_003601664.1|  hypothetical protein MTR_3g084110                93.2    2e-18   
ref|WP_017895285.1|  major facilitator transporter                    92.8    2e-18   
ref|XP_007034050.1|  Inositol transporter 1 isoform 2                 89.7    2e-18   
gb|KFK22027.1|  hypothetical protein AALP_AAs71925U000400             93.2    2e-18   
ref|WP_036393994.1|  major facilitator transporter                    93.6    2e-18   
ref|WP_026580203.1|  major facilitator transporter                    92.8    2e-18   
ref|XP_010933396.1|  PREDICTED: D-xylose-proton symporter-like 2 ...  93.2    2e-18   
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like             93.2    2e-18   
ref|XP_010733777.1|  PREDICTED: proton myo-inositol cotransporter...  93.6    2e-18   
ref|XP_010733780.1|  PREDICTED: proton myo-inositol cotransporter...  93.6    2e-18   
emb|CEG86441.1|  iolT3 (myo-inositol transporter iolT3)               93.2    2e-18   
ref|XP_010733776.1|  PREDICTED: proton myo-inositol cotransporter...  93.6    2e-18   
ref|XP_002524977.1|  sugar transporter, putative                      93.6    2e-18   
emb|CEG99445.1|  iolT3 (myo-inositol transporter iolT3)               93.2    2e-18   
ref|XP_010733779.1|  PREDICTED: proton myo-inositol cotransporter...  93.6    2e-18   
ref|WP_044636345.1|  major facilitator transporter                    93.2    2e-18   



>ref|XP_009796447.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796448.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796450.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=738

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+D  GRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDSFGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQFTGSGGMFLA
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLA  146



>ref|XP_006342166.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342167.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=737

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELALDASVEGLVVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SGSIAD +GRRPMLI+SSM YFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQFTGSGGMFLA
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLA  146



>ref|NP_001289848.1| monosaccharide-sensing protein 2 [Solanum lycopersicum]
 dbj|BAO96237.1| tonoplast monosaccharide transporter 2 [Solanum lycopersicum]
Length=738

 Score =   264 bits (675),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGL+VAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLIVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SGSIAD +GRRPMLI+SSM YFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGSIADSIGRRPMLIMSSMLYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQFTGSGGMFLA
Sbjct  121  ETAPSEIRGSLNTLPQFTGSGGMFLA  146



>ref|XP_011074068.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011074069.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=739

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGA LVAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGAT+ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLILSS+FYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDWIGRRPMLILSSIFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGS GMFLA
Sbjct  121  ETAPSEIRGLLNTLPQFTGSAGMFLA  146



>ref|XP_009595864.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595865.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595866.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
Length=738

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVA+AATIGNFLQGWDNATIAGAVVYIKKEL L+  +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVALAATIGNFLQGWDNATIAGAVVYIKKELTLDASVEGLVVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+D  GRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDSFGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQFTGS GMFLA
Sbjct  121  ETAPSEIRGSLNTLPQFTGSSGMFLA  146



>gb|KDO85211.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=592

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQFTGSGGMFLA
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLA  146



>ref|XP_011100175.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=740

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAVVYIKKELQLGAAIEGLIVAMSLIGATLITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+D +GRRPMLI SSMFYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDLIGRRPMLISSSMFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFLA
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLA  146



>gb|KDO85208.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=706

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQFTGSGGMFLA
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLA  146



>ref|XP_006435423.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 ref|XP_006473839.1| PREDICTED: monosaccharide-sensing protein 2-like [Citrus sinensis]
 gb|ESR48663.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 gb|KDO85209.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=738

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGA LVAIAATIGNFLQGWDNATIAGA+VYIKK+L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLNLGTTVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLILSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGVGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQFTGSGGMFLA
Sbjct  121  ETAPSEIRGRLNTLPQFTGSGGMFLA  146



>ref|XP_010094525.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB56279.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=739

 Score =   259 bits (662),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIKK+LVLE+ +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVAIAATIGNFLQGWDNATIAGAIVYIKKDLVLESSVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+++DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDWLGRRPMLIISSVLYFISGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSDIRGLLNTLPQFTGSGGMFLS  146



>ref|XP_003527273.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581130.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
Length=737

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG +ADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLS  146



>gb|KJB14183.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=557

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLS  146



>gb|KHN33775.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=737

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG IADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPIADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLS  146



>ref|XP_006577928.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=738

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG IADWLGRRPM+I+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPIADWLGRRPMMIISSVLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLS  146



>gb|KJB14182.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=548

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLS  146



>ref|XP_007135975.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
 gb|ESW07969.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
Length=736

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L L+T MEGLVVAMSLIGATLITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALQTTMEGLVVAMSLIGATLITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG ++DWLGRRPMLI+SS+ YFL GL+MLWSPNVYVL +ARLLDGFGIGLAVTL+P+YIS
Sbjct  61   SGPVSDWLGRRPMLIISSLLYFLGGLVMLWSPNVYVLCLARLLDGFGIGLAVTLIPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  121  ETAPSEIRGSLNTLPQFSGSGGMFLS  146



>ref|XP_007018122.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
 gb|EOY15347.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
Length=740

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSILYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLS  146



>ref|XP_007018119.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018120.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018121.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15344.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15345.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15346.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
Length=739

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKEDLNLGTSVEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DWLGRRPMLI+SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSILYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLS  146



>emb|CDP07261.1| unnamed protein product [Coffea canephora]
Length=737

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAV VA++AT+GNFLQGWDNATIAGAVVY+KKEL LE  +EGLVVAMSLIGATLITTC
Sbjct  1    MKGAVFVALSATVGNFLQGWDNATIAGAVVYMKKELDLEATVEGLVVAMSLIGATLITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SGSI+DW+GRRPMLILSS FYF SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTL PLYIS
Sbjct  61   SGSISDWIGRRPMLILSSSFYFFSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLTPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQF GS GMFLA
Sbjct  121  ETAPSEIRGSLNTLPQFAGSAGMFLA  146



>ref|XP_010061214.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW68134.1| hypothetical protein EUGRSUZ_F01805 [Eucalyptus grandis]
Length=735

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAV VAIAATIGNFLQGWDNATIAGA++YIK++L L T +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVWVAIAATIGNFLQGWDNATIAGAIIYIKEDLDLGTTVEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLILSS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWVGRRPMLILSSLLYFISGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPIYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLS  146



>gb|KHG10189.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAALVAIAATIGNFLQGWDNATIAGAIVYIKNDLDLGTSVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DWLGRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLS  146



>dbj|BAK00015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   240 bits (613),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLS  148



>gb|KDP36756.1| hypothetical protein JCGZ_08047 [Jatropha curcas]
Length=739

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVAIAA IG+FLQGWDNATIAGA+VYIK +L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MNGAVLVAIAACIGSFLQGWDNATIAGAIVYIKDDLDLQTTVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DWLGRRPMLI+SSM YF+SGLIM+WSPNVYVL IARLLDGF IGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIMSSMLYFVSGLIMIWSPNVYVLCIARLLDGFAIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRG+LNTLPQFTGSGGMFL+
Sbjct  121  ETAPSDIRGMLNTLPQFTGSGGMFLS  146



>gb|KJB14177.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14178.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14179.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14180.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14181.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14184.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=739

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA  VAIAATIGNFLQGWDNATIAGA+VYIK +L L T +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAAFVAIAATIGNFLQGWDNATIAGAIVYIKNDLNLGTSVEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLS  146



>ref|XP_002510716.1| sugar transporter, putative [Ricinus communis]
 gb|EEF52903.1| sugar transporter, putative [Ricinus communis]
Length=739

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVAI A IG+FLQGWDNATIAGA+VYIKK+L L+T +EGLVVAMSLIGAT ITTC
Sbjct  1    MKGAVLVAITACIGSFLQGWDNATIAGAIVYIKKDLNLQTTVEGLVVAMSLIGATTITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DWLGRRPMLI+SS  YF+SGLIMLWSP+VYVL IARLLDGF IGLAVTLVP+YIS
Sbjct  61   SGAISDWLGRRPMLIISSTLYFVSGLIMLWSPDVYVLCIARLLDGFAIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG+LNTLPQFTGSGGMFL+
Sbjct  121  ETAPSEIRGMLNTLPQFTGSGGMFLS  146



>ref|XP_003603868.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74119.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=730

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVAIAA+IGNFLQGWDNATIAG+++YIKK+L L+T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGSILYIKKDLALQTTMEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRG LNTLPQF+GSGGMFL+
Sbjct  121  ETAPSDIRGSLNTLPQFSGSGGMFLS  146



>gb|EAY85098.1| hypothetical protein OsI_06450 [Oryza sativa Indica Group]
Length=689

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 3/173 (2%)
 Frame = +1

Query  130  GTTDLSFTGACSSY*L-ELDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKE  306
            G+   SF+   S + L   D   ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE
Sbjct  5    GSGSCSFSSPLSPFVLTRRDRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKE  64

Query  307  LVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPN  480
              LE+   +EGL+VAMSLIGAT+ITT SG ++DW+GRRPMLILSS+ YFLS LIMLWSPN
Sbjct  65   FKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPN  124

Query  481  VYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            VYVLL+ARL+DGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQF+GSGGMFL+
Sbjct  125  VYVLLLARLIDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFSGSGGMFLS  177



>ref|XP_004500833.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500834.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=736

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAV VAI A+IGNFLQGWDNATIAGA++YIKK+L L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIVASIGNFLQGWDNATIAGAILYIKKDLALHTTMEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRG LNTLPQF+GSGGMFL+
Sbjct  121  ETAPSDIRGSLNTLPQFSGSGGMFLS  146



>gb|EAZ22316.1| hypothetical protein OsJ_05971 [Oryza sativa Japonica Group]
Length=775

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 3/173 (2%)
 Frame = +1

Query  130  GTTDLSFTGACSSY*L-ELDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKE  306
            G+   SF+   S + L   D   ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE
Sbjct  5    GSGSCSFSSPLSPFVLTRRDRRGVKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKE  64

Query  307  LVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPN  480
              LE+   +EGL+VAMSLIGAT+ITT SG ++DW+GRRPMLILSS+ YFLS LIMLWSPN
Sbjct  65   FKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPN  124

Query  481  VYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            VYVLL+ARL+DGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQF+GSGGMFL+
Sbjct  125  VYVLLLARLIDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFSGSGGMFLS  177



>emb|CBI21577.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            MNGAVLVAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +ADWLGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLS  148



>emb|CBI40753.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP++IRG LNTLPQFTGSGGMFL+
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLS  146



>emb|CAN59780.1| hypothetical protein VITISV_024656 [Vitis vinifera]
Length=740

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP++IRG LNTLPQFTGSGGMFL+
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLS  146



>ref|NP_001267873.1| hexose transporter-like [Vitis vinifera]
 gb|AAY40466.1| putative hexose transporter [Vitis vinifera]
 gb|ADP37147.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=740

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP++IRG LNTLPQFTGSGGMFL+
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLS  146



>ref|XP_004300112.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465026.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=738

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAV VAIAATIGNFLQGWDNATIAGA+VYI  +  L++ +EGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVFVAIAATIGNFLQGWDNATIAGAIVYITDDFALDSSVEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+++DWLGRRPMLI SS+ YF+SGL+MLWSPNVYVL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDWLGRRPMLITSSVLYFVSGLVMLWSPNVYVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPSDIRGSLNTLPQFLGSGGMFLS  146



>gb|AAX47312.1| hexose transporter 6 [Vitis vinifera]
Length=740

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVAIAA IGNFLQGWDNATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWDNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP++IRG LNTLPQFTGSGGMFL+
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLS  146



>emb|CDY31497.1| BnaC05g16060D [Brassica napus]
Length=632

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>gb|EYU43534.1| hypothetical protein MIMGU_mgv1a001953mg [Erythranthe guttata]
Length=734

