BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS139B12

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081899.1|  PREDICTED: transcriptional corepressor LEUNIG      196   9e-64   Sesamum indicum [beniseed]
gb|EYU21923.1|  hypothetical protein MIMGU_mgv1a000972mg                196   4e-63   Erythranthe guttata [common monkey flower]
ref|XP_009624260.1|  PREDICTED: transcriptional corepressor LEUNI...    195   4e-63   
ref|XP_009787198.1|  PREDICTED: transcriptional corepressor LEUNI...    195   5e-63   Nicotiana sylvestris
ref|XP_009787196.1|  PREDICTED: transcriptional corepressor LEUNI...    195   5e-63   Nicotiana sylvestris
ref|XP_009624257.1|  PREDICTED: transcriptional corepressor LEUNI...    195   5e-63   Nicotiana tomentosiformis
ref|XP_009787197.1|  PREDICTED: transcriptional corepressor LEUNI...    194   5e-63   Nicotiana sylvestris
ref|XP_009624258.1|  PREDICTED: transcriptional corepressor LEUNI...    194   5e-63   
ref|XP_003544623.1|  PREDICTED: transcriptional corepressor LEUNI...    195   1e-62   Glycine max [soybeans]
ref|XP_006596119.1|  PREDICTED: transcriptional corepressor LEUNI...    195   1e-62   Glycine max [soybeans]
ref|XP_003544622.1|  PREDICTED: transcriptional corepressor LEUNI...    195   1e-62   Glycine max [soybeans]
ref|XP_004498639.1|  PREDICTED: transcriptional corepressor LEUNI...    194   1e-62   Cicer arietinum [garbanzo]
ref|XP_004498638.1|  PREDICTED: transcriptional corepressor LEUNI...    194   1e-62   Cicer arietinum [garbanzo]
emb|CBI20987.3|  unnamed protein product                                197   2e-62   Vitis vinifera
ref|XP_010648611.1|  PREDICTED: transcriptional corepressor LEUNI...    197   2e-62   Vitis vinifera
ref|XP_002284900.1|  PREDICTED: transcriptional corepressor LEUNI...    197   2e-62   Vitis vinifera
ref|XP_011459234.1|  PREDICTED: transcriptional corepressor LEUNI...    193   7e-62   Fragaria vesca subsp. vesca
ref|XP_010322741.1|  PREDICTED: transcriptional corepressor LEUNI...    191   8e-62   Solanum lycopersicum
ref|XP_004241804.1|  PREDICTED: transcriptional corepressor LEUNI...    191   8e-62   Solanum lycopersicum
ref|XP_010322743.1|  PREDICTED: transcriptional corepressor LEUNI...    191   8e-62   Solanum lycopersicum
ref|XP_010322742.1|  PREDICTED: transcriptional corepressor LEUNI...    191   9e-62   Solanum lycopersicum
ref|XP_004291496.1|  PREDICTED: transcriptional corepressor LEUNI...    192   9e-62   Fragaria vesca subsp. vesca
ref|XP_006353651.1|  PREDICTED: transcriptional corepressor LEUNI...    191   9e-62   Solanum tuberosum [potatoes]
ref|XP_010322740.1|  PREDICTED: transcriptional corepressor LEUNI...    191   9e-62   Solanum lycopersicum
ref|XP_006353653.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-61   Solanum tuberosum [potatoes]
ref|XP_006353650.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-61   Solanum tuberosum [potatoes]
ref|XP_006353652.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-61   Solanum tuberosum [potatoes]
ref|XP_008394022.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    191   2e-61   
gb|KEH39820.1|  transcriptional corepressor leunig-like protein         193   3e-61   Medicago truncatula
ref|XP_003588695.1|  Transcriptional corepressor LEUNIG                 194   3e-61   Medicago truncatula
ref|XP_007013777.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    192   3e-61   
ref|XP_007013778.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    191   3e-61   Theobroma cacao [chocolate]
ref|XP_009377499.1|  PREDICTED: transcriptional corepressor LEUNI...    191   4e-61   Pyrus x bretschneideri [bai li]
ref|XP_009377496.1|  PREDICTED: transcriptional corepressor LEUNI...    191   5e-61   Pyrus x bretschneideri [bai li]
ref|XP_007161251.1|  hypothetical protein PHAVU_001G054700g             192   6e-61   Phaseolus vulgaris [French bean]
emb|CAF18245.1|  STYLOSA protein                                        192   7e-61   Antirrhinum majus [garden snapdragon]
ref|XP_010526195.1|  PREDICTED: transcriptional corepressor LEUNI...    191   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_010526194.1|  PREDICTED: transcriptional corepressor LEUNI...    190   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_010254246.1|  PREDICTED: transcriptional corepressor LEUNI...    190   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010254244.1|  PREDICTED: transcriptional corepressor LEUNI...    190   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010254245.1|  PREDICTED: transcriptional corepressor LEUNI...    189   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_002515595.1|  WD-repeat protein, putative                        189   2e-60   
ref|XP_010254242.1|  PREDICTED: transcriptional corepressor LEUNI...    189   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010526192.1|  PREDICTED: transcriptional corepressor LEUNI...    190   2e-60   
ref|XP_010254243.1|  PREDICTED: transcriptional corepressor LEUNI...    189   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010526193.1|  PREDICTED: transcriptional corepressor LEUNI...    190   2e-60   
ref|XP_003550164.1|  PREDICTED: transcriptional corepressor LEUNI...    195   2e-60   
ref|XP_003550163.1|  PREDICTED: transcriptional corepressor LEUNI...    196   2e-60   
ref|XP_002309593.2|  LEUNIG family protein                              192   3e-60   
ref|XP_008359609.1|  PREDICTED: transcriptional corepressor LEUNI...    188   3e-60   
ref|XP_008359611.1|  PREDICTED: transcriptional corepressor LEUNI...    188   3e-60   
ref|XP_008359608.1|  PREDICTED: transcriptional corepressor LEUNI...    188   3e-60   
ref|XP_008359612.1|  PREDICTED: transcriptional corepressor LEUNI...    188   3e-60   
ref|XP_008359610.1|  PREDICTED: transcriptional corepressor LEUNI...    188   3e-60   
ref|XP_009372950.1|  PREDICTED: transcriptional corepressor LEUNI...    189   7e-60   Pyrus x bretschneideri [bai li]
ref|XP_011019744.1|  PREDICTED: transcriptional corepressor LEUNI...    193   7e-60   Populus euphratica
ref|XP_009372954.1|  PREDICTED: transcriptional corepressor LEUNI...    189   7e-60   Pyrus x bretschneideri [bai li]
ref|XP_010112086.1|  Transcriptional corepressor LEUNIG                 186   8e-60   Morus notabilis
ref|XP_009372951.1|  PREDICTED: transcriptional corepressor LEUNI...    189   8e-60   Pyrus x bretschneideri [bai li]
ref|XP_009372955.1|  PREDICTED: transcriptional corepressor LEUNI...    189   8e-60   Pyrus x bretschneideri [bai li]
ref|XP_011019742.1|  PREDICTED: transcriptional corepressor LEUNI...    193   8e-60   Populus euphratica
ref|XP_011019743.1|  PREDICTED: transcriptional corepressor LEUNI...    193   8e-60   Populus euphratica
ref|XP_007013780.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    187   8e-60   
ref|XP_009372956.1|  PREDICTED: transcriptional corepressor LEUNI...    188   1e-59   
ref|XP_008219868.1|  PREDICTED: transcriptional corepressor LEUNI...    190   2e-59   Prunus mume [ume]
ref|XP_008219867.1|  PREDICTED: transcriptional corepressor LEUNI...    190   2e-59   Prunus mume [ume]
ref|XP_008219869.1|  PREDICTED: transcriptional corepressor LEUNI...    190   2e-59   Prunus mume [ume]
ref|XP_004501291.1|  PREDICTED: transcriptional corepressor LEUNI...    184   7e-59   Cicer arietinum [garbanzo]
ref|XP_004501290.1|  PREDICTED: transcriptional corepressor LEUNI...    184   8e-59   Cicer arietinum [garbanzo]
ref|XP_004501292.1|  PREDICTED: transcriptional corepressor LEUNI...    184   8e-59   Cicer arietinum [garbanzo]
gb|KDO79600.1|  hypothetical protein CISIN_1g002471mg                   187   1e-58   Citrus sinensis [apfelsine]
ref|XP_007225318.1|  hypothetical protein PRUPE_ppa001131mg             187   2e-58   
ref|XP_006476206.1|  PREDICTED: transcriptional corepressor LEUNI...    186   2e-58   Citrus sinensis [apfelsine]
ref|XP_006450544.1|  hypothetical protein CICLE_v10007390mg             186   2e-58   Citrus clementina [clementine]
gb|KDO79596.1|  hypothetical protein CISIN_1g002471mg                   186   2e-58   Citrus sinensis [apfelsine]