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGA L+AIAATIGNFLQGWDNATIAGAVVYIKKEL L   +EGL+VAMSLIGATLITTC
Sbjct  1    MNGAALIAIAATIGNFLQGWDNATIAGAVVYIKKELELGAAIEGLIVAMSLIGATLITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+D +GRRPMLI SSMFYFLSGLIMLWSPNVYVLL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDSIGRRPMLIASSMFYFLSGLIMLWSPNVYVLLLARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMFLA
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFLA  146



>ref|XP_011034826.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034827.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034828.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034829.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SGSI+DW+GRRPMLI SS+ YF+SGL+M WSPNVYVL I RLLDGFG+GLAVTLVPLYIS
Sbjct  61   SGSISDWIGRRPMLISSSILYFVSGLVMFWSPNVYVLCIGRLLDGFGVGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRG+LNTLPQF GSGGMFL+
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLS  146



>ref|XP_002276373.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37149.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=742

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            MNGAVLVAI A IGN LQGWDNATIAGAV+YIK+E  L+T   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVAITAAIGNLLQGWDNATIAGAVLYIKREFHLQTEPTIEGLIVAMSLIGATAIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +ADWLGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVADWLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_010539774.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539775.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYIK E+ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNEMNLATSVQGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I DWLGRRPMLI SS+ YF+SGLIMLWSPNVYVL +ARLLDGFGIGLAVTL+P+YIS
Sbjct  61   SGPITDWLGRRPMLIFSSILYFISGLIMLWSPNVYVLCLARLLDGFGIGLAVTLIPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFMGSGGMFLS  146



>dbj|BAJ33724.1| unnamed protein product [Thellungiella halophila]
Length=733

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|XP_006416357.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 ref|XP_006416358.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34710.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34711.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
Length=733

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSIMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|XP_010537220.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537221.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537222.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
Length=735

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYIK ++ L T ++GLVVAMSLIGAT ITTC
Sbjct  1    MKGAALVALAATIGNFLQGWDNATIAGAMVYIKNDMNLATSVQGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLI SS+ YF+SGLIM+WSPNVYVL +ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLIFSSILYFISGLIMVWSPNVYVLCLARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFMGSGGMFLS  146



>emb|CDY29502.1| BnaA06g14680D [Brassica napus]
Length=659

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|XP_009149562.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
 ref|XP_009149563.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=721

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLATSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLIL+S+ YFLSGLIMLWSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILASVMYFLSGLIMLWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|NP_001046359.1| Os02g0229400 [Oryza sativa Japonica Group]
 dbj|BAD26163.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF08273.1| Os02g0229400 [Oryza sativa Japonica Group]
 gb|ADG21983.1| tonoplast monosaccharide transporter 2 [Oryza sativa Japonica 
Group]
Length=746

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLS  148



>gb|EMS49950.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=686

 Score =   242 bits (617),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSLLYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLS  148



>ref|XP_010686712.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=735

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVA+AATIGNFLQGWDNATIAG+++YIKKEL L T MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVALAATIGNFLQGWDNATIAGSILYIKKELELSTAMEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+++D +GRRP+L+LS+  YF+  L+MLWSPNVY+LL+ARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAVSDAVGRRPLLMLSASLYFIGSLVMLWSPNVYILLLARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ET+P EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETSPPEIRGLLNTLPQFTGSGGMFLS  146



>emb|CDY33650.1| BnaC08g19500D [Brassica napus]
Length=697

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSPNVYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPNVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|XP_002307812.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
 gb|EEE94808.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
Length=738

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLI+SS+ YF+SGL+M WSPNVYVL I RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLIISSILYFVSGLVMFWSPNVYVLCIGRLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRG+LNTLPQF GSGGMFL+
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLS  146



>ref|XP_003571780.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=749

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  196  LRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATL  369
            ++M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+
Sbjct  3    VKMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLENDPTLEGLIVAMSLIGATI  62

Query  370  ITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP  549
            ITT SG ++DW+GRRPMLILSS+ YF SGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVP
Sbjct  63   ITTFSGPVSDWVGRRPMLILSSILYFFSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVP  122

Query  550  LYISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            LYISETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  123  LYISETAPSEIRGQLNTLPQFSGSGGMFLS  152



>ref|XP_002300629.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
 gb|EEE79902.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
Length=738

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAA +GNFLQGWDNATIAGAV+Y+KK+L L++ +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGASLVAIAACVGNFLQGWDNATIAGAVIYVKKDLKLQSSVEGLVVAMSLIGAAAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DW+GRRPMLI SS+ YF+SGL+M WSPNVYVL I RLLDGFG+GLAVTL+PLYIS
Sbjct  61   SGPISDWIGRRPMLISSSILYFVSGLVMFWSPNVYVLCIGRLLDGFGVGLAVTLIPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRG+LNTLPQF GSGGMFL+
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLS  146



>gb|AIQ77649.1| tonoplastic transporter 1 [Vitis vinifera]
Length=740

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            MNGAVLVAIAA IGNFLQGW NATIAGA+VYIKKEL LE+ +EGLVVAMSLIGATL+TTC
Sbjct  1    MNGAVLVAIAAAIGNFLQGWGNATIAGAIVYIKKELDLESTVEGLVVAMSLIGATLVTTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GRRPMLI+SSM YF+SGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGAISDWIGRRPMLIVSSMLYFISGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPIYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP++IRG LNTLPQFTGSGGMFL+
Sbjct  121  ETAPADIRGSLNTLPQFTGSGGMFLS  146



>ref|XP_009390770.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 138/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA+IGN LQGWDNATIAGAV+YIKKE  LET   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAASIGNLLQGWDNATIAGAVLYIKKEFKLETQPTMEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++D +GRRPMLI+SS+ YF+SGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDMVGRRPMLIISSVLYFVSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_011041174.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAA IGNFLQGWDNATIAGA++Y+ K+L L+  +EGLVVAMSLIGA  ITTC
Sbjct  1    MKGAALVAIAACIGNFLQGWDNATIAGAIIYVNKDLKLQASVEGLVVAMSLIGAAAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLI+SS+ YF+SGL+M WSPNVYVL I RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLIISSVLYFVSGLVMFWSPNVYVLCIGRLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRG+LNTLPQF GSGGMFL+
Sbjct  121  ETAPSDIRGMLNTLPQFAGSGGMFLS  146



>ref|XP_009397963.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397964.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397965.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GA LVAI A+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAALVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++DW+GRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDWVGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLS  148



>gb|EMT06669.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=787

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 2/149 (1%)
 Frame = +1

Query  199  RMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLI  372
            +M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+I
Sbjct  43   KMSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENNPTVEGLIVAMSLIGATII  102

Query  373  TTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPL  552
            TT SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPL
Sbjct  103  TTFSGPVSDWVGRRPMLILSSLLYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPL  162

Query  553  YISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            YISETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  163  YISETAPSEIRGRLNTLPQFSGSGGMFLS  191



>dbj|BAJ89532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLENDPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GRRPMLILSS+ YFLSGLIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWVGRRPMLILSSILYFLSGLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  121  ISETAPSEIRGRLNTLPQFSGSGGMFLS  148



>emb|CDI66591.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLS  148



>emb|CDI66586.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
 emb|CDI66607.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   241 bits (616),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFQLQSEPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GRRPMLILSS+ YFLS LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSVLYFLSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_008373385.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=739

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  205  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  384
             GAVLVAIAATIGN LQGWDNATIAGA+VYI KE  L + +EGLVVAMSLIGAT+ITTCS
Sbjct  3    KGAVLVAIAATIGNLLQGWDNATIAGAIVYITKEFDLGSSLEGLVVAMSLIGATIITTCS  62

Query  385  GSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISE  564
            G+I+DW+GRRPMLI SS+FYF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTL+PLYISE
Sbjct  63   GAISDWIGRRPMLIASSVFYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLIPLYISE  122

Query  565  TAPSEIRGLLNTLPQFTGSGGMFLA  639
            TAP +IRG LNTLPQF GSGG+FL+
Sbjct  123  TAPPDIRGSLNTLPQFLGSGGLFLS  147



>ref|XP_010063149.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW70342.1| hypothetical protein EUGRSUZ_F03585 [Eucalyptus grandis]
Length=740

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAV VA+AATIGNFLQGWDNATIAG +VYIK++L L + +EGLVVAMSLIGAT+ITT 
Sbjct  1    MRGAVFVALAATIGNFLQGWDNATIAGGIVYIKEDLDLGSTVEGLVVAMSLIGATVITTS  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLI+SS+ YF+ GL+MLWSPNVYVL + RLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGPISDWLGRRPMLIMSSILYFIGGLVMLWSPNVYVLCLGRLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP ++RGLLNTLPQFTGSGGMFLA
Sbjct  121  ETAPPDVRGLLNTLPQFTGSGGMFLA  146



>ref|XP_006647093.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647094.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Oryza 
brachyantha]
Length=746

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GRRPMLILSS+ YFL  LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRRPMLILSSILYFLGSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_008351570.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=216

 Score =   226 bits (577),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG++ADWLGRRPMLI+SS+FYFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLS  148



>ref|XP_010909820.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909821.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909822.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909823.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909824.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909825.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909826.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909827.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909828.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909829.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=747

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = +1

Query  205  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  378
             GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    RGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTVEGLIVAMSLIGATIITT  62

Query  379  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYI  558
             SG+++DW+GRRP+LILSS+ YFLSGL+MLWSPNV++LL+ARL+DGFGIGLAVTLVPLYI
Sbjct  63   FSGAVSDWIGRRPILILSSVLYFLSGLVMLWSPNVHILLLARLIDGFGIGLAVTLVPLYI  122

Query  559  SETAPSEIRGLLNTLPQFTGSGGMFLA  639
            SETAP EIRGLLNTLPQF+GSGGMFL+
Sbjct  123  SETAPPEIRGLLNTLPQFSGSGGMFLS  149



>ref|XP_009110209.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=726

 Score =   240 bits (612),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSP+VYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPSVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>emb|CAA90628.1| sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   240 bits (612),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>emb|CDX96618.1| BnaA08g21610D [Brassica napus]
Length=725

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K++ L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDMNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YFLSGLIM WSP+VYVL +ARLLDGFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFLSGLIMWWSPSVYVLCLARLLDGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|XP_009372620.1| PREDICTED: monosaccharide-sensing protein 2 [Pyrus x bretschneideri]
Length=739

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  205  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCS  384
             GAVLVA+AATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTCS
Sbjct  3    KGAVLVAVAATIGNLLQGWDNATIAGAIVYITEDFSLGSSLEGLVVAMSLIGATFITTCS  62

Query  385  GSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISE  564
            G+I+DW+GRRPMLI SS+FYF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYISE
Sbjct  63   GAISDWIGRRPMLIASSVFYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYISE  122

Query  565  TAPSEIRGLLNTLPQFTGSGGMFLA  639
            TAP +IRG LNTLPQF GSGGMFL+
Sbjct  123  TAPPDIRGSLNTLPQFLGSGGMFLS  147



>gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|NP_173508.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
 sp|Q96290.2|MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1; AltName: Full=Monosaccharide 
transporter 1; AltName: Full=Sugar transporter 
MSSP1; AltName: Full=Sugar transporter MT1 [Arabidopsis thaliana]
 gb|AAF80627.1|AC069251_20 F2D10.36 [Arabidopsis thaliana]
 gb|AEE30030.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
Length=734

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|XP_006306868.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306869.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306870.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39766.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39767.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39768.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
Length=736

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|XP_002893133.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69392.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
Length=735

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI K+L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>gb|AAP54842.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
Length=445

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_010477336.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
 ref|XP_010477338.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
Length=734