ref|XP_006578171.1|  PREDICTED: transcriptional corepressor LEUNI...    184   2e-58   Glycine max [soybeans]
gb|KDO79598.1|  hypothetical protein CISIN_1g002471mg                   186   2e-58   Citrus sinensis [apfelsine]
ref|XP_003522634.1|  PREDICTED: transcriptional corepressor LEUNI...    184   2e-58   Glycine max [soybeans]
ref|XP_007225321.1|  hypothetical protein PRUPE_ppa001131mg             187   2e-58   
ref|XP_003522633.1|  PREDICTED: transcriptional corepressor LEUNI...    184   2e-58   Glycine max [soybeans]
ref|XP_007225320.1|  hypothetical protein PRUPE_ppa001131mg             187   2e-58   
ref|XP_006450543.1|  hypothetical protein CICLE_v10007390mg             186   2e-58   
ref|XP_007225322.1|  hypothetical protein PRUPE_ppa001131mg             187   2e-58   
gb|KDO79597.1|  hypothetical protein CISIN_1g002471mg                   186   2e-58   Citrus sinensis [apfelsine]
gb|KDO79602.1|  hypothetical protein CISIN_1g002471mg                   186   2e-58   Citrus sinensis [apfelsine]
ref|XP_011026513.1|  PREDICTED: transcriptional corepressor LEUNI...    188   3e-58   Populus euphratica
ref|XP_011026511.1|  PREDICTED: transcriptional corepressor LEUNI...    188   3e-58   Populus euphratica
ref|XP_011026512.1|  PREDICTED: transcriptional corepressor LEUNI...    187   3e-58   Populus euphratica
ref|XP_011026514.1|  PREDICTED: transcriptional corepressor LEUNI...    187   3e-58   Populus euphratica
ref|XP_002284925.2|  PREDICTED: transcriptional corepressor LEUNI...    186   3e-58   Vitis vinifera
emb|CBI20989.3|  unnamed protein product                                186   4e-58   Vitis vinifera
ref|XP_010548472.1|  PREDICTED: transcriptional corepressor LEUNI...    187   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_010548470.1|  PREDICTED: transcriptional corepressor LEUNI...    187   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_006581384.1|  PREDICTED: transcriptional corepressor LEUNI...    182   5e-58   Glycine max [soybeans]
gb|KJB83303.1|  hypothetical protein B456_013G240700                    181   5e-58   Gossypium raimondii
ref|XP_006581383.1|  PREDICTED: transcriptional corepressor LEUNI...    182   5e-58   Glycine max [soybeans]
gb|KJB83312.1|  hypothetical protein B456_013G240700                    181   5e-58   Gossypium raimondii
ref|XP_003526430.1|  PREDICTED: transcriptional corepressor LEUNI...    182   5e-58   Glycine max [soybeans]
gb|KJB83302.1|  hypothetical protein B456_013G240700                    181   5e-58   Gossypium raimondii
gb|KJB83304.1|  hypothetical protein B456_013G240700                    181   6e-58   Gossypium raimondii
gb|KJB83300.1|  hypothetical protein B456_013G240700                    181   6e-58   Gossypium raimondii
ref|XP_010548471.1|  PREDICTED: transcriptional corepressor LEUNI...    186   6e-58   Tarenaya hassleriana [spider flower]
gb|KJB83314.1|  hypothetical protein B456_013G240700                    181   6e-58   Gossypium raimondii
gb|KJB83305.1|  hypothetical protein B456_013G240700                    181   6e-58   Gossypium raimondii
gb|KJB83301.1|  hypothetical protein B456_013G240700                    181   6e-58   Gossypium raimondii
ref|XP_010914979.1|  PREDICTED: transcriptional corepressor LEUNI...    187   6e-58   
ref|XP_010249918.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    189   8e-58   
gb|KFK29865.1|  hypothetical protein AALP_AA7G189100                    187   9e-58   Arabis alpina [alpine rockcress]
ref|XP_009377497.1|  PREDICTED: transcriptional corepressor LEUNI...    180   1e-57   
ref|XP_009377498.1|  PREDICTED: transcriptional corepressor LEUNI...    180   1e-57   
ref|XP_006371728.1|  LEUNIG family protein                              186   1e-57   
ref|XP_009377494.1|  PREDICTED: transcriptional corepressor LEUNI...    180   1e-57   
ref|XP_006412457.1|  hypothetical protein EUTSA_v10024343mg             189   2e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009377500.1|  PREDICTED: transcriptional corepressor LEUNI...    179   2e-57   
emb|CDY51674.1|  BnaC03g67130D                                          189   2e-57   Brassica napus [oilseed rape]
emb|CDY23331.1|  BnaA08g12150D                                          190   2e-57   Brassica napus [oilseed rape]
ref|XP_010915881.1|  PREDICTED: transcriptional corepressor LEUNI...    184   2e-57   Elaeis guineensis
ref|XP_009367963.1|  PREDICTED: transcriptional corepressor LEUNI...    181   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_010915657.1|  PREDICTED: transcriptional corepressor LEUNI...    183   3e-57   Elaeis guineensis
ref|XP_010915804.1|  PREDICTED: transcriptional corepressor LEUNI...    183   3e-57   
ref|XP_010915729.1|  PREDICTED: transcriptional corepressor LEUNI...    183   3e-57   Elaeis guineensis
ref|XP_009367962.1|  PREDICTED: transcriptional corepressor LEUNI...    181   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_009108869.1|  PREDICTED: transcriptional corepressor LEUNIG      189   4e-57   Brassica rapa
ref|XP_010670737.1|  PREDICTED: transcriptional corepressor LEUNIG      185   5e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007137062.1|  hypothetical protein PHAVU_009G096600g             181   6e-57   Phaseolus vulgaris [French bean]
ref|XP_007137063.1|  hypothetical protein PHAVU_009G096600g             181   7e-57   Phaseolus vulgaris [French bean]
gb|KDP32298.1|  hypothetical protein JCGZ_13223                         177   7e-57   Jatropha curcas
emb|CDX75254.1|  BnaA01g04480D                                          187   7e-57   
gb|KCW81465.1|  hypothetical protein EUGRSUZ_C028381                    175   1e-56   Eucalyptus grandis [rose gum]
ref|XP_010049005.1|  PREDICTED: transcriptional corepressor LEUNIG      175   1e-56   
ref|XP_009138136.1|  PREDICTED: transcriptional corepressor LEUNI...    186   1e-56   Brassica rapa
ref|XP_009125844.1|  PREDICTED: transcriptional corepressor LEUNI...    186   1e-56   Brassica rapa
ref|XP_009125852.1|  PREDICTED: transcriptional corepressor LEUNI...    186   1e-56   Brassica rapa
ref|XP_009125860.1|  PREDICTED: transcriptional corepressor LEUNI...    186   1e-56   Brassica rapa
emb|CDY13494.1|  BnaA03g52120D                                          185   2e-56   Brassica napus [oilseed rape]
ref|XP_008352162.1|  PREDICTED: transcriptional corepressor LEUNI...    182   2e-56   
emb|CDX72364.1|  BnaC07g43860D                                          184   3e-56   
ref|XP_008811606.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    179   3e-56   
emb|CDX68860.1|  BnaC01g05930D                                          185   5e-56   
gb|KCW81467.1|  hypothetical protein EUGRSUZ_C028381                    172   6e-56   Eucalyptus grandis [rose gum]
gb|KJB64525.1|  hypothetical protein B456_010G053000                    177   7e-56   Gossypium raimondii
gb|KJB64522.1|  hypothetical protein B456_010G053000                    177   8e-56   Gossypium raimondii
gb|KJB64523.1|  hypothetical protein B456_010G053000                    177   8e-56   Gossypium raimondii
gb|KEH35932.1|  transcriptional corepressor leunig-like protein         174   9e-56   Medicago truncatula
gb|AES73711.2|  transcriptional corepressor leunig-like protein         174   1e-55   Medicago truncatula
ref|XP_003603460.1|  NAD(P)H-quinone oxidoreductase subunit             173   1e-55   
ref|XP_010432701.1|  PREDICTED: transcriptional corepressor LEUNI...    189   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010447372.1|  PREDICTED: transcriptional corepressor LEUNIG      189   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009407640.1|  PREDICTED: transcriptional corepressor LEUNI...    182   3e-55   
gb|KCW81471.1|  hypothetical protein EUGRSUZ_C028381                    172   4e-55   Eucalyptus grandis [rose gum]
gb|KCW81469.1|  hypothetical protein EUGRSUZ_C028381                    172   4e-55   Eucalyptus grandis [rose gum]