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVA+AATIGNFLQGWDNATIAGA+VYI  +L L T ++GLVVAMSLIGAT+ITTC
Sbjct  1    MKGATLVALAATIGNFLQGWDNATIAGAMVYINNDLNLPTSVQGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+DWLGRRPMLILSS+ YF+ GLIMLWSPNVYVL  ARLL+GFG GLAVTLVP+YIS
Sbjct  61   SGPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPPEIRGQLNTLPQFLGSGGMFLS  146



>ref|XP_006855646.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
 gb|ERN17113.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
Length=743

 Score =   238 bits (606),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 133/147 (90%), Gaps = 2/147 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA+IGN LQGWDNATIA AV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAAAVLYIKEEFDLDNEPTLEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DW+GRRPMLI SS+ YF+S LIM WSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDWIGRRPMLIFSSILYFVSALIMFWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFL  636
            ISETAP+EIRGLLNTLPQF+GSGGMF+
Sbjct  121  ISETAPAEIRGLLNTLPQFSGSGGMFV  147



>ref|XP_010029562.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56480.1| hypothetical protein EUGRSUZ_I02208 [Eucalyptus grandis]
Length=731

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  375
            M GAVLVA+AATIGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAATIGNLLQGWDNATIAGAVLYIKKEFDLEGQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPM+I+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTL+P+Y
Sbjct  61   TFSGPVSDSIGRRPMMIISSILYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLIPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_008242106.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=742

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M G+VLVAIAATIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MWGSVLVAIAATIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMF++
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFMS  148



>ref|XP_009401004.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401005.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA+IGN LQGWDNATIAG+++YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAGSILYIKKEFKLDSEPTIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWVGRRPMLIISSILYFLSGLVMLWSPNVYVLLLARLIDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQF+GSGGMF++
Sbjct  121  ISETAPPEIRGSLNTLPQFSGSGGMFIS  148



>ref|XP_007204446.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
 gb|EMJ05645.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
Length=742

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M G+VLVAIAATIGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MWGSVLVAIAATIGNLLQGWDNATIAGAVLYIKREFKLETQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMF++
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFMS  148



>ref|XP_008778122.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778123.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778124.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778125.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778126.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=747

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAI A+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  2    MQGAVLVAIVASIGNLLQGWDNATIAGAVLYIKKEFKLETEPTIEGLIVAMSLIGATIIT  61

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++D +GRRP+LILSS+ YFLSGL+MLWSPNVY+LL+ARL+DGFGIGLAVTLVP+Y
Sbjct  62   TFSGAVSDCIGRRPILILSSVLYFLSGLVMLWSPNVYILLLARLIDGFGIGLAVTLVPVY  121

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF+GSGGMFL+
Sbjct  122  ISETAPPEIRGLLNTLPQFSGSGGMFLS  149



>ref|XP_010940242.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=745

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GA LVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAALVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLESEPTIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
              SG+I+DW GRRPMLI+SS+FYF SGL+MLWSPNVY+LL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYFFSGLVMLWSPNVYILLLARLIDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLS  148



>gb|EMS63940.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=743

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 138/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>gb|EMT29091.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=743

 Score =   236 bits (601),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 138/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_010906859.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=549

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AATIGN LQGWDN+TIAGAV++IK+E  LE+   +EGL++AMSLIGAT+IT
Sbjct  1    MRGAVLVALAATIGNLLQGWDNSTIAGAVLFIKREFQLESEPTIEGLIIAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++DW GRRPMLI +++F FLSGL+MLWSPNVY+LL+ARL++GFG+GLAVTLVP+Y
Sbjct  61   TFSGAVSDWFGRRPMLIAAAVFTFLSGLVMLWSPNVYILLLARLINGFGVGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_010266258.1| PREDICTED: monosaccharide-sensing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=653

 Score =   234 bits (596),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG ++DWLGRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVSGLIMFWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLS  148



>gb|KJB79727.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=592

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLS  148



>ref|XP_004951395.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=745

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPMLILSS+ YF S LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGPVSDLIGRRPMLILSSILYFCSSLIMLWSPNVYVLLLARLVDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_006364349.1| PREDICTED: monosaccharide-sensing protein 2-like [Solanum tuberosum]
Length=257

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IG+FLQGWDNATIAG+++YIKKE  LET   MEGL+VAMSL+GA L+T
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGSILYIKKEFNLETQPTMEGLIVAMSLVGAVLMT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPN+YVLL+ARLL+GFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVSGLVMLWSPNIYVLLLARLLNGFGVGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTG  GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCVGMFFS  148



>ref|XP_008237926.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=739

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M  A++VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRSAMMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+DW+GR+PMLI SS+ YF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGAISDWIGRKPMLIASSVLYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP++IRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPADIRGSLNTLPQFLGSGGMFLS  146



>dbj|BAJ90138.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = +1

Query  205  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  378
            +GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  379  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYI  558
             SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLYI
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLYI  122

Query  559  SETAPSEIRGLLNTLPQFTGSGGMFLA  639
            SETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  123  SETAPTDIRGLLNTLPQFSGSGGMFLS  149



>emb|CAD58958.1| hexose transporter [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 137/147 (93%), Gaps = 2/147 (1%)
 Frame = +1

Query  205  NGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITT  378
            +GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT
Sbjct  3    SGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITT  62

Query  379  CSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYI  558
             SG++AD +GRRP+LI SS+ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLYI
Sbjct  63   FSGAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLYI  122

Query  559  SETAPSEIRGLLNTLPQFTGSGGMFLA  639
            SETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  123  SETAPTDIRGLLNTLPQFSGSGGMFLS  149



>ref|XP_010266257.1| PREDICTED: monosaccharide-sensing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MKGAVFVAIAAAVGNLLQGWDNATIAGAVLYIKKEFQLESEPTIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG ++DWLGRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLIISSVLYFVSGLIMFWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_011000869.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000870.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000871.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRP+LI+SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDWLGRRPLLIISSILYFVSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_002467580.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
 gb|EER94578.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
Length=740

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG++AD +GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSVGRRPMLIASAILYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>gb|EEC67373.1| hypothetical protein OsI_34495 [Oryza sativa Indica Group]
Length=718

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>ref|NP_001065182.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|AAG46115.1|AC073166_13 putative sugar transporter [Oryza sativa Japonica Group]
 gb|ABB47937.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27096.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|EAZ16837.1| hypothetical protein OsJ_32308 [Oryza sativa Japonica Group]
 gb|ADG21982.1| tonoplast monosaccharide transporter 1 [Oryza sativa Japonica 
Group]
Length=740

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MAGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG++AD  GRRPMLI S++ YF+SGL+MLW+PNVYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>gb|KJB79728.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=739

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLS  148



>ref|XP_007142576.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
 gb|ESW14570.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
Length=732

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGNFLQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVALAAAIGNFLQGWDNATIAGSILYIKREFQLESEPTIEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SSM YFLS L+MLWSPNVY+LL ARLLDGFGIGLAVTLVPLY
Sbjct  61   TCSGPISDWLGRRPMLIISSMLYFLSSLVMLWSPNVYILLFARLLDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP+EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPTEIRGLLNTLPQFTGSAGMFFS  148



>gb|KHG05233.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MNGAVLVALAAAIGNMLQGWDNATIAGAVLYIKKEFKLESAPTIEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SS+ YFLSGL+M+WSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFLSGLVMVWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLS  148



>ref|XP_007210337.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 ref|XP_007210338.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11536.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11537.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
Length=739

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAV+VAIAATIGN LQGWDNATIAGA+VYI ++  L + +EGLVVAMSLIGAT ITTC
Sbjct  1    MRGAVMVAIAATIGNLLQGWDNATIAGAIVYITEDFDLGSSLEGLVVAMSLIGATAITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG I+D +GR+PMLI SS+ YF+SGL+M+WSPNVYVL IARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGVISDSIGRKPMLIASSVLYFVSGLVMVWSPNVYVLCIARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAP++IRG LNTLPQF GSGGMFL+
Sbjct  121  ETAPADIRGSLNTLPQFLGSGGMFLS  146



>ref|XP_010680636.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV  A+AAT+GN LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFAALAATMGNLLQGWDNATIAGAVIYIKREFSLETQPTLEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPMLI+SS+ YFL GL+MLWSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDSVGRRPMLIISSILYFLGGLVMLWSPNVYVLLLGRLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGQLNTLPQFTGSGGMFLS  148



>ref|XP_003574265.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=741

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 138/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLESQPLIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG++AD +GRRP+LI S++ YF+SGL+MLW+P+VYVLL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAVADAVGRRPLLIASAVLYFVSGLVMLWAPSVYVLLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_002520608.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41781.1| sugar transporter, putative [Ricinus communis]
Length=740

 Score =   229 bits (585),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 138/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKREFNLESEPTIEGLIVATSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+I+DWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYFLSGVVMLWSPNVYILLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>gb|AJO70165.1| tonoplast monosaccharide transporters 1 [Camellia sinensis]
Length=736

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +1

Query  241  GNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSIADWLGRRPM  420
            GNFLQGWDNATIAGA+VYIK++L LET +EGLVVAMSLIGATL+TTCSG I+D +GRRPM
Sbjct  14   GNFLQGWDNATIAGAIVYIKEDLSLETTIEGLVVAMSLIGATLVTTCSGPISDLIGRRPM  73

Query  421  LILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNT  600
            LI+SSMFYF+SGL+MLWSPNVYVLL+ARL+DGFGIGLAVTLVP+YISETAP++IRGLLNT
Sbjct  74   LIMSSMFYFVSGLVMLWSPNVYVLLVARLIDGFGIGLAVTLVPVYISETAPADIRGLLNT  133

Query  601  LPQFTGSGGMFLA  639
             PQF GS  MFLA
Sbjct  134  FPQFAGSFAMFLA  146



>emb|CDP14489.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVAI ATIGN LQGWDNATIAGAV++IK+EL LE+   +EGL+VAMSLIGA L+T
Sbjct  1    MSGAVLVAIGATIGNLLQGWDNATIAGAVLFIKRELKLESDPTVEGLIVAMSLIGAVLVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T +G +ADWLGRRPMLI+SS+ YF+SGL+M WSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TFAGGVADWLGRRPMLIVSSVLYFVSGLVMFWSPNVYVLLLGRLLDGFGVGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISET+P EIRGLLNTLPQF GS GMFL+
Sbjct  121  ISETSPPEIRGLLNTLPQFCGSLGMFLS  148



>ref|XP_008645619.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 ref|XP_008645620.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 gb|AFW59275.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_154299 [Zea 
mays]
 gb|AFW71237.1| hypothetical protein ZEAMMB73_210614 [Zea mays]
Length=745

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVAI A+IGN LQGWDNATIA AV+YIKKE  L  E  +EGL+V+MSLIGAT++T
Sbjct  1    MSGAVLVAIVASIGNLLQGWDNATIAAAVLYIKKEFQLQNEPTVEGLIVSMSLIGATIVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPMLILSS+ YF SGLIMLWSPNVYVLL+AR +DGFGIGLAVTLVPLY
Sbjct  61   TFSGPLSDSIGRRPMLILSSILYFFSGLIMLWSPNVYVLLLARFVDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE APSEIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISEIAPSEIRGLLNTLPQFSGSGGMFLS  148



>gb|EPS65490.1| hypothetical protein M569_09283 [Genlisea aurea]
Length=734

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA LVAIAA IGNFLQGWDNATIA AVVYIK+E  L   +EGLVVA SLIGAT+ITTC
Sbjct  1    MKGAALVAIAAAIGNFLQGWDNATIAAAVVYIKREEHLGASVEGLVVATSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG+I+D +GRRPML+LSS+FYF+ GLIMLWSPNVY+LL+ARLLDGFGIGLAVTLVPLYIS
Sbjct  61   SGTISDAVGRRPMLVLSSVFYFIGGLIMLWSPNVYILLLARLLDGFGIGLAVTLVPLYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPS+IRGLLNTLPQFTGSGGMFL+
Sbjct  121  ETAPSDIRGLLNTLPQFTGSGGMFLS  146



>gb|EMT28528.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=531

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAI A IGN LQG DNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAITAAIGNMLQGVDNATIAGAVMYIKREFHLETQPAVEGLVVATSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +AD +GRRPMLI SS+ YFL GL+MLWSPNVYVLLIARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVADIVGRRPMLIASSLLYFLGGLVMLWSPNVYVLLIARLIDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNT PQFTGS GMF+A
Sbjct  121  ISETAPPEIRGLLNTFPQFTGSAGMFMA  148



>ref|XP_010548175.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548176.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548177.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548178.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
Length=742

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNFLQGWDNATIAGAVLYIKKEFDLESEPTIEGLIVATSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SS+ YF+  L MLWSPNVYVLL+ RLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYFVGALTMLWSPNVYVLLLGRLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGSGGMF++
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFIS  148



>gb|KDP47010.1| hypothetical protein JCGZ_10737 [Jatropha curcas]
Length=740

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+ A +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAVGNLLQGWDNATIAGAVLYIKREFQLESEPTIEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+I+DWLGRRPMLI+SS+ Y +SG++M WSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRPMLIISSVLYCVSGIVMFWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_002312798.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE86753.1| transporter-related family protein [Populus trichocarpa]
Length=740

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            MNGAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VA SL+GATLIT
Sbjct  1    MNGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFHLESEPTIEGLIVATSLVGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+D LGRRP+LI+SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGPISDCLGRRPLLIISSILYFVSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_007043079.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
 gb|EOX98910.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
Length=739

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFKLESDPTMEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYIISGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLS  148



>ref|XP_008349018.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=254

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGL VT+VPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLVVTVVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNT PQF GSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTXPQFLGSGGMFLS  148



>ref|NP_195256.3| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001154287.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 sp|Q8LPQ8.2|MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2; AltName: Full=Sugar 
transporter MSSP2 [Arabidopsis thaliana]
 emb|CAA18739.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAB80247.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAD58692.1| monosaccharide sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86494.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86495.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=729

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|NP_001151936.1| LOC100285573 [Zea mays]
 ref|XP_008680244.1| PREDICTED: LOC100285573 isoform X1 [Zea mays]
 gb|ACG45075.1| hexose transporter [Zea mays]
 tpg|DAA46098.1| TPA: hexose transporter isoform 1 [Zea mays]
 tpg|DAA46099.1| TPA: hexose transporter isoform 2 [Zea mays]
Length=747

 Score =   227 bits (579),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAV+VAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MGGAVMVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+ AD +GRRPML+ S++ YF+SGL+MLW+P+VY+LL+ARL+DGFGIGLAVTLVPLY
Sbjct  61   TFSGAAADCVGRRPMLVASAVLYFVSGLVMLWAPSVYILLLARLIDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_004144248.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_004171132.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN47521.1| hypothetical protein Csa_6G355400 [Cucumis sativus]
Length=729

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGAVLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG ++DW+GRRPMLILSS+ Y LSGLIMLWSPNV VL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVSDWVGRRPMLILSSLLYILSGLIMLWSPNVLVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMF++
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFIS  146



>gb|KDO68405.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=560

 Score =   224 bits (570),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = +1

Query  244  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  417
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  418  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  597
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  598  TLPQFTGSGGMFLA  639
            TLPQFTG  GMFLA
Sbjct  135  TLPQFTGCVGMFLA  148



>gb|KJB77474.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=629

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLS  148



>gb|AAO37640.1| putative sugar transporter type 2a [Saccharum hybrid cultivar 
Q117]
Length=745

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GA LVAI A+IGN LQGWDNATI+ A++YIKKE  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAALVAIVASIGNLLQGWDNATISAALLYIKKEFKLESEPTVEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DW+GR PMLILSS+ YF+S LIMLWSPNVYVLL+ARL++GFG+GLAVTLVPLY
Sbjct  61   TFSGPVSDWIGRLPMLILSSVLYFVSSLIMLWSPNVYVLLLARLINGFGVGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_006384856.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP62653.1| transporter-related family protein [Populus trichocarpa]
Length=739

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG I+D LGRRP+LI+SS+ YF+SGLIMLWSPNVYVLL+ARLLDGFGIGL+VTL+P+Y
Sbjct  61   MCSGPISDLLGRRPLLIISSVLYFVSGLIMLWSPNVYVLLLARLLDGFGIGLSVTLIPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLS  148



>ref|NP_849565.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001190923.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AAM19835.1| AT4g35300/F23E12_140 [Arabidopsis thaliana]
 gb|AEE86493.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86497.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=739

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_010090703.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB40422.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=740

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFHLESQPTLEGLIVATSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+IADWLGRRP+LI+SS+ YFLSG++MLWSPNVY LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLIISSILYFLSGILMLWSPNVYFLLLARLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF GSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLS  148



>ref|XP_002867077.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43336.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_006283193.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 ref|XP_006283194.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16091.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16092.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
Length=740

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TCSGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|NP_001190054.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 gb|AEE78799.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=737

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>ref|XP_007201798.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201799.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201800.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02997.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02998.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02999.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
Length=736

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+ A IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVVAAIGNLLQGWDNATIAASVLYIKKEFKLESEPAVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+IADWLGRRP+LI+SS+ YF SG++MLW+PNVY+LL+ARLLDGFGIGL VTLVPLY
Sbjct  61   TCSGAIADWLGRRPVLIISSVLYFFSGIVMLWAPNVYILLLARLLDGFGIGLVVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLS  148



>ref|NP_190717.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 sp|Q9SD00.1|MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3; AltName: Full=Sugar 
transporter MSSP3 [Arabidopsis thaliana]
 emb|CAB63013.1| sugar transporter-like protein [Arabidopsis thaliana]
 emb|CAD58693.1| monosaccharide sensing protein 3 [Arabidopsis thaliana]
 gb|AEE78798.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=729

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>ref|XP_008235816.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
 ref|XP_008235817.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=736

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKKEFKLESDPAVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TC+G+IADWLGRRP+LI+SS+ YFLSG++MLW+PNVY+LL+ARLLDGFGIGL VTLVPLY
Sbjct  61   TCAGAIADWLGRRPVLIISSVLYFLSGIVMLWAPNVYILLLARLLDGFGIGLVVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLS  148



>gb|KFK34392.1| hypothetical protein AALP_AA5G139300 [Arabis alpina]
Length=739

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YF+S ++M WSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFVSSIVMFWSPNVYVLLLARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>emb|CBI37732.3| unnamed protein product [Vitis vinifera]
Length=644

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLS  148



>ref|XP_008464819.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464820.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464821.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464822.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
Length=729

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GA+LVA+AA++GNFLQGWDNATIAGA+VYIKK++VL + +EGL+VA+SLIGAT+ITTC
Sbjct  1    MKGALLVALAASVGNFLQGWDNATIAGAMVYIKKDMVLNSSVEGLIVAISLIGATIITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG ++DW+GRRPMLILSS+ Y LSGLIMLWSPNV VL IARLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVSDWVGRRPMLILSSLLYILSGLIMLWSPNVLVLCIARLLDGFGIGLAVTLVPVYIS  120

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRGLLNTLPQFTGSGGMF++
Sbjct  121  ETAPSEIRGLLNTLPQFTGSGGMFIS  146



>ref|XP_009763350.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763351.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763352.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=734

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFISGLVMLWSPNVYVLLLARLLDGFGVGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTG  GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCLGMFFS  148



>ref|XP_008812559.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812567.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812574.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812580.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=745

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA+IGN LQGWDNATIA AV+YIK+E  LE+   MEGL+VAMSLIGA +IT
Sbjct  1    MRGAVLVAIAASIGNLLQGWDNATIAVAVLYIKREFNLESEPTMEGLIVAMSLIGAMIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
              SG+I+DW GRRPMLI+SS+FY  SGL+MLWSPNV +LL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   MFSGAISDWGGRRPMLIVSSIFYLFSGLVMLWSPNVCILLLARLIDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLS  148



>gb|AFP89954.1| tonoplastic transporter 2 [Vitis vinifera]
Length=739

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLS  148



>ref|XP_009333794.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG++ADWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLS  148



>ref|XP_002282975.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37148.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=739

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLS  148



>ref|XP_002877807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54066.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   V VA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVFVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>emb|CAN80213.1| hypothetical protein VITISV_042076 [Vitis vinifera]
Length=739

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLQGEPTVEGLIVAMSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++DWLGRRPMLI+SS+FYF+SGL+MLWSPNVYVLL+ARLLDGFG+GL+VT+VP+Y
Sbjct  61   TISGAVSDWLGRRPMLIISSLFYFVSGLVMLWSPNVYVLLLARLLDGFGVGLSVTIVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSVGMFLS  148



>ref|XP_009341490.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG++ADWLGRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLS  148



>ref|XP_009103100.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 ref|XP_009103156.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 emb|CDX75492.1| BnaA01g02100D [Brassica napus]
Length=740

 Score =   225 bits (573),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>gb|KJB77472.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
 gb|KJB77475.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=740

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFLS  148



>gb|AIN39841.1| hypothetical protein [Zoysia matrella]
Length=744

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 126/137 (92%), Gaps = 2/137 (1%)
 Frame = +1

Query  235  TIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLG  408
            +IGN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT+ITT SG ++DW+G
Sbjct  12   SIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIITTFSGPVSDWIG  71

Query  409  RRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRG  588
            RRPMLILSS+ YF+S LIMLWSPNVYVLL+ARL+DGFGIGLAVTLVPLYISETAP EIRG
Sbjct  72   RRPMLILSSVLYFVSSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLYISETAPPEIRG  131

Query  589  LLNTLPQFTGSGGMFLA  639
            LLNTLPQF+GSGGMFL+
Sbjct  132  LLNTLPQFSGSGGMFLS  148



>gb|KJB12352.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=592

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLP+FTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPEFTGSIGMFLS  148



>ref|XP_006486570.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486571.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Citrus 
sinensis]
Length=732

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = +1

Query  244  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  417
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  418  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  597
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIISSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  598  TLPQFTGSGGMFLA  639
            TLPQFTG  GMFLA
Sbjct  135  TLPQFTGCVGMFLA  148



>ref|XP_006422393.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
 gb|ESR35633.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
Length=732

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = +1

Query  244  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  417
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  418  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  597
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  598  TLPQFTGSGGMFLA  639
            TLPQFTG  GMFLA
Sbjct  135  TLPQFTGCVGMFLA  148



>gb|KDO68402.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68403.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68404.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=732

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = +1

Query  244  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  417
            N LQGWDNATIAGAV+YIK+E  LET   +EGL+VAMSLIGAT ITTCSG+IADWLGRRP
Sbjct  15   NLLQGWDNATIAGAVLYIKREFHLETEPTIEGLIVAMSLIGATCITTCSGAIADWLGRRP  74

Query  418  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  597
            MLI+SS+ YF+ GL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP EIRGLLN
Sbjct  75   MLIVSSVLYFIGGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPIYISETAPPEIRGLLN  134

Query  598  TLPQFTGSGGMFLA  639
            TLPQFTG  GMFLA
Sbjct  135  TLPQFTGCVGMFLA  148



>gb|KCW64229.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=739

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+IADWLGRRP+LI+SS+FYF  GL+MLWSPNVYVLL+AR LDG G+GLAVTLVPLY
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYFAGGLVMLWSPNVYVLLLARFLDGLGVGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGS GMF++
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSAGMFMS  148



>ref|XP_010066352.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066353.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066354.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066355.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW64228.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=740

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAV VA+AA +GN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVWVAVAAAVGNLLQGWDNATIAGAVLYIKREFDLESEPALEGLIVAMSLIGATLVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+IADWLGRRP+LI+SS+FYF  GL+MLWSPNVYVLL+AR LDG G+GLAVTLVPLY
Sbjct  61   TCSGAIADWLGRRPLLIISSVFYFAGGLVMLWSPNVYVLLLARFLDGLGVGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGS GMF++
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSAGMFMS  148