ref|XP_009407639.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407638.1|  PREDICTED: transcriptional corepressor LEUNI...    181   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_567896.1|  transcriptional corepressor LEUNIG                    187   4e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AAG32022.1|AF277458_1  LEUNIG                                        187   5e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CAB43692.1|  putative protein                                       187   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190891.1|  transcriptional corepressor LEUNIG                 187   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869264.1|  hypothetical protein ARALYDRAFT_491464             187   6e-55   
ref|XP_010049009.1|  PREDICTED: transcriptional corepressor LEUNI...    171   2e-54   
ref|XP_010049010.1|  PREDICTED: transcriptional corepressor LEUNI...    170   2e-54   Eucalyptus grandis [rose gum]
ref|XP_010049007.1|  PREDICTED: transcriptional corepressor LEUNI...    170   3e-54   
ref|XP_010925121.1|  PREDICTED: transcriptional corepressor LEUNI...    180   5e-54   Elaeis guineensis
ref|XP_010925120.1|  PREDICTED: transcriptional corepressor LEUNI...    180   5e-54   Elaeis guineensis
ref|XP_007221603.1|  hypothetical protein PRUPE_ppa026892mg             179   9e-54   
ref|XP_002970913.1|  hypothetical protein SELMODRAFT_94317              180   2e-53   
ref|XP_002969651.1|  hypothetical protein SELMODRAFT_410492             181   2e-53   Selaginella moellendorffii
ref|XP_008445143.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    184   3e-53   
gb|KDP23675.1|  hypothetical protein JCGZ_23508                         175   3e-53   Jatropha curcas
gb|KFK29867.1|  hypothetical protein AALP_AA7G189300                    174   3e-53   Arabis alpina [alpine rockcress]
gb|KFK29866.1|  hypothetical protein AALP_AA7G189300                    174   4e-53   Arabis alpina [alpine rockcress]
gb|KHN08101.1|  Transcriptional corepressor LEUNIG                      163   4e-52   Glycine soja [wild soybean]
ref|XP_004138745.1|  PREDICTED: transcriptional corepressor LEUNI...    183   4e-52   Cucumis sativus [cucumbers]
ref|XP_004138746.1|  PREDICTED: transcriptional corepressor LEUNI...    182   4e-52   Cucumis sativus [cucumbers]
ref|XP_004168288.1|  PREDICTED: transcriptional corepressor LEUNI...    182   4e-52   
gb|KGN62903.1|  hypothetical protein Csa_2G379340                       182   6e-52   Cucumis sativus [cucumbers]
gb|KHN16498.1|  Transcriptional corepressor LEUNIG                      161   1e-51   Glycine soja [wild soybean]
ref|XP_002514368.1|  WD-repeat protein, putative                        174   1e-51   
gb|KDP32334.1|  hypothetical protein JCGZ_13259                         170   7e-51   Jatropha curcas
gb|EPS73524.1|  hypothetical protein M569_01232                         163   7e-51   Genlisea aurea
ref|XP_002962710.1|  hypothetical protein SELMODRAFT_79275              169   7e-51   
ref|XP_002980381.1|  hypothetical protein SELMODRAFT_112245             169   8e-51   
ref|XP_010656382.1|  PREDICTED: transcriptional corepressor LEUNI...    163   2e-50   Vitis vinifera
ref|XP_010656383.1|  PREDICTED: transcriptional corepressor LEUNI...    163   2e-50   Vitis vinifera
gb|KJB83315.1|  hypothetical protein B456_013G240700                    155   2e-50   Gossypium raimondii
ref|XP_009405115.1|  PREDICTED: transcriptional corepressor LEUNI...    170   3e-50   
ref|XP_009405109.1|  PREDICTED: transcriptional corepressor LEUNI...    170   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405103.1|  PREDICTED: transcriptional corepressor LEUNI...    170   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006451037.1|  hypothetical protein CICLE_v10007449mg             166   5e-50   Citrus clementina [clementine]
gb|KDO80395.1|  hypothetical protein CISIN_1g003177mg                   166   6e-50   Citrus sinensis [apfelsine]
ref|XP_006475763.1|  PREDICTED: transcriptional corepressor LEUNI...    166   6e-50   Citrus sinensis [apfelsine]
ref|XP_006475762.1|  PREDICTED: transcriptional corepressor LEUNI...    166   6e-50   Citrus sinensis [apfelsine]
gb|KDO80404.1|  hypothetical protein CISIN_1g003177mg                   167   6e-50   Citrus sinensis [apfelsine]
gb|KDO80396.1|  hypothetical protein CISIN_1g003177mg                   166   6e-50   Citrus sinensis [apfelsine]
gb|KDO80403.1|  hypothetical protein CISIN_1g003177mg                   167   7e-50   Citrus sinensis [apfelsine]
gb|KDO80405.1|  hypothetical protein CISIN_1g003177mg                   166   1e-49   Citrus sinensis [apfelsine]
gb|KHG05392.1|  Transcriptional corepressor LEUNIG -like protein        157   1e-49   Gossypium arboreum [tree cotton]
ref|XP_002531278.1|  WD-repeat protein, putative                        159   1e-48   
ref|XP_009403020.1|  PREDICTED: transcriptional corepressor LEUNI...    165   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403018.1|  PREDICTED: transcriptional corepressor LEUNI...    165   1e-48   
ref|XP_006838727.1|  hypothetical protein AMTR_s00002p00252820          162   2e-48   Amborella trichopoda
ref|XP_009387170.1|  PREDICTED: transcriptional corepressor LEUNI...    162   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009371419.1|  PREDICTED: transcriptional corepressor LEUNI...    160   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_009371420.1|  PREDICTED: transcriptional corepressor LEUNI...    160   2e-48   
ref|XP_010533194.1|  PREDICTED: transcriptional corepressor LEUNI...    163   4e-48   
ref|XP_007013296.1|  LisH dimerization motif,WD40/YVTN repeat-lik...    161   7e-48   
ref|XP_010245978.1|  PREDICTED: transcriptional corepressor LEUNI...    164   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010245980.1|  PREDICTED: transcriptional corepressor LEUNI...    164   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010245979.1|  PREDICTED: transcriptional corepressor LEUNI...    163   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008337351.1|  PREDICTED: transcriptional corepressor LEUNI...    159   1e-47   
ref|XP_008337350.1|  PREDICTED: transcriptional corepressor LEUNI...    159   1e-47   
ref|XP_010245981.1|  PREDICTED: transcriptional corepressor LEUNI...    163   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008337347.1|  PREDICTED: transcriptional corepressor LEUNI...    159   1e-47   
ref|XP_009374058.1|  PREDICTED: transcriptional corepressor LEUNI...    157   1e-47   
ref|XP_008337349.1|  PREDICTED: transcriptional corepressor LEUNI...    159   1e-47   
gb|ACZ98534.1|  LisH-SSDP-WD40                                          160   2e-47   Malus domestica [apple tree]
ref|XP_008386062.1|  PREDICTED: transcriptional corepressor LEUNI...    160   2e-47   
ref|XP_008386048.1|  PREDICTED: transcriptional corepressor LEUNI...    160   2e-47   
ref|XP_008386053.1|  PREDICTED: transcriptional corepressor LEUNI...    160   3e-47   
ref|XP_002518113.1|  WD-repeat protein, putative                        162   3e-47   
gb|KHN15508.1|  Transcriptional corepressor LEUNIG                      151   4e-47   Glycine soja [wild soybean]
ref|XP_008390143.1|  PREDICTED: transcriptional corepressor LEUNI...    160   4e-47   
ref|XP_010264093.1|  PREDICTED: transcriptional corepressor LEUNI...    162   5e-47   Nelumbo nucifera [Indian lotus]
gb|KHG11579.1|  Transcriptional corepressor LEUNIG -like protein        158   6e-47   Gossypium arboreum [tree cotton]
ref|XP_006857440.1|  hypothetical protein AMTR_s00067p00167320          157   9e-47   
ref|XP_008394021.1|  PREDICTED: transcriptional corepressor LEUNI...    151   1e-46   
gb|KDP39380.1|  hypothetical protein JCGZ_01137                         161   2e-46   Jatropha curcas
gb|KJB64846.1|  hypothetical protein B456_010G067800                    157   3e-46   Gossypium raimondii
gb|KJB64850.1|  hypothetical protein B456_010G067800                    157   3e-46   Gossypium raimondii
gb|KJB64845.1|  hypothetical protein B456_010G067800                    157   3e-46   Gossypium raimondii
gb|KJB64849.1|  hypothetical protein B456_010G067800                    156   3e-46   Gossypium raimondii