>ref|XP_010678631.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678632.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+ AVLVAIAAT+G+ L GWDNATIAGAV+YIKKE  LE+   +EGL+VA S+IGATLIT
Sbjct  1    MSAAVLVAIAATVGDLLYGWDNATIAGAVLYIKKEFNLESSPTLEGLIVATSIIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG IAD LGRRPM+I+SS+ +F+S LIMLWSPNVYVLL  RLLDGFG GLAVTL PLY
Sbjct  61   TCSGPIADRLGRRPMMIISSVCFFVSALIMLWSPNVYVLLFGRLLDGFGSGLAVTLGPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRG LNTLPQFTGSGGMFLA
Sbjct  121  ISETAPTDIRGSLNTLPQFTGSGGMFLA  148



>emb|CDX69128.1| BnaC01g03250D [Brassica napus]
Length=683

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF GSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLS  148



>ref|XP_009392211.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFKLEGQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++DW+GRRPMLI+SS+ YF+SGLIM WSPNVY+LL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TFSGAVSDWIGRRPMLIISSVLYFISGLIMFWSPNVYMLLLARLIDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_004983796.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=739

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA+IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VAMSL GAT++T
Sbjct  1    MGGAVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLFGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG++AD +GRRPMLI S++ YF+SGL MLW+P+VYVLL+ARL+DG GIGLAVTLVPLY
Sbjct  61   TFSGALADSIGRRPMLIASAVLYFVSGLFMLWAPSVYVLLLARLIDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRGLLNTLPQF+GSGGMFL+
Sbjct  121  ISETAPTDIRGLLNTLPQFSGSGGMFLS  148



>ref|XP_009340799.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
 ref|XP_009340800.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   MEGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAMEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFLGSGGMFLS  148



>gb|KHG04801.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22589.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=740

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKREFSLESEPTIEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRPMLI+SS+ Y +SGL+MLWSPNVY+LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TCSGGISDWLGRRPMLIISSVLYCVSGLVMLWSPNVYILLLARLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSIGMFFS  148



>emb|CDY65623.1| BnaCnng48010D [Brassica napus]
Length=675

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+GL VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQF GSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFAGSGGMFLS  148



>ref|XP_009608796.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608797.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608798.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=734

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IG+FLQGWDNATIAG ++YIKKE  LET   MEGL+V+MSLIGA LIT
Sbjct  1    MSGAVLVAVAAAIGSFLQGWDNATIAGGILYIKKEFKLETQPTMEGLIVSMSLIGAVLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+IADWLGRRP+LI SS+ YF+SGL+MLWSPNVYVLL+ARLLDGFG+GLAV LVP+Y
Sbjct  61   TCSGAIADWLGRRPLLITSSVLYFVSGLVMLWSPNVYVLLLARLLDGFGVGLAVILVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTG  GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGCLGMFFS  148



>emb|CDP01766.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA +GNF+QGWDNATIAG+V+YIK+E  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAVVGNFVQGWDNATIAGSVLYIKREFNLQTQPTVEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SGS+ADWLGRRPML++SS+ YFL GL+MLW+PNVYVLL+ RLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGSVADWLGRRPMLVISSVLYFLGGLVMLWAPNVYVLLLGRLLDGFGVGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP+EIRGLLNTLPQF GS GMFL+
Sbjct  121  ISETAPTEIRGLLNTLPQFAGSAGMFLS  148



>gb|KJB12354.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=758

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  25   MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  84

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  85   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  144

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLP+FTGS GMFL+
Sbjct  145  ISETAPPEIRGLLNTLPEFTGSIGMFLS  172



>gb|KJB12351.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
 gb|KJB12353.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=734

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA IGNFLQGWD ATIAGAV+Y+K+E  LE+   +EGL++AMSLIGAT IT
Sbjct  1    MGGAVLVAVAAAIGNFLQGWDTATIAGAVLYVKREFKLESEPTIEGLIIAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG I+DWLGRRP+LI+SS+FYFLSG++M+WSPNVY+LL+ RL+DGFG+GLAVTLVP+Y
Sbjct  61   TCSGYISDWLGRRPLLIISSVFYFLSGIVMIWSPNVYILLLGRLMDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLP+FTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPEFTGSIGMFLS  148



>ref|XP_010270527.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
 ref|XP_010270528.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
Length=740

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MRGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFKLESEPTIEGLIVAMSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DWLGRRPM+I+SS+ YF+S +IMLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMMIISSVLYFISSIIMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFS  148



>ref|XP_011099908.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011099909.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=709

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  L  E  +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLQSEPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG ++DWLGRRPMLILSS+ Y LSGL+MLWSPNV VLL+ARL+DGFGIGLAVTLVP+Y
Sbjct  61   TCSGPVSDWLGRRPMLILSSVLYCLSGLVMLWSPNVSVLLLARLMDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTG+ GMF++
Sbjct  121  ISETAPPEIRGLLNTLPQFTGAAGMFMS  148



>ref|XP_011040809.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040810.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040811.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSL+GATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESEPAIEGLIVAMSLVGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG I+D LGRRP+LI+SS+ YF+SGLIMLWSPNV VLL+ARLLDGFGIGLAVTL+P+Y
Sbjct  61   MCSGPISDMLGRRPLLIISSVLYFISGLIMLWSPNVSVLLLARLLDGFGIGLAVTLIPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_010446942.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446943.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446944.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
Length=739

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG +AD LGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_010437493.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG +AD LGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_011098017.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098018.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098019.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=711

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 134/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAG+V+YIK+E  L+    +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGSVLYIKREFDLQRQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DWLGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFLS  148



>ref|XP_010432297.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
 ref|XP_010432298.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG +AD LGRRPMLILSS  YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TCSGGVADLLGRRPMLILSSFLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>ref|XP_009359631.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=742

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFS  148



>ref|XP_006412119.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412120.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412121.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53572.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53573.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53574.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
Length=734

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   MEGL+VAMSLIGATLIT
Sbjct  1    MSGAVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFHLESNPSMEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +ADWLGRRPMLILSS+ YF+  L+MLWSPNVYVLL+ RLLDGFG+G+ VTLVP+Y
Sbjct  61   TWSGGVADWLGRRPMLILSSVLYFVGSLVMLWSPNVYVLLLGRLLDGFGVGIVVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLS  148



>ref|XP_009359629.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=753

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFS  148



>ref|XP_009359630.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VAIAA IGN LQGWDNATIAGAV+YIK+E  LE+   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVFVAIAAAIGNLLQGWDNATIAGAVLYIKREFKLESQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDSLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFFS  148



>gb|KHN33643.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=734

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSAGMFFS  148



>ref|XP_003543932.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=734

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPSEIRGLLNTLPQFTGSAGMFFS  148



>ref|XP_004289029.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011461449.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 2/135 (1%)
 Frame = +1

Query  241  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  414
            GN LQGWDNATIAGAV+YIKKE  LET   +EGL+VAMSLIGAT+ITT SG ++D LGRR
Sbjct  14   GNLLQGWDNATIAGAVLYIKKEFKLETQPTIEGLIVAMSLIGATVITTFSGPVSDSLGRR  73

Query  415  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  594
            PMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+YISETAP +IRGLL
Sbjct  74   PMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVYISETAPPDIRGLL  133

Query  595  NTLPQFTGSGGMFLA  639
            NTLPQFTGSGGMF +
Sbjct  134  NTLPQFTGSGGMFFS  148



>ref|XP_011022133.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011022134.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=719

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++D  GRRPMLI+SS+ Y LS +I+LW+PNVYVLL+ARLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLSSIIILWAPNVYVLLLARLLDGFGVGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSE+RG LNTLPQF GSGGMFL+
Sbjct  121  ISETAPSEMRGQLNTLPQFMGSGGMFLS  148



>ref|XP_002306419.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
 gb|EEE93415.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
Length=719

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AAT+GN LQGWDN+TIAG++ YIK+EL L++   +EGL+VAMS+IG T IT
Sbjct  1    MRGAVLVALAATVGNLLQGWDNSTIAGSIPYIKEELNLQSQPAVEGLIVAMSIIGGTTIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG+++D  GRRPMLI+SS+ Y LS +I+LW+PNVYVLL+ARLLDGFG+GLAVTLVPLY
Sbjct  61   TFSGTVSDIFGRRPMLIMSSILYLLSSIIILWAPNVYVLLLARLLDGFGVGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSE+RG LNTLPQF GSGGMFL+
Sbjct  121  ISETAPSEMRGQLNTLPQFMGSGGMFLS  148



>dbj|BAI94493.1| sugar transporter [Dianthus caryophyllus]
Length=733

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M+GAV VAIAATIGNFLQGWDNATIAGAV+YIKKE  LE+   MEG+++AM+LIG+T+IT
Sbjct  1    MSGAVWVAIAATIGNFLQGWDNATIAGAVLYIKKEFHLESDPKMEGILLAMALIGSTIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSGS++DWLGRR M+I S++ + +S +IMLWSPN+YVLL+ARL+DGFG GLAVTLVPLY
Sbjct  61   TCSGSVSDWLGRRLMMISSAICFIVSAVIMLWSPNIYVLLLARLVDGFGGGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP+E RGLLNT+PQF  + GMFL+
Sbjct  121  ISETAPTETRGLLNTVPQFAVAAGMFLS  148



>ref|XP_009776539.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009776540.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=722

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAV+VA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVVVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SGS++D  GRRPMLI+SS+FYFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGSVSDMFGRRPMLIISSVFYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNT PQFTG  GMFL+
Sbjct  121  ISETAPPEIRGRLNTFPQFTGCVGMFLS  148



>ref|XP_008382498.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008382499.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   218 bits (556),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEPAVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG++ADWLGRRP LI+SS+ YFLSGL+MLWSPNVY+LL+ARLLDGFGIGL VT+VPLY
Sbjct  61   FCSGAVADWLGRRPTLIVSSVLYFLSGLVMLWSPNVYILLLARLLDGFGIGLVVTVVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFLGSGGMFLS  148



>ref|XP_003526737.1| PREDICTED: monosaccharide-sensing protein 2-like isoform 1 [Glycine 
max]
Length=738

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+++D LGRRPMLI+SSM YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSMLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSLGMFFS  148



>ref|XP_004139974.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN46648.1| hypothetical protein Csa_6G118280 [Cucumis sativus]
Length=733

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+G+VLVA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+I+DWLGRR +LILSS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFS  148



>ref|NP_001067890.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|ABA93553.1| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28253.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|EAZ18344.1| hypothetical protein OsJ_33873 [Oryza sativa Japonica Group]
 dbj|BAH00841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=757

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPMLI SS+ YF  GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYFAGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISET+P EIRG LNTLPQFTGSGGMF++
Sbjct  121  ISETSPPEIRGRLNTLPQFTGSGGMFMS  148



>gb|EAY80902.1| hypothetical protein OsI_36080 [Oryza sativa Indica Group]
Length=763

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA IGN+LQGWDNATIAGAV+YIK+E  LET   +EGLVVAMSLIGAT+IT
Sbjct  1    MRGAVLVAVAAAIGNYLQGWDNATIAGAVLYIKREFALETQPAVEGLVVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPMLI SS+ YF  GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDLVGRRPMLIASSLLYFAGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISET+P EIRG LNTLPQFTGSGGMF++
Sbjct  121  ISETSPPEIRGRLNTLPQFTGSGGMFMS  148



>gb|EYU30848.1| hypothetical protein MIMGU_mgv1a001984mg [Erythranthe guttata]
Length=730

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  L++   +EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFDLQSQPKIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++DWLGRRPMLI SS+ YFLSGL+MLW+PNV +LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDWLGRRPMLIASSILYFLSGLVMLWAPNVEILLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSVGMFLS  148



>ref|XP_009622210.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622211.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622212.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=722