ref|XP_008785186.1|  PREDICTED: transcriptional corepressor LEUNI...    157   5e-46   
ref|XP_008785188.1|  PREDICTED: transcriptional corepressor LEUNI...    157   5e-46   
ref|XP_008785183.1|  PREDICTED: transcriptional corepressor LEUNI...    157   6e-46   
ref|XP_003570372.1|  PREDICTED: transcriptional corepressor LEUNIG      154   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_007204646.1|  hypothetical protein PRUPE_ppa001612mg             155   2e-45   
ref|XP_008802406.1|  PREDICTED: transcriptional corepressor LEUNI...    154   4e-45   Phoenix dactylifera
ref|XP_008802409.1|  PREDICTED: transcriptional corepressor LEUNI...    154   5e-45   Phoenix dactylifera
ref|XP_006420876.1|  hypothetical protein CICLE_v10004358mg             155   5e-45   
ref|XP_006420877.1|  hypothetical protein CICLE_v10004358mg             155   5e-45   
ref|XP_010934267.1|  PREDICTED: transcriptional corepressor LEUNI...    153   6e-45   Elaeis guineensis
ref|XP_010934265.1|  PREDICTED: transcriptional corepressor LEUNI...    153   6e-45   Elaeis guineensis
ref|XP_006420880.1|  hypothetical protein CICLE_v10004358mg             154   9e-45   
ref|XP_006493701.1|  PREDICTED: transcriptional corepressor LEUNI...    154   9e-45   Citrus sinensis [apfelsine]
ref|XP_008242693.1|  PREDICTED: transcriptional corepressor LEUNI...    156   9e-45   Prunus mume [ume]
ref|XP_006493704.1|  PREDICTED: transcriptional corepressor LEUNI...    154   9e-45   
ref|XP_008242692.1|  PREDICTED: transcriptional corepressor LEUNI...    156   1e-44   Prunus mume [ume]
gb|EEC74226.1|  hypothetical protein OsI_09411                          155   1e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_006385922.1|  hypothetical protein POPTR_0003s17700g             155   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002454764.1|  hypothetical protein SORBIDRAFT_04g036910          152   1e-44   Sorghum bicolor [broomcorn]
ref|XP_004954333.1|  PREDICTED: transcriptional corepressor LEUNI...    153   1e-44   
ref|XP_011020662.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-44   Populus euphratica
ref|XP_010541888.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_010522422.1|  PREDICTED: transcriptional corepressor LEUNI...    160   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_010522421.1|  PREDICTED: transcriptional corepressor LEUNI...    160   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_008789440.1|  PREDICTED: transcriptional corepressor LEUNIG      153   2e-44   Phoenix dactylifera
ref|XP_010541890.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_010541889.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-44   Tarenaya hassleriana [spider flower]
ref|XP_010541891.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-44   Tarenaya hassleriana [spider flower]
gb|EMS54829.1|  Transcriptional corepressor LEUNIG                      154   3e-44   Triticum urartu
ref|XP_006368907.1|  hypothetical protein POPTR_0001s14560g             156   3e-44   
ref|XP_006652501.1|  PREDICTED: transcriptional corepressor LEUNI...    152   3e-44   Oryza brachyantha
ref|NP_001048487.1|  Os02g0813800                                       154   3e-44   
ref|XP_002299273.1|  hypothetical protein POPTR_0001s14560g             156   3e-44   Populus trichocarpa [western balsam poplar]
emb|CAE03368.2|  OSJNBb0065L13.11                                       152   4e-44   Oryza sativa Japonica Group [Japonica rice]
gb|AFW73990.1|  hypothetical protein ZEAMMB73_066038                    150   4e-44   
ref|XP_006643822.1|  PREDICTED: transcriptional corepressor LEUNI...    148   4e-44   Oryza brachyantha
ref|XP_008796439.1|  PREDICTED: transcriptional corepressor LEUNI...    151   4e-44   
ref|XP_004517069.1|  PREDICTED: transcriptional corepressor LEUNI...    159   4e-44   
ref|XP_004517071.1|  PREDICTED: transcriptional corepressor LEUNI...    159   4e-44   
ref|XP_004517067.1|  PREDICTED: transcriptional corepressor LEUNI...    159   4e-44   Cicer arietinum [garbanzo]
ref|XP_004517072.1|  PREDICTED: transcriptional corepressor LEUNI...    158   4e-44   
ref|XP_004517073.1|  PREDICTED: transcriptional corepressor LEUNI...    158   4e-44   Cicer arietinum [garbanzo]
ref|XP_004517070.1|  PREDICTED: transcriptional corepressor LEUNI...    158   4e-44   Cicer arietinum [garbanzo]
ref|NP_001042184.1|  Os01g0177100                                       152   5e-44   
dbj|BAD67819.1|  putative transcriptional corepressor LEUNIG            152   5e-44   Oryza sativa Japonica Group [Japonica rice]
gb|KHG28610.1|  Transcriptional corepressor LEUNIG -like protein        134   5e-44   Gossypium arboreum [tree cotton]
gb|EEC77619.1|  hypothetical protein OsI_16603                          151   6e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_008643802.1|  PREDICTED: LOC100285175 isoform X1                 150   7e-44   Zea mays [maize]
ref|XP_008224605.1|  PREDICTED: transcriptional corepressor LEUNIG      154   1e-43   Prunus mume [ume]
ref|XP_009385699.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-43   
ref|XP_009382685.1|  PREDICTED: transcriptional corepressor LEUNI...    152   2e-43   
ref|XP_009382681.1|  PREDICTED: transcriptional corepressor LEUNI...    152   2e-43   
ref|NP_001151541.1|  LOC100285175                                       148   2e-43   
ref|XP_003590232.1|  Transcriptional corepressor LEUNIG                 157   5e-43   
ref|XP_003607636.1|  Transcriptional corepressor LEUNIG                 157   5e-43   
ref|XP_003607635.1|  Transcriptional corepressor LEUNIG                 157   5e-43   
gb|AFK33901.1|  unknown                                                 152   5e-43   
ref|XP_004173399.1|  PREDICTED: transcriptional corepressor LEUNI...    151   6e-43   
dbj|BAK08332.1|  predicted protein                                      149   7e-43   
ref|XP_007221910.1|  hypothetical protein PRUPE_ppa001706mg             152   8e-43   
ref|XP_010936002.1|  PREDICTED: transcriptional corepressor LEUNI...    147   9e-43   
ref|XP_010232007.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-42   
ref|XP_010936000.1|  PREDICTED: transcriptional corepressor LEUNI...    147   1e-42   
ref|XP_006588998.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-42   
ref|XP_010936003.1|  PREDICTED: transcriptional corepressor LEUNI...    147   1e-42   
ref|XP_006588999.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-42   
ref|XP_006588996.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-42   
ref|XP_006588997.1|  PREDICTED: transcriptional corepressor LEUNI...    154   1e-42   
ref|XP_008438369.1|  PREDICTED: transcriptional corepressor LEUNI...    155   1e-42   
gb|KDP46173.1|  hypothetical protein JCGZ_06684                         148   1e-42   
ref|XP_004134000.1|  PREDICTED: transcriptional corepressor LEUNI...    155   1e-42   
ref|XP_004242402.1|  PREDICTED: transcriptional corepressor LEUNI...    157   1e-42   
ref|XP_011458499.1|  PREDICTED: transcriptional corepressor LEUNI...    146   2e-42   
ref|XP_004287384.1|  PREDICTED: transcriptional corepressor LEUNI...    146   2e-42   
ref|XP_008438370.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-42   
ref|XP_006352696.1|  PREDICTED: transcriptional corepressor LEUNI...    157   2e-42   
ref|XP_010069048.1|  PREDICTED: transcriptional corepressor LEUNIG      152   2e-42   
emb|CDP03866.1|  unnamed protein product                                158   2e-42   
gb|KHG01358.1|  Transcriptional corepressor LEUNIG -like protein        149   3e-42   
gb|KJB72103.1|  hypothetical protein B456_011G159400                    148   3e-42   
gb|KJB72102.1|  hypothetical protein B456_011G159400                    148   3e-42   
ref|XP_010940735.1|  PREDICTED: transcriptional corepressor LEUNI...    145   3e-42   
ref|XP_010940736.1|  PREDICTED: transcriptional corepressor LEUNI...    145   4e-42   
ref|XP_010940732.1|  PREDICTED: transcriptional corepressor LEUNI...    145   4e-42   
gb|EYU46334.1|  hypothetical protein MIMGU_mgv1a001624mg                156   4e-42   
ref|XP_010940733.1|  PREDICTED: transcriptional corepressor LEUNI...    145   4e-42   
ref|XP_010940734.1|  PREDICTED: transcriptional corepressor LEUNI...    145   4e-42   
ref|XP_011080189.1|  PREDICTED: transcriptional corepressor LEUNI...    155   5e-42   
ref|XP_008654518.1|  PREDICTED: uncharacterized protein LOC100217...    151   1e-41   
gb|AFW83211.1|  hypothetical protein ZEAMMB73_733859                    150   1e-41   
gb|ACN34826.1|  unknown                                                 151   1e-41   
ref|XP_009374609.1|  PREDICTED: transcriptional corepressor LEUNI...    149   1e-41   
ref|XP_009374610.1|  PREDICTED: transcriptional corepressor LEUNI...    149   2e-41   
ref|XP_011083129.1|  PREDICTED: transcriptional corepressor LEUNI...    154   2e-41   
ref|NP_001137120.1|  uncharacterized protein LOC100217300               149   2e-41   
ref|XP_009400486.1|  PREDICTED: transcriptional corepressor LEUNI...    139   2e-41   
gb|AFW83210.1|  hypothetical protein ZEAMMB73_733859                    149   2e-41   
ref|XP_010688121.1|  PREDICTED: transcriptional corepressor LEUNI...    152   3e-41   
ref|XP_010688120.1|  PREDICTED: transcriptional corepressor LEUNI...    152   3e-41   
ref|XP_006602529.1|  PREDICTED: transcriptional corepressor LEUNI...    142   3e-41   
ref|XP_003552134.1|  PREDICTED: transcriptional corepressor LEUNI...    142   3e-41   
ref|XP_004161049.1|  PREDICTED: transcriptional corepressor LEUNI...    144   3e-41   
gb|KHN09543.1|  Transcriptional corepressor LEUNIG                      142   3e-41   
ref|XP_006602530.1|  PREDICTED: transcriptional corepressor LEUNI...    142   4e-41   
dbj|BAK05188.1|  predicted protein                                      137   5e-41   
ref|XP_004969118.1|  PREDICTED: transcriptional corepressor LEUNI...    147   5e-41   
gb|EPS68633.1|  hypothetical protein M569_06134                         131   5e-41   
ref|XP_004969117.1|  PREDICTED: transcriptional corepressor LEUNI...    147   5e-41   
ref|XP_007145511.1|  hypothetical protein PHAVU_007G244700g             149   5e-41   
ref|XP_004296628.1|  PREDICTED: transcriptional corepressor LEUNIG      147   6e-41   
ref|XP_002458130.1|  hypothetical protein SORBIDRAFT_03g027390          144   6e-41   
gb|KJB42456.1|  hypothetical protein B456_007G154000                    144   7e-41   
gb|KJB42457.1|  hypothetical protein B456_007G154000                    144   7e-41   
gb|KJB42458.1|  hypothetical protein B456_007G154000                    144   7e-41   
gb|KJB42455.1|  hypothetical protein B456_007G154000                    144   7e-41   
gb|KDO65918.1|  hypothetical protein CISIN_1g047260mg                   144   1e-40   
ref|XP_008380580.1|  PREDICTED: transcriptional corepressor LEUNI...    145   1e-40   
ref|XP_008380581.1|  PREDICTED: transcriptional corepressor LEUNI...    145   1e-40   
ref|XP_008380582.1|  PREDICTED: transcriptional corepressor LEUNI...    145   1e-40   
ref|XP_006479291.1|  PREDICTED: transcriptional corepressor LEUNI...    144   1e-40   
ref|XP_006479286.1|  PREDICTED: transcriptional corepressor LEUNI...    144   1e-40   
ref|XP_006479287.1|  PREDICTED: transcriptional corepressor LEUNI...    144   1e-40   
ref|XP_006443612.1|  hypothetical protein CICLE_v10023309mg             144   1e-40   
ref|XP_004149861.1|  PREDICTED: transcriptional corepressor LEUNI...    144   1e-40   
ref|XP_006479288.1|  PREDICTED: transcriptional corepressor LEUNI...    144   1e-40   
ref|XP_006479292.1|  PREDICTED: transcriptional corepressor LEUNI...    144   1e-40   
gb|KGN65390.1|  hypothetical protein Csa_1G403660                       144   1e-40   
ref|XP_009372971.1|  PREDICTED: transcriptional corepressor LEUNI...    125   1e-40   
gb|KHG03492.1|  Transcriptional corepressor LEUNIG -like protein        142   2e-40   
gb|KJB64847.1|  hypothetical protein B456_010G067800                    136   2e-40   
emb|CAF18246.1|  STY-L protein                                          150   2e-40   
ref|XP_004969116.1|  PREDICTED: transcriptional corepressor LEUNI...    148   3e-40   
emb|CDM81840.1|  unnamed protein product                                134   3e-40   
ref|XP_002301780.1|  WD-40 repeat family protein                        146   3e-40   
ref|XP_009611891.1|  PREDICTED: transcriptional corepressor LEUNI...    150   4e-40   
ref|XP_006356768.1|  PREDICTED: transcriptional corepressor LEUNI...    148   5e-40   
ref|XP_010652506.1|  PREDICTED: transcriptional corepressor LEUNI...    146   6e-40   
ref|XP_002266172.1|  PREDICTED: transcriptional corepressor LEUNI...    146   6e-40   
emb|CAN73936.1|  hypothetical protein VITISV_026282                     146   6e-40   
ref|XP_009143947.1|  PREDICTED: transcriptional corepressor LEUNI...    148   8e-40   
ref|XP_009143945.1|  PREDICTED: transcriptional corepressor LEUNI...    148   8e-40   
ref|XP_009760188.1|  PREDICTED: transcriptional corepressor LEUNIG      146   8e-40   
emb|CDY12182.1|  BnaC04g12120D                                          144   8e-40   
ref|XP_009620776.1|  PREDICTED: transcriptional corepressor LEUNI...    146   8e-40   
ref|XP_006586253.1|  PREDICTED: transcriptional corepressor LEUNI...    139   1e-39   
ref|XP_009763485.1|  PREDICTED: transcriptional corepressor LEUNI...    148   1e-39   
ref|XP_004247088.1|  PREDICTED: transcriptional corepressor LEUNI...    148   1e-39   
ref|XP_004290216.1|  PREDICTED: transcriptional corepressor LEUNI...    140   1e-39   
ref|XP_010230532.1|  PREDICTED: transcriptional corepressor LEUNI...    132   1e-39   
gb|KDP26395.1|  hypothetical protein JCGZ_17553                         142   2e-39   
ref|XP_002458129.1|  hypothetical protein SORBIDRAFT_03g027380          140   2e-39   
ref|XP_011460664.1|  PREDICTED: transcriptional corepressor LEUNI...    140   2e-39   
gb|KJB30144.1|  hypothetical protein B456_005G131200                    139   2e-39   
gb|KJB30141.1|  hypothetical protein B456_005G131200                    139   2e-39   
gb|KJB30139.1|  hypothetical protein B456_005G131200                    139   2e-39   
gb|KJB30138.1|  hypothetical protein B456_005G131200                    139   2e-39   
gb|KHG13588.1|  Transcriptional corepressor LEUNIG -like protein        140   2e-39   
ref|XP_008463346.1|  PREDICTED: transcriptional corepressor LEUNI...    141   2e-39   
gb|EMS61864.1|  Transcriptional corepressor LEUNIG                      134   2e-39   
emb|CDX84727.1|  BnaA03g15030D                                          141   3e-39   
ref|XP_007049790.1|  WD-repeat protein isoform 1                        142   3e-39   
ref|XP_006575161.1|  PREDICTED: transcriptional corepressor LEUNI...    142   3e-39   
ref|XP_007049791.1|  WD-repeat protein isoform 2                        142   3e-39   
ref|XP_006575159.1|  PREDICTED: transcriptional corepressor LEUNI...    142   4e-39   
ref|XP_006575158.1|  PREDICTED: transcriptional corepressor LEUNI...    142   4e-39   
ref|XP_003518997.1|  PREDICTED: transcriptional corepressor LEUNI...    142   4e-39   
ref|XP_006575160.1|  PREDICTED: transcriptional corepressor LEUNI...    142   4e-39   
gb|KJB10964.1|  hypothetical protein B456_001G234100                    137   5e-39   
gb|KJB10968.1|  hypothetical protein B456_001G234100                    137   5e-39   
ref|XP_007034391.1|  LEUNIG_homolog isoform 1                           140   5e-39   
gb|KJB10965.1|  hypothetical protein B456_001G234100                    137   5e-39   
gb|KJB10963.1|  hypothetical protein B456_001G234100                    137   5e-39   
gb|KJB10969.1|  hypothetical protein B456_001G234100                    137   5e-39   
gb|KHG14548.1|  Transcriptional corepressor LEUNIG -like protein        137   6e-39   
gb|KJB10966.1|  hypothetical protein B456_001G234100                    137   6e-39   
gb|ACN37000.1|  unknown                                                 148   6e-39   
gb|KDP46176.1|  hypothetical protein JCGZ_06687                         149   7e-39   