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  L+T   +EGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVALAAAIGNLLQGWDNATIAGAVLYIKKEFNLQTQPTIEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNT PQFTG  GMFL+
Sbjct  121  ISETAPPEIRGRLNTFPQFTGCVGMFLS  148



>ref|NP_001280690.1| monosaccharide-sensing protein 2-like [Solanum lycopersicum]
 dbj|BAO96236.1| tonoplast monosaccharide transporter 1 [Solanum lycopersicum]
Length=725

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNT PQFTGS GMFL+
Sbjct  121  ISETAPPEIRGQLNTFPQFTGSLGMFLS  148



>ref|XP_009775817.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775879.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775941.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=721

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNT PQFTG  GMFL+
Sbjct  121  ISETAPPEIRGQLNTFPQFTGCVGMFLS  148



>ref|XP_009589978.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009589979.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=721

 Score =   216 bits (549),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLIALAAAIGNLLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLWSPNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWSPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNT PQFTG  GMFL+
Sbjct  121  ISETAPPEIRGQLNTFPQFTGCVGMFLS  148



>ref|XP_008448165.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448166.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448167.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448168.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448169.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448170.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448171.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
Length=733

 Score =   216 bits (550),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+G+VLVA+AA +GNFLQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNFLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+I+DWLGRR +LI SS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLIFSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFS  148



>ref|XP_006343319.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343320.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=722

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVL+A+AA IGN LQGWDNATIAG+V+YIKKE  L+T   MEGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLIALAAAIGNMLQGWDNATIAGSVLYIKKEFNLQTQPTMEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPMLI+SS+ YFLSGL+MLW+PNVYVLL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDMLGRRPMLIISSVLYFLSGLVMLWAPNVYVLLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNT PQFTGS GMFL+
Sbjct  121  ISETAPPEIRGQLNTFPQFTGSLGMFLS  148



>ref|XP_007137297.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
 gb|ESW09291.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
Length=739

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GA+LVA+AA IGN LQGWDNATIAG+++YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAILVAVAAAIGNLLQGWDNATIAGSILYIKREFQLESQPTVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+++D LGRRPMLI+SS+ YF+S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSLLYFVSSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFFS  148



>ref|XP_010690557.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690558.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIAGAV+YIKKE  LE    MEGL+VAMSLIGAT+IT
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLEGAPTMEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG ++D  GRRPM+I+SS+ +F S LIMLWSPNVYVLL+ RLLDGFG GLAVTLVPLY
Sbjct  61   TCSGPVSDRFGRRPMMIISSICFFFSALIMLWSPNVYVLLLGRLLDGFGSGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP++IRG LNTLPQFTGSGGMF+A
Sbjct  121  ISETAPTDIRGSLNTLPQFTGSGGMFVA  148



>ref|XP_008377843.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008377844.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAASVLYIKREFNLESEXAVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
             CSG++ADWLGRRPMLI+SS+FYFLSG++MLW    Y+LL+AR LDGFGIGLAVTLVPLY
Sbjct  61   FCSGAVADWLGRRPMLIISSVFYFLSGIVMLWXXXXYILLLARXLDGFGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSGGMFLS  148



>ref|XP_004154526.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=733

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 132/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+G+VLVA+AA +GN LQGWDNATIAGAV+YIKKE  LE+   +EGL+VA SLIGAT+IT
Sbjct  1    MSGSVLVAVAAAVGNLLQGWDNATIAGAVLYIKKEFNLESSPTVEGLIVATSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+I+DWLGRR +LILSS+ YF+ G+IMLWSPNVY+LL+ RLLDGFGIGLAVTLVP+Y
Sbjct  61   TCSGAISDWLGRRLLLILSSVLYFIGGIIMLWSPNVYILLLGRLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGSLNTLPQFTGSAGMFFS  148



>gb|KHN46863.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=717

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAVLVA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVLVAVAAAIGNLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG ++D LGRRPMLI+SS+ YF+  L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGPLSDLLGRRPMLIISSILYFVGSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSAGMFFS  148



>ref|XP_004500684.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500685.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIKKE  LE    +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKKEFQLENEPTVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+++D LGRRPMLI+SS+ YF+S L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLLGRRPMLIISSVLYFVSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE AP EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISEIAPPEIRGLLNTLPQFTGSAGMFFS  148



>ref|XP_003560303.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=770

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET+  +EGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKREFHLETHPAIEGLVVATSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +AD +GRRPMLI SS+ YFL GLIMLWSPNVYVLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVADMVGRRPMLIASSILYFLGGLIMLWSPNVYVLLLARLVDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GM ++
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSWGMCMS  148



>ref|XP_004954530.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=707

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LE +  MEGLVVA SLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLEAHPAMEGLVVATSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPMLI SS+ YF +GL+MLWSPNV+VLL++RL+DGF IGLAVTLVP+Y
Sbjct  61   TFSGPVSDSVGRRPMLIASSLLYFAAGLLMLWSPNVHVLLLSRLVDGFAIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSGGMFLS  148



>gb|KGN49001.1| hypothetical protein Csa_6G509700 [Cucumis sativus]
Length=768

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  181  LDSGLLRMNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSL  354
            L    LRM GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSL
Sbjct  40   LSPSRLRMRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSL  99

Query  355  IGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLA  534
            IGAT+ITT SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLA
Sbjct  100  IGATVITTFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLA  159

Query  535  VTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            VTLVP+YISETAP+EIRGLLNTLPQFTGS GMFL+
Sbjct  160  VTLVPVYISETAPAEIRGLLNTLPQFTGSIGMFLS  194



>ref|XP_003518591.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006575765.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006575766.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Glycine 
max]
 gb|KHN29885.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=711

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 118/134 (88%), Gaps = 2/134 (1%)
 Frame = +1

Query  244  NFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLITTCSGSIADWLGRRP  417
            N LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++TTCSG ++D+LGRRP
Sbjct  17   NLLQGWDNATIAGSILYIKREFNLQSEPTIEGLIVAMSLIGATVVTTCSGPLSDFLGRRP  76

Query  418  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  597
            MLI+SS+ YF S L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLYISETAP EIRGLLN
Sbjct  77   MLIISSVLYFASSLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLYISETAPPEIRGLLN  136

Query  598  TLPQFTGSGGMFLA  639
            TLPQFTGS GMF +
Sbjct  137  TLPQFTGSAGMFFS  150



>gb|EYU40481.1| hypothetical protein MIMGU_mgv1a001997mg [Erythranthe guttata]
Length=728

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 116/135 (86%), Gaps = 2/135 (1%)
 Frame = +1

Query  241  GNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRR  414
            GN LQGWDNAT+AGA++YIKKE   E    MEGL VAMSLIGATLIT CSG I+DWLGRR
Sbjct  14   GNLLQGWDNATMAGAIIYIKKEFEWENEPTMEGLSVAMSLIGATLITLCSGGISDWLGRR  73

Query  415  PMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLL  594
            PMLI+SSMFYF+SG++MLWSPNVY LL ARLLDGFGIGLAVT VPLYISE +P EIRG+L
Sbjct  74   PMLIVSSMFYFVSGVLMLWSPNVYSLLCARLLDGFGIGLAVTFVPLYISEMSPPEIRGVL  133

Query  595  NTLPQFTGSGGMFLA  639
            +TL QFT S G+FL+
Sbjct  134  STLSQFTYSSGIFLS  148



>ref|XP_010028861.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Eucalyptus grandis]
Length=730

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+ AVL+A+ A  GN LQGWDNATIAGA++YIK+E  LE+   +EGL+VA+SL+GA L+T
Sbjct  1    MSRAVLIAVVAAFGNLLQGWDNATIAGAILYIKREFHLESEPAVEGLIVAISLLGAILVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG++AD +GRRPML++SS FY +SGL+M WSPN+Y LL+AR + GFG+GL VTLVPLY
Sbjct  61   TCSGAMADCIGRRPMLVMSSHFYLISGLLMFWSPNLYALLLARFVGGFGVGLTVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            +SE AP EIRGLLNTLPQF+GS GMF++
Sbjct  121  VSELAPPEIRGLLNTLPQFSGSCGMFVS  148



>ref|XP_004134823.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
Length=722

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP+EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFLS  148



>ref|XP_008440928.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Cucumis melo]
Length=725

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V++LL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMITSSILYFTSGLVMLWAPDVHILLLARLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP+EIRGLLNTLPQFTGS GMFL+
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFLS  148



>ref|XP_006403910.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
 gb|ESQ45363.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
Length=739

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MQSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR ML+LSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLVLSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>ref|XP_004289030.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=714

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VA+AA IGN LQGWDN+ IAG+V+YIKKE  LE+    EGL+VA SLIGAT+IT
Sbjct  1    MRGAVYVAVAAAIGNMLQGWDNSVIAGSVLYIKKEFSLESKPTFEGLIVATSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG  +DWLGRR MLI+SS+ +FLSGL+MLWSPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIMSSLLFFLSGLVMLWSPNVYVLLYARLLDGFGTGLAVTLVPAY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE AP +IRG LNTLPQFTGS GMFL+
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSAGMFLS  148



>ref|XP_004169167.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2-like [Cucumis sativus]
Length=722

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLE--TYMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIKKE  LE     EGL+VAMSLIGAT+IT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVMYIKKEFKLEGDPTTEGLIVAMSLIGATVIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRP++I SS+ YF SGL+MLW+P+V+VLL+ARLLDGFG+GLAVTLVP+Y
Sbjct  61   TFSGPLSDSVGRRPLMIASSILYFTSGLVMLWAPDVHVLLLARLLDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP+EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPAEIRGLLNTLPQFTGSIGMFXS  148



>ref|XP_009148978.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=741

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>gb|KJB31963.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31964.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31965.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31966.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31967.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
Length=737

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSGS++DWLGRRP+LI+SS+ YFLSG++MLW+PNV  LL+ARLLDG GIGLAVTL+P+Y
Sbjct  61   TCSGSLSDWLGRRPILIISSLLYFLSGIVMLWAPNVPTLLLARLLDGLGIGLAVTLIPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLP F+G  GMFL+
Sbjct  121  ISETAPPEIRGFLNTLPLFSGCLGMFLS  148



>ref|XP_006292750.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
 gb|EOA25648.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
Length=729

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGATLIT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>ref|XP_010097645.1| Monosaccharide-sensing protein 3 [Morus notabilis]
 gb|EXB70345.1| Monosaccharide-sensing protein 3 [Morus notabilis]
Length=737

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VAI A IGN LQGWDN+ IAG+++YIKKE  LE    +EGL++A SLIG TLIT
Sbjct  1    MKGAVAVAIVAAIGNLLQGWDNSVIAGSLLYIKKEFNLERKPTLEGLIIATSLIGGTLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPMLI+SS+ +F SGL+MLW+PNVY+LL+ARLLDGFG GLAVTLVP+Y
Sbjct  61   TVSGPVSDRVGRRPMLIMSSVLFFFSGLVMLWAPNVYMLLVARLLDGFGTGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGSGGMFL+
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSGGMFLS  148



>emb|CDY33276.1| BnaA01g19430D [Brassica napus]
Length=668

 Score =   204 bits (519),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>ref|XP_010515555.1| PREDICTED: monosaccharide-sensing protein 3 [Camelina sativa]
Length=738

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>ref|XP_010503840.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=740

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>ref|XP_010426703.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=738

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>emb|CDX78009.1| BnaA09g32040D [Brassica napus]
Length=669

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>emb|CDY16303.1| BnaC01g23380D [Brassica napus]
Length=670

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLVA+ A IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVALTAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDRVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>ref|XP_004290074.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458100.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVAIAA +GN LQGWDNATIA +V+YIK+E  LE+   +EGL+VAMSLIGATL+T
Sbjct  1    MSGAVLVAIAAAVGNLLQGWDNATIAASVLYIKREFNLESQPAVEGLIVAMSLIGATLVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG++ADW+GRRPMLI+SS+ YFLSG++MLWSPNVY+LL+ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGAVADWIGRRPMLIISSVLYFLSGIVMLWSPNVYILLLARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQF GSGGMFL+
Sbjct  121  ISETAPPEIRGSLNTLPQFAGSGGMFLS  148