gb|KJB10967.1|  hypothetical protein B456_001G234100                    137   7e-39   
emb|CDX79469.1|  BnaC03g18050D                                          141   7e-39   
ref|XP_010109725.1|  Transcriptional corepressor LEUNIG                 142   7e-39   
ref|XP_008235491.1|  PREDICTED: transcriptional corepressor LEUNI...    139   8e-39   
ref|XP_010532887.1|  PREDICTED: transcriptional corepressor LEUNI...    142   8e-39   
ref|XP_010532885.1|  PREDICTED: transcriptional corepressor LEUNI...    142   8e-39   
ref|XP_002879407.1|  WD-40 repeat family protein                        139   9e-39   
ref|XP_010684998.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    139   9e-39   
ref|XP_008235489.1|  PREDICTED: transcriptional corepressor LEUNI...    139   1e-38   
ref|XP_010049941.1|  PREDICTED: transcriptional corepressor LEUNI...    127   1e-38   
gb|KCW82772.1|  hypothetical protein EUGRSUZ_C04148                     127   1e-38   
gb|EMT14678.1|  Transcriptional corepressor LEUNIG                      137   1e-38   
ref|XP_009132864.1|  PREDICTED: transcriptional corepressor LEUNI...    140   1e-38   
ref|XP_009132865.1|  PREDICTED: transcriptional corepressor LEUNI...    140   2e-38   
ref|XP_009371604.1|  PREDICTED: transcriptional corepressor LEUNI...    139   2e-38   
ref|XP_008673193.1|  PREDICTED: hypothetical protein isoform X6         138   2e-38   
ref|XP_008673195.1|  PREDICTED: hypothetical protein isoform X8         138   2e-38   
ref|XP_008673188.1|  PREDICTED: hypothetical protein isoform X1         138   2e-38   
ref|XP_008673196.1|  PREDICTED: hypothetical protein isoform X9         138   2e-38   
tpg|DAA58910.1|  TPA: hypothetical protein ZEAMMB73_487398              138   2e-38   
ref|XP_008673191.1|  PREDICTED: hypothetical protein isoform X4         137   2e-38   
ref|XP_008673190.1|  PREDICTED: hypothetical protein isoform X3         137   2e-38   
ref|XP_008673189.1|  PREDICTED: hypothetical protein isoform X2         137   2e-38   
ref|XP_008673192.1|  PREDICTED: hypothetical protein isoform X5         138   2e-38   
ref|XP_010049943.1|  PREDICTED: transcriptional corepressor LEUNI...    127   2e-38   
ref|XP_010098951.1|  Transcriptional corepressor LEUNIG                 132   2e-38   
ref|NP_001169538.1|  hypothetical protein                               137   2e-38   
ref|XP_008673194.1|  PREDICTED: hypothetical protein isoform X7         137   2e-38   
ref|XP_011024693.1|  PREDICTED: transcriptional corepressor LEUNI...    143   2e-38   
ref|XP_010049942.1|  PREDICTED: transcriptional corepressor LEUNI...    127   2e-38   
ref|XP_006295571.1|  hypothetical protein CARUB_v10024675mg             135   3e-38   
ref|XP_011024689.1|  PREDICTED: transcriptional corepressor LEUNI...    143   3e-38   
ref|XP_011024691.1|  PREDICTED: transcriptional corepressor LEUNI...    143   3e-38   
ref|XP_011024692.1|  PREDICTED: transcriptional corepressor LEUNI...    143   3e-38   
gb|EMS47185.1|  Transcriptional corepressor LEUNIG                      131   3e-38   
ref|XP_010107758.1|  Transcriptional corepressor LEUNIG                 137   3e-38   
ref|XP_006644351.1|  PREDICTED: transcriptional corepressor LEUNI...    140   3e-38   
gb|KHN07186.1|  Transcriptional corepressor LEUNIG                      134   3e-38   
gb|EMT20506.1|  hypothetical protein F775_26146                         131   4e-38   
gb|EYU17986.1|  hypothetical protein MIMGU_mgv1a001888mg                144   4e-38   
gb|EPS70716.1|  hypothetical protein M569_04039                         144   4e-38   
ref|XP_011046456.1|  PREDICTED: transcriptional corepressor LEUNI...    140   5e-38   
ref|XP_006600771.1|  PREDICTED: transcriptional corepressor LEUNI...    135   7e-38   
gb|KHN15134.1|  Transcriptional corepressor LEUNIG                      135   8e-38   
ref|XP_006600769.1|  PREDICTED: transcriptional corepressor LEUNI...    135   8e-38   
ref|XP_006600770.1|  PREDICTED: transcriptional corepressor LEUNI...    135   8e-38   
tpg|DAA58907.1|  TPA: hypothetical protein ZEAMMB73_625314              136   9e-38   
ref|XP_008382635.1|  PREDICTED: transcriptional corepressor LEUNI...    138   1e-37   
ref|NP_001189659.1|  WD40 repeat protein MUCILAGE-MODIFIED 1            135   1e-37   
ref|NP_565749.1|  WD40 repeat protein MUCILAGE-MODIFIED 1               135   1e-37   
ref|NP_001031466.2|  WD40 repeat protein MUCILAGE-MODIFIED 1            135   2e-37   
ref|XP_004968403.1|  PREDICTED: transcriptional corepressor LEUNI...    130   2e-37   
gb|KHN45807.1|  Transcriptional corepressor LEUNIG                      135   2e-37   
ref|XP_006855981.1|  hypothetical protein AMTR_s00037p00237830          135   2e-37   
ref|XP_004492306.1|  PREDICTED: transcriptional corepressor LEUNI...    136   3e-37   
ref|XP_004492304.1|  PREDICTED: transcriptional corepressor LEUNI...    136   4e-37   
ref|XP_004492305.1|  PREDICTED: transcriptional corepressor LEUNI...    136   4e-37   
ref|XP_010051207.1|  PREDICTED: uncharacterized protein LOC104439902    124   5e-37   
ref|XP_002521103.1|  WD-repeat protein, putative                        147   6e-37   
dbj|BAE98454.1|  hypothetical protein                                   133   6e-37   
ref|XP_009334933.1|  PREDICTED: transcriptional corepressor LEUNI...    135   8e-37   
ref|XP_009334934.1|  PREDICTED: transcriptional corepressor LEUNI...    135   9e-37   
ref|XP_008348989.1|  PREDICTED: transcriptional corepressor LEUNI...    135   9e-37   
emb|CDY19159.1|  BnaA04g18990D                                          144   1e-36   
ref|XP_010647372.1|  PREDICTED: transcriptional corepressor LEUNI...    135   1e-36   
ref|XP_009389935.1|  PREDICTED: transcriptional corepressor LEUNI...    122   1e-36   
ref|XP_003525653.1|  PREDICTED: transcriptional corepressor LEUNI...    127   2e-36   
gb|KHN27387.1|  Transcriptional corepressor LEUNIG                      127   2e-36   
ref|XP_006579741.1|  PREDICTED: transcriptional corepressor LEUNI...    127   2e-36   
ref|XP_007201209.1|  hypothetical protein PRUPE_ppa001687mg             131   2e-36   
ref|XP_009372953.1|  PREDICTED: transcriptional corepressor LEUNI...    110   2e-36   
emb|CAN78118.1|  hypothetical protein VITISV_041543                     132   3e-36   
ref|XP_007154936.1|  hypothetical protein PHAVU_003G159500g             131   3e-36   
ref|XP_007154933.1|  hypothetical protein PHAVU_003G159500g             131   3e-36   
ref|XP_010920380.1|  PREDICTED: transcriptional corepressor LEUNI...    127   3e-36   
ref|XP_007154935.1|  hypothetical protein PHAVU_003G159500g             131   3e-36   
ref|XP_007154930.1|  hypothetical protein PHAVU_003G159500g             131   3e-36   
ref|XP_003569328.1|  PREDICTED: transcriptional corepressor LEUNI...    131   4e-36   
ref|XP_010232006.1|  PREDICTED: transcriptional corepressor LEUNI...    131   4e-36   
gb|EYU17970.1|  hypothetical protein MIMGU_mgv1a019969mg                139   4e-36   
ref|XP_007140593.1|  hypothetical protein PHAVU_008G125400g             132   4e-36   
ref|XP_010232005.1|  PREDICTED: transcriptional corepressor LEUNI...    131   4e-36   
ref|XP_010051202.1|  PREDICTED: transcriptional corepressor LEUNI...    139   5e-36   
dbj|BAJ95303.1|  predicted protein                                      135   5e-36   
ref|XP_006829639.1|  hypothetical protein AMTR_s00122p00094620          108   6e-36   
ref|XP_010469559.1|  PREDICTED: transcriptional corepressor LEUNI...    130   7e-36   
ref|XP_010469560.1|  PREDICTED: transcriptional corepressor LEUNI...    129   7e-36   
ref|XP_010469558.1|  PREDICTED: transcriptional corepressor LEUNI...    129   7e-36   
ref|XP_010469555.1|  PREDICTED: transcriptional corepressor LEUNI...    129   7e-36   
gb|KCW58071.1|  hypothetical protein EUGRSUZ_H008012                    129   9e-36   
gb|KCW58069.1|  hypothetical protein EUGRSUZ_H008012                    129   1e-35   
gb|EMT26206.1|  hypothetical protein F775_06650                         131   1e-35   
gb|KJB83313.1|  hypothetical protein B456_013G240700                    105   2e-35   



>ref|XP_011081899.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081901.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081902.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081903.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
 ref|XP_011081904.1| PREDICTED: transcriptional corepressor LEUNIG [Sesamum indicum]
Length=912

 Score =   196 bits (498),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  808  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  867

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIASLAVSTVAGLVASASHDKI+KLWK
Sbjct  868  ELWNMTENKTMTLSAHEGLIASLAVSTVAGLVASASHDKIVKLWK  912


 Score = 75.1 bits (183),  Expect(2) = 9e-64, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPRLGRYLAAAAENVVSILD ETQTCR +LK 
Sbjct  760  TAQVRFQPRLGRYLAAAAENVVSILDAETQTCRHSLKG  797



>gb|EYU21923.1| hypothetical protein MIMGU_mgv1a000972mg [Erythranthe guttata]
Length=926

 Score =   196 bits (497),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+ SG+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  822  DPSGELLASVSEDSVRVWTMRSGSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  881

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIASLAVSTVAGLVASASHDKI+KLWK
Sbjct  882  ELWNMTENKTMTLSAHEGLIASLAVSTVAGLVASASHDKIVKLWK  926


 Score = 72.8 bits (177),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPRLGRYLAAAAENVVSILD ETQ CR +LK 
Sbjct  774  TAQVRFQPRLGRYLAAAAENVVSILDAETQACRHSLKG  811



>ref|XP_009624260.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Nicotiana 
tomentosiformis]
Length=896

 Score =   195 bits (495),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  792  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSL  851

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  852  ELWNMNENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  896


 Score = 73.6 bits (179),  Expect(2) = 4e-63, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  744  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  781



>ref|XP_009787198.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Nicotiana 
sylvestris]
Length=892

 Score =   195 bits (495),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  788  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSL  847

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  848  ELWNMNENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  892


 Score = 73.6 bits (179),  Expect(2) = 5e-63, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  740  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  777



>ref|XP_009787196.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Nicotiana 
sylvestris]
Length=900

 Score =   195 bits (495),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  796  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSL  855

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  856  ELWNMNENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  900


 Score = 73.6 bits (179),  Expect(2) = 5e-63, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  748  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  785



>ref|XP_009624257.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Nicotiana 
tomentosiformis]
Length=904

 Score =   195 bits (495),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  800  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSL  859

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  860  ELWNMNENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  904


 Score = 73.6 bits (179),  Expect(2) = 5e-63, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  752  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  789



>ref|XP_009787197.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Nicotiana 
sylvestris]
Length=895

 Score =   194 bits (494),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  791  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSL  850

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  851  ELWNMNENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  895


 Score = 73.6 bits (179),  Expect(2) = 5e-63, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  743  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  780



>ref|XP_009624258.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Nicotiana 
tomentosiformis]
Length=899

 Score =   194 bits (494),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  795  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPTYSSLLVIGCYQSL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AHEGLIASLAVSTVAGLVASASHDK +KLWK
Sbjct  855  ELWNMNENKTMTLTAHEGLIASLAVSTVAGLVASASHDKFVKLWK  899


 Score = 73.6 bits (179),  Expect(2) = 5e-63, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  747  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  784



>ref|XP_003544623.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX2 
[Glycine max]
Length=893

 Score =   195 bits (496),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSL
Sbjct  789  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSL  848

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  849  ELWNMTENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  893


 Score = 72.0 bits (175),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  741  TAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKG  778



>ref|XP_006596119.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=897

 Score =   195 bits (495),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSL
Sbjct  793  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSL  852

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  853  ELWNMTENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  897


 Score = 72.4 bits (176),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  745  TAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKG  782



>ref|XP_003544622.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX1 
[Glycine max]
Length=902

 Score =   195 bits (495),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSL
Sbjct  798  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSL  857

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  858  ELWNMTENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  902


 Score = 72.0 bits (175),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  750  TAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKG  787



>ref|XP_004498639.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=900

 Score =   194 bits (494),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  796  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  855

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  856  ELWNMTENKTMTLSAHDGLIAALAVSTVNGLVASASHDKFVKLWK  900


 Score = 72.4 bits (176),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  748  TAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKG  785



>ref|XP_004498638.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
Length=909

 Score =   194 bits (494),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  805  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  864

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  865  ELWNMTENKTMTLSAHDGLIAALAVSTVNGLVASASHDKFVKLWK  909


 Score = 72.4 bits (176),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  757  TAQMRFQPRLGRYLAAAAENVVSILDVETQACRYSLKG  794



>emb|CBI20987.3| unnamed protein product [Vitis vinifera]
Length=734

 Score =   197 bits (502),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSGNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  630  DPSGEFLASVSEDSVRVWTLGSGNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  689

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  690  ELWNMSENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  734


 Score = 69.3 bits (168),  Expect(2) = 2e-62, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  582  TAQMRFQPRHGRYLAAAAENVVSILDVETQACRHSLQG  619



>ref|XP_010648611.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Vitis 
vinifera]
Length=901

 Score =   197 bits (501),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSGNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  797  DPSGEFLASVSEDSVRVWTLGSGNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  856

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  857  ELWNMSENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  901


 Score = 69.3 bits (168),  Expect(2) = 2e-62, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  749  TAQMRFQPRHGRYLAAAAENVVSILDVETQACRHSLQG  786



>ref|XP_002284900.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010648609.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
 ref|XP_010648610.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Vitis 
vinifera]
Length=910