>ref|XP_009115837.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=731

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS ++M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>emb|CDX73717.1| BnaC08g22860D [Brassica napus]
Length=681

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   VLV++AA IGN LQGWDNATIAGAV+YIKKE  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MRSVVLVSLAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATMIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRR MLILSS+ YFLS L+M WSPNVYVLL ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TFSGPVSDKVGRRSMLILSSLLYFLSSLVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNT PQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTFPQFCGSGGMFLS  148



>gb|KDP43790.1| hypothetical protein JCGZ_22417 [Jatropha curcas]
Length=729

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA +GN LQGWDN+TIAG+++YIKKE  L+T   MEGL+ AMSLIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNSTIAGSLLYIKKEFNLQTQPTMEGLIAAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D  GRRP++I+S++ YFLSGL+M W+PNVYVLL+ RLL+GFGIGLAVT+VP+Y
Sbjct  61   TFSGPVSDIYGRRPLMIISAIMYFLSGLVMFWAPNVYVLLLGRLLNGFGIGLAVTIVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRG LNT PQF GSGGMF++
Sbjct  121  ISETAPSEIRGQLNTFPQFMGSGGMFVS  148



>gb|EPS57524.1| hypothetical protein M569_17293, partial [Genlisea aurea]
Length=693

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA +GN LQGWDNATIAGAV+Y+K+E  LE+   +EGL+VA SLIGAT IT
Sbjct  1    MKGAVLVAIAAAVGNLLQGWDNATIAGAVLYVKREFHLESQPTVEGLIVATSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG  +D  GRRPML+LSS+ YF+SG++MLW+P+V +LL+ARLLDGFGIGLAVTLVP+Y
Sbjct  61   TISGPASDSFGRRPMLLLSSILYFVSGIVMLWAPSVEILLLARLLDGFGIGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQFTGS GMFL+
Sbjct  121  ISETAPPEIRGTLNTLPQFTGSVGMFLS  148



>ref|XP_009359632.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 122/148 (82%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VA+AA IGN LQGWDN+ IAG+VVYIKKE  LE+    EGL+ A SLIGAT IT
Sbjct  1    MRGAVFVAVAAAIGNLLQGWDNSVIAGSVVYIKKEFELESEPTFEGLIAASSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG  +DWLGRR MLI+SS+ +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSVLFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE AP +IRG LNTLPQFTGSGGMFL+
Sbjct  121  ISEIAPPDIRGRLNTLPQFTGSGGMFLS  148



>ref|XP_010029563.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56481.1| hypothetical protein EUGRSUZ_I02209 [Eucalyptus grandis]
Length=738

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAATIG  LQGWD +TIAG+V+YIK E  L+    +EGL+VAMSLIG+T IT
Sbjct  1    MRGAVLVAIAATIGTMLQGWDGSTIAGSVLYIKGEFDLQEQPTIEGLIVAMSLIGSTAIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D LGRRPM+I+ S+  F S LIMLW+PNVYVLL+ RL  GFGIG+A+TLVP+Y
Sbjct  61   TFSGPLSDSLGRRPMMIICSVLSFASALIMLWAPNVYVLLLGRLFSGFGIGIAITLVPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRG LNT+PQF  S GMFL+
Sbjct  121  ISETAPSEIRGQLNTIPQFANSSGMFLS  148



>gb|KHG14026.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=737

 Score =   202 bits (514),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M+GAVLVA+ ATIGN LQGWD+ATIAGAV+YIKKE  LE+   +EGL+VAMSLIGAT IT
Sbjct  1    MSGAVLVALTATIGNLLQGWDSATIAGAVMYIKKEFKLESEPAIEGLIVAMSLIGATCIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSGS++DWLGRRP+LI+SS+ Y LSG++MLW+PNV  LL+ARLLDG GIGLAVTL+P+Y
Sbjct  61   TCSGSMSDWLGRRPILIISSLLYCLSGIVMLWAPNVPTLLLARLLDGLGIGLAVTLIPIY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLP F+G  GMFL+
Sbjct  121  ISETAPPEIRGFLNTLPLFSGCLGMFLS  148



>ref|XP_008786687.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786688.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786689.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786690.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=744

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 133/148 (90%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IG+ LQGWD+AT+AGAV+YI +E  LE    +EGL+VAMSLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGSLLQGWDSATMAGAVLYINREFKLEADPTIEGLIVAMSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            + SG+++DW+GRRP+LI++++  FLSGL+MLWSPNVY+LL+ARL+ GFG+G+AVTLVP+Y
Sbjct  61   SFSGALSDWVGRRPVLIVAAVLTFLSGLVMLWSPNVYILLLARLIYGFGVGIAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAPSEIRGLLNTLPQF GSGGMFL+
Sbjct  121  ISETAPSEIRGLLNTLPQFCGSGGMFLS  148



>ref|XP_002532480.1| sugar transporter, putative [Ricinus communis]
 gb|EEF29904.1| sugar transporter, putative [Ricinus communis]
Length=536

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVA+AA +GN LQGWDNATIAG+++YIK+E  L+T   MEGL+ A++LIGAT+IT
Sbjct  1    MRGAVLVALAAAVGNMLQGWDNATIAGSLLYIKREFNLQTQPTMEGLIAAVALIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
              +G ++D LGRRPMLI+S++ YFLSGL+M+W+PNVY+L++ R+LDGFG GLAVTLVP+Y
Sbjct  61   IFTGPVSDLLGRRPMLIISAIMYFLSGLVMVWAPNVYILILGRVLDGFGTGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNT PQF GSGGMF++
Sbjct  121  ISETAPPEIRGQLNTFPQFMGSGGMFVS  148



>ref|XP_004978456.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Setaria 
italica]
 ref|XP_004978457.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Setaria 
italica]
 ref|XP_004978458.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Setaria 
italica]
Length=710

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GAVLVA+AA IGN LQGWDNATIAGAV+YIKKE  L  E  +EGL+VA SLIGAT +T
Sbjct  1    MGGAVLVAVAAAIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVATSLIGATAVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T +G++AD +GRRP+LI S++ YF+SGL+MLW+P+VYVLL+ARL+DG GIGLA+T+VPLY
Sbjct  61   TIAGAVADSIGRRPVLIASAVLYFVSGLVMLWAPSVYVLLLARLIDGLGIGLALTIVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP+EIRG LNTLPQF  +GGMFL+
Sbjct  121  ISETAPTEIRGSLNTLPQFNATGGMFLS  148



>ref|XP_007203009.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
 gb|EMJ04208.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
Length=738

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG  +DWLGRR MLI+SS  +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE AP +IRG LNTLPQFTGSGGMFL+
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSGGMFLS  148



>ref|XP_008242155.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=738

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAV VA+AA +GN LQGWDN+ IAG+V YIKKE  LE+    EGL+VA SLIGAT IT
Sbjct  1    MRGAVFVAVAAAVGNLLQGWDNSVIAGSVHYIKKEFELESQPTFEGLIVATSLIGATFIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG  +DWLGRR MLI+SS  +F+SGL+ML SPNVYVLL ARLLDGFG GLAVTLVP Y
Sbjct  61   TFSGPASDWLGRRTMLIISSALFFISGLVMLLSPNVYVLLFARLLDGFGTGLAVTLVPAY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE AP +IRG LNTLPQFTGSGGMFL+
Sbjct  121  ISEIAPPDIRGTLNTLPQFTGSGGMFLS  148



>gb|KHN20087.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=712

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 111/146 (76%), Gaps = 25/146 (17%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTC  381
            M GAVLVAIAA+IGNFLQGWDNATIAGA+VYIKK+L LET MEGLVVAMSLIGAT+ITTC
Sbjct  1    MKGAVLVAIAASIGNFLQGWDNATIAGAIVYIKKDLALETTMEGLVVAMSLIGATVITTC  60

Query  382  SGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYIS  561
            SG +ADW                              LI+RLLDGFGIGLAVTLVP+YIS
Sbjct  61   SGPVADWTHDDN-------------------------LISRLLDGFGIGLAVTLVPVYIS  95

Query  562  ETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ETAPSEIRG LNTLPQF+GSGGMFL+
Sbjct  96   ETAPSEIRGSLNTLPQFSGSGGMFLS  121



>ref|XP_004964709.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=748

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGLVVA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNMLQGWDNATIAGAVLYIKREFHLETQPALEGLVVATSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPMLI SS+ YF  GLIM+WSPNV VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDNVGRRPMLIASSLLYFAGGLIMMWSPNVVVLLLARLVDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSFGMFFS  148



>gb|KEH36403.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=645

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+++D  GRRPMLI+SS+ YFLS L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLFGRRPMLIISSLLYFLSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE AP EIRG LNTLPQF GS GMF +
Sbjct  121  ISEIAPPEIRGSLNTLPQFAGSAGMFFS  148



>gb|EMS60524.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=407

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M GA LVA+AA +GN LQGWDNATIAG+++YIK++  L  +  ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLHGQPALQGLVVATSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SGS++D +GRRPML+ SS+ Y L+G++MLWSP V VLL+ARL+ GF +GLAVTL+P+Y
Sbjct  61   TFSGSLSDRVGRRPMLVASSLLYTLAGMLMLWSPTVGVLLLARLVGGFAVGLAVTLIPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP E+RGLL+TLPQ TGS GMFLA
Sbjct  121  ISETAPPEVRGLLSTLPQLTGSTGMFLA  148



>ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
 gb|EER90435.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
Length=767

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK+E  LET   +EGL+VA SLIGAT+IT
Sbjct  1    MQGAVLVAIAAAIGNLLQGWDNATIAGAVIYIKREFHLETQPAVEGLLVATSLIGATIIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPML+ SS+ YF  GLIMLWSPNV VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   TFSGPVSDIVGRRPMLVASSLLYFAGGLIMLWSPNVLVLLLARLVDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGS GMF +
Sbjct  121  ISETAPPEIRGLLNTLPQFTGSFGMFFS  148



>ref|XP_003604104.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74355.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=744

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVL--ETYMEGLVVAMSLIGATLIT  375
            M+GAV+VA+AA IGN LQGWDNATIAG+++YIK+E  L  E  +EGL+VAMSLIGAT++T
Sbjct  1    MSGAVIVAVAAAIGNLLQGWDNATIAGSILYIKREFQLQSEPTVEGLIVAMSLIGATVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            TCSG+++D  GRRPMLI+SS+ YFLS L+M WSPNVY+LL ARLLDG GIGLAVTLVPLY
Sbjct  61   TCSGALSDLFGRRPMLIISSLLYFLSSLVMFWSPNVYILLFARLLDGLGIGLAVTLVPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE AP EIRG LNTLPQF GS GMF +
Sbjct  121  ISEIAPPEIRGSLNTLPQFAGSAGMFFS  148



>ref|XP_006649210.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=668

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 125/149 (84%), Gaps = 3/149 (2%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKEL-VLETY--MEGLVVAMSLIGATLI  372
            M GAV+ A AA +GN LQGWDNATIAGA++YI+++L  L+ +  ++GLVVA SLIGAT++
Sbjct  1    MRGAVVAAAAAALGNMLQGWDNATIAGALLYIRRDLPALQAHPALQGLVVATSLIGATIV  60

Query  373  TTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPL  552
            TT SG ++D+ GRRPML+ S++ Y L+GL+MLWSP V VLL+ARL+DGF IGLAVTLVP+
Sbjct  61   TTLSGPLSDYRGRRPMLVASALLYSLAGLLMLWSPTVEVLLLARLVDGFAIGLAVTLVPV  120