 Score =   197 bits (500),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSGNEG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  806  DPSGEFLASVSEDSVRVWTLGSGNEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  865

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  866  ELWNMSENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  910


 Score = 69.3 bits (168),  Expect(2) = 2e-62, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  758  TAQMRFQPRHGRYLAAAAENVVSILDVETQACRHSLQG  795



>ref|XP_011459234.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Fragaria 
vesca subsp. vesca]
Length=892

 Score =   193 bits (490),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  788  DPSGEFLASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  847

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTE KTMTL AHEGLIASLAVSTV GLVASASHDK +KLWK
Sbjct  848  ELWNMTEGKTMTLSAHEGLIASLAVSTVTGLVASASHDKWVKLWK  892


 Score = 71.6 bits (174),  Expect(2) = 7e-62, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T QVRFQPRLGRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  740  TTQVRFQPRLGRYLAAAAENVVSILDVETQACRHSLQG  777



>ref|XP_010322741.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Solanum 
lycopersicum]
Length=899

 Score =   191 bits (484),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  795  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  855  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  899


 Score = 73.6 bits (179),  Expect(2) = 8e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  747  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  784



>ref|XP_004241804.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Solanum 
lycopersicum]
Length=902

 Score =   191 bits (484),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  798  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  857

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  858  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  902


 Score = 73.6 bits (179),  Expect(2) = 8e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  750  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  787



>ref|XP_010322743.1| PREDICTED: transcriptional corepressor LEUNIG isoform X5 [Solanum 
lycopersicum]
Length=894

 Score =   191 bits (484),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  790  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  849

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  850  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  894


 Score = 73.6 bits (179),  Expect(2) = 8e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  742  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  779



>ref|XP_010322742.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Solanum 
lycopersicum]
Length=896

 Score =   191 bits (484),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  792  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  851

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  852  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  896


 Score = 73.6 bits (179),  Expect(2) = 9e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  744  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  781



>ref|XP_004291496.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459233.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Fragaria 
vesca subsp. vesca]
Length=901

 Score =   192 bits (489),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  797  DPSGEFLASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  856

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTE KTMTL AHEGLIASLAVSTV GLVASASHDK +KLWK
Sbjct  857  ELWNMTEGKTMTLSAHEGLIASLAVSTVTGLVASASHDKWVKLWK  901


 Score = 71.6 bits (174),  Expect(2) = 9e-62, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T QVRFQPRLGRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  749  TTQVRFQPRLGRYLAAAAENVVSILDVETQACRHSLQG  786



>ref|XP_006353651.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Solanum tuberosum]
Length=906

 Score =   191 bits (484),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  802  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  861

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  862  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  906


 Score = 73.6 bits (179),  Expect(2) = 9e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  754  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  791



>ref|XP_010322740.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Solanum 
lycopersicum]
Length=904

 Score =   191 bits (484),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  800  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  859

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  860  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  904


 Score = 73.6 bits (179),  Expect(2) = 9e-62, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  752  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  789



>ref|XP_006353653.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Solanum tuberosum]
Length=898

 Score =   191 bits (484),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  794  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  853

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  854  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  898


 Score = 73.2 bits (178),  Expect(2) = 1e-61, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  746  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  783



>ref|XP_006353650.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Solanum tuberosum]
Length=908

 Score =   191 bits (484),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  804  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  863

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  864  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  908


 Score = 73.6 bits (179),  Expect(2) = 1e-61, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  756  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  793



>ref|XP_006353652.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Solanum tuberosum]
Length=900

 Score =   191 bits (484),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELSSNGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  796  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSSNGNKFHSCVFHPAYSSLLVIGCYQSL  855

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL  HEGLIASLAVS VAGLVASASHDK +KLWK
Sbjct  856  ELWNMNENKTMTLTGHEGLIASLAVSGVAGLVASASHDKFVKLWK  900


 Score = 73.2 bits (178),  Expect(2) = 1e-61, Method: Composition-based stats.
 Identities = 33/38 (87%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+GRYLAAAAENVVSILDVETQ CR +LK 
Sbjct  748  TAQVRFQPRIGRYLAAAAENVVSILDVETQACRHSLKG  785



>ref|XP_008394022.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Malus domestica]
Length=897

 Score =   191 bits (485),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT G+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  793  DPSGEFLASVSEDSVRVWTFGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  852

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+L+VSTV GLVASASHDK +KLWK
Sbjct  853  ELWNMTENKTMTLSAHEGLIAALSVSTVTGLVASASHDKFVKLWK  897


 Score = 72.4 bits (176),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVETQTCR +L+ 
Sbjct  745  TAQMRFQPRLGRFLAAAAENVVSILDVETQTCRHSLQG  782



>gb|KEH39820.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=902

 Score =   193 bits (491),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  798  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  857

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LAVSTV GLVASASHD+ +KLWK
Sbjct  858  ELWNMTENKTMTLSAHDGLIAALAVSTVNGLVASASHDRFVKLWK  902


 Score = 69.3 bits (168),  Expect(2) = 3e-61, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +LK 
Sbjct  751  AQMRFQPRLGRFLAAAAENVVSILDVETQACRYSLKG  787



>ref|XP_003588695.1| Transcriptional corepressor LEUNIG [Medicago truncatula]
 gb|AES58946.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=893

 Score =   194 bits (492),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  789  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  848

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LAVSTV GLVASASHD+ +KLWK
Sbjct  849  ELWNMTENKTMTLSAHDGLIAALAVSTVNGLVASASHDRFVKLWK  893


 Score = 68.9 bits (167),  Expect(2) = 3e-61, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +LK 
Sbjct  742  AQMRFQPRLGRFLAAAAENVVSILDVETQACRYSLKG  778



>ref|XP_007013777.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 ref|XP_007013779.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY31396.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY31398.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
Length=910

 Score =   192 bits (487),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  806  DTSGELLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  865

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LAVS V GLV+SASHDKI+KLWK
Sbjct  866  ELWNMTENKTMTLAAHDGLIAALAVSPVTGLVSSASHDKIVKLWK  910


 Score = 70.5 bits (171),  Expect(2) = 3e-61, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  758  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  795



>ref|XP_007013778.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 2 [Theobroma cacao]
 gb|EOY31397.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 2 [Theobroma cacao]
Length=919

 Score =   191 bits (486),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  815  DTSGELLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  874

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LAVS V GLV+SASHDKI+KLWK
Sbjct  875  ELWNMTENKTMTLAAHDGLIAALAVSPVTGLVSSASHDKIVKLWK  919


 Score = 70.9 bits (172),  Expect(2) = 3e-61, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  767  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  804



>ref|XP_009377499.1| PREDICTED: transcriptional corepressor LEUNIG isoform X5 [Pyrus 
x bretschneideri]
Length=897

 Score =   191 bits (486),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  793  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  852

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+L+VSTV GLVASASHDK +KLWK
Sbjct  853  ELWNMTENKTMTLSAHDGLIAALSVSTVTGLVASASHDKFVKLWK  897


 Score = 70.5 bits (171),  Expect(2) = 4e-61, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+ 
Sbjct  745  TAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQG  782



>ref|XP_009377496.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Pyrus 
x bretschneideri]
Length=906

 Score =   191 bits (486),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  802  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  861

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+L+VSTV GLVASASHDK +KLWK
Sbjct  862  ELWNMTENKTMTLSAHDGLIAALSVSTVTGLVASASHDKFVKLWK  906


 Score = 70.5 bits (171),  Expect(2) = 5e-61, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+ 
Sbjct  754  TAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQG  791



>ref|XP_007161251.1| hypothetical protein PHAVU_001G054700g [Phaseolus vulgaris]
 gb|ESW33245.1| hypothetical protein PHAVU_001G054700g [Phaseolus vulgaris]
Length=895

 Score =   192 bits (488),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++SSLLV+GCY+SL
Sbjct  791  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFSSLLVVGCYESL  850

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  851  ELWNMTENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  895


 Score = 69.3 bits (168),  Expect(2) = 6e-61, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSI DVETQ CR +LK 
Sbjct  743  TAQMRFQPRLGRFLAAAAENVVSIFDVETQACRYSLKG  780



>emb|CAF18245.1| STYLOSA protein [Antirrhinum majus]
Length=915

 Score =   192 bits (487),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG+EG+C+HELS NGNKFHSCVFHP