Query  553  YISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            YISETAP + RGLLNTLPQ TGS GMFL+
Sbjct  121  YISETAPPDTRGLLNTLPQLTGSTGMFLS  149



>dbj|BAK02857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GA LVA+AA +GN LQGWDNATIAG+++YIK++  L+    ++GLVVA SLIGATLIT
Sbjct  1    MRGAALVALAAALGNMLQGWDNATIAGSLLYIKRDFGLDAQPALQGLVVATSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG ++D +GRRPML+ SS+ Y L+GL+MLWSP V VLL+ARL+DGF +GLAVTLVP+Y
Sbjct  61   TFSGPLSDHVGRRPMLVASSLLYALAGLLMLWSPTVGVLLLARLVDGFAVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP E+RGLL+TLPQ TGS GMFL+
Sbjct  121  ISETAPPEVRGLLSTLPQLTGSTGMFLS  148



>ref|XP_002453100.1| hypothetical protein SORBIDRAFT_04g038460 [Sorghum bicolor]
 gb|EES06076.1| hypothetical protein SORBIDRAFT_04g038460 [Sorghum bicolor]
Length=498

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 122/148 (82%), Gaps = 3/148 (2%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQGWDNATIAGAV+YIK +  LE+   +EGL+VA SLIGATLIT
Sbjct  1    MRGAVLVAIAAAIGNLLQGWDNATIAGAVLYIKHDFHLESQPAVEGLLVATSLIGATLIT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
            T SG +A        L  SS+ YFL+GL+MLWSP V+VLL+ARL+DGF IGLAVTLVP+Y
Sbjct  61   TFSGPVAAPTPSAAALC-SSLLYFLAGLLMLWSPGVHVLLLARLVDGFAIGLAVTLVPVY  119

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRGLLNTLPQFTGSGGMFLA
Sbjct  120  ISETAPPEIRGLLNTLPQFTGSGGMFLA  147



>gb|KHN19961.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=723

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = +1

Query  280  GAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLS  453
            G+++YIKKE  LE    +EGL+VAMSLIGAT++TTCSG+++D LGRRPMLI+SSM YF+S
Sbjct  14   GSIMYIKKEFQLENEPTVEGLIVAMSLIGATVVTTCSGALSDLLGRRPMLIISSMLYFVS  73

Query  454  GLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMF  633
             L+MLWSPNVY+LL ARLLDG GIGLAVTLVPLYISETAP EIRGLLNTLPQFTGS GMF
Sbjct  74   SLVMLWSPNVYILLFARLLDGLGIGLAVTLVPLYISETAPPEIRGLLNTLPQFTGSLGMF  133

Query  634  LA  639
             +
Sbjct  134  FS  135



>ref|NP_001147067.1| hexose transporter [Zea mays]
 gb|ACN33422.1| unknown [Zea mays]
 gb|AFW69612.1| hexose transporter [Zea mays]
Length=763

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQG DNA IA AV+YIK+E  LET   +EG+VVA SL GAT++T
Sbjct  1    MQGAVLVAIAAAIGNLLQGLDNAAIAAAVLYIKREFHLETDPALEGVVVATSLFGATIVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
              SG ++D +GRRPMLI+SS+ YF  GL+MLWSP+V VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   IFSGPVSDVIGRRPMLIVSSLLYFAGGLLMLWSPSVPVLLVARLVDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQ TGS GMFL+
Sbjct  121  ISETAPPEIRGFLNTLPQLTGSLGMFLS  148



>gb|ACG25339.1| hexose transporter [Zea mays]
Length=763

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M GAVLVAIAA IGN LQG DNA IA AV+YIK+E  LET   +EG+VVA SL GAT++T
Sbjct  1    MQGAVLVAIAAAIGNLLQGLDNAAIAAAVLYIKREFHLETDPALEGVVVATSLFGATIVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
              SG ++D +GRRPMLI+SS+ YF  GL+MLWSP+V VLL+ARL+DGFG+GLAVTLVP+Y
Sbjct  61   IFSGPVSDVIGRRPMLIVSSLLYFAGGLLMLWSPSVPVLLVARLVDGFGVGLAVTLVPVY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISETAP EIRG LNTLPQ TGS GMFL+
Sbjct  121  ISETAPPEIRGFLNTLPQLTGSLGMFLS  148



>gb|EAY88138.1| hypothetical protein OsI_09573 [Oryza sativa Indica Group]
Length=643

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 125/149 (84%), Gaps = 3/149 (2%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKEL-VLETY--MEGLVVAMSLIGATLI  372
            M GAV+ A AA +GN LQGWDNATIAGA++Y++++L  L+ +  ++GLVVA SLIGAT++
Sbjct  1    MRGAVVAAAAAAVGNMLQGWDNATIAGALLYMRRDLPALQAHPALQGLVVATSLIGATIV  60

Query  373  TTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPL  552
            TT SG ++D  GRRPMLI S++ Y L+GL+MLWSPNV +LL+ARL+DGF IGLAVTLVP+
Sbjct  61   TTFSGPLSDSRGRRPMLIASALLYSLAGLLMLWSPNVPILLLARLVDGFAIGLAVTLVPV  120

Query  553  YISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            YISETAP + RGLLNTLPQ TGS GMFL+
Sbjct  121  YISETAPPDTRGLLNTLPQLTGSTGMFLS  149



>dbj|BAD23011.1| putative hexose transporter [Oryza sativa Japonica Group]
 gb|EAZ25202.1| hypothetical protein OsJ_09002 [Oryza sativa Japonica Group]
Length=652

 Score =   186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 125/149 (84%), Gaps = 3/149 (2%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKEL-VLETY--MEGLVVAMSLIGATLI  372
            M GAV+ A AA +GN LQGWDNATIAGA++Y++++L  L+ +  ++GLVVA SLIGAT++
Sbjct  1    MRGAVVAAAAAAVGNMLQGWDNATIAGALLYMRRDLPALQAHPALQGLVVATSLIGATIV  60

Query  373  TTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPL  552
            TT SG ++D  GRRPMLI S++ Y L+GL+MLWSPNV +LL+ARL+DGF IGLAVTLVP+
Sbjct  61   TTFSGPLSDSRGRRPMLIASALLYSLAGLLMLWSPNVPILLLARLVDGFAIGLAVTLVPV  120

Query  553  YISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            YISETAP + RGLLNTLPQ TGS GMFL+
Sbjct  121  YISETAPPDTRGLLNTLPQLTGSTGMFLS  149



>ref|XP_003537696.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
 gb|KHN41803.1| Monosaccharide-sensing protein 3 [Glycine soja]
Length=722

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  214  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  393
            V+VAIAAT+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVAIAATLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFITGTIVTLFSGTV  64

Query  394  ADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAP  573
            +D +GRRPMLI SS+ +FLSGL+MLW+PNV ++L+AR++DG  I LAVTL PLYISE AP
Sbjct  65   SDLVGRRPMLITSSIMFFLSGLVMLWAPNVVIVLLARIIDGVAIALAVTLTPLYISEVAP  124

Query  574  SEIRGLLNTLPQFTGSGGMFLA  639
            ++IRG LNTL QF  SGGMF A
Sbjct  125  ADIRGQLNTLTQFACSGGMFFA  146



>ref|XP_003517121.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=722

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  214  VLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLETYMEGLVVAMSLIGATLITTCSGSI  393
            V+VAIAAT+GN L GWD++TIA  + YIKKE VL+  +EGL+V+MS I  T++T  SG++
Sbjct  5    VIVAIAATLGNLLMGWDSSTIAAGMTYIKKEFVLDATLEGLIVSMSFIIGTVVTIFSGTV  64

Query  394  ADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAP  573
             D +GRRPMLI SS+ +FLSGL+MLW+PNV ++L+AR++DG  I LAVTL PLYISE AP
Sbjct  65   CDLVGRRPMLITSSIMFFLSGLVMLWAPNVVIVLLARIIDGVAIALAVTLTPLYISEVAP  124

Query  574  SEIRGLLNTLPQFTGSGGMFLA  639
            ++IRG LNTL QF  SGGMFLA
Sbjct  125  ADIRGQLNTLTQFACSGGMFLA  146



>ref|XP_003603869.1| Monosaccharide-sensing protein [Medicago truncatula]
Length=689

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  325  MEGLVVAMSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIAR  504
            MEGLVVAMSLIGAT+ITTCSG I+DWLGRRPM+I+SS+ YFL  L+MLWSPNVYVL +AR
Sbjct  1    MEGLVVAMSLIGATVITTCSGPISDWLGRRPMMIISSVLYFLGSLVMLWSPNVYVLCLAR  60

Query  505  LLDGFGIGLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            LLDGFGIGLAVTLVP+YISETAPS+IRG LNTLPQF+GSGGMFL+
Sbjct  61   LLDGFGIGLAVTLVPVYISETAPSDIRGSLNTLPQFSGSGGMFLS  105



>ref|XP_003573173.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=709

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +1

Query  244  NFLQGWDNATIAGAVVYIKKELVLETY--MEGLVVAMSLIGATLITTCSGSIADWLGRRP  417
            N LQGWDNATIAG+++YIK+E  LE +  +EGLVVA SLIGAT++TT SG ++D +GRRP
Sbjct  16   NMLQGWDNATIAGSLLYIKREFRLEGHPALEGLVVATSLIGATVVTTFSGPLSDSVGRRP  75

Query  418  MLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLYISETAPSEIRGLLN  597
            ML+ SS+ Y L+GL+MLWSPNV +LL++RL+ G  +GLAVTLVP+YISETAP+E RG LN
Sbjct  76   MLVASSLLYALAGLLMLWSPNVQLLLLSRLVGGLAVGLAVTLVPVYISETAPAETRGRLN  135

Query  598  TLPQFTGSGGMFL  636
            TLPQ TGS GMFL
Sbjct  136  TLPQLTGSAGMFL  148



>ref|XP_007156262.1| hypothetical protein PHAVU_003G271500g [Phaseolus vulgaris]
 gb|ESW28256.1| hypothetical protein PHAVU_003G271500g [Phaseolus vulgaris]
Length=687

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = +1

Query  202  MNGAVLVAIAATIGNFLQGWDNATIAGAVVYIKKELVLET--YMEGLVVAMSLIGATLIT  375
            M   V+VAIAAT+GN L GWD++TIAG + YIKKE  LET   +EGL+++ S +  T++T
Sbjct  1    MREVVIVAIAATVGNVLVGWDSSTIAGGMSYIKKEFKLETDPTLEGLIMSTSFLTGTVVT  60

Query  376  TCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGIGLAVTLVPLY  555
              SG++ D LGRRPMLI++S  +FLSGL+MLW+PNV V+L +RLL+G  + LA+TL PLY
Sbjct  61   IFSGTVCDMLGRRPMLIVASTMFFLSGLVMLWAPNVTVILFSRLLNGIALALAITLTPLY  120

Query  556  ISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            ISE +P +IRG LNTLPQF+ SGGMFLA
Sbjct  121  ISEISPPDIRGTLNTLPQFSCSGGMFLA  148



>gb|KJB14185.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=691

 Score =   179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +1

Query  346  MSLIGATLITTCSGSIADWLGRRPMLILSSMFYFLSGLIMLWSPNVYVLLIARLLDGFGI  525
            MSLIGAT ITTCSG+I+DW+GRRPMLI+SSM YF+SGL+MLWSPNVY+L +ARLLDGFGI
Sbjct  1    MSLIGATAITTCSGAISDWIGRRPMLIMSSMLYFVSGLVMLWSPNVYILCLARLLDGFGI  60

Query  526  GLAVTLVPLYISETAPSEIRGLLNTLPQFTGSGGMFLA  639
            GLAVTLVP+YISETAPSEIRGLLNTLPQFTGSGGMFL+
Sbjct  61   GLAVTLVPVYISETAPSEIRGLLNTLPQFTGSGGMFLS  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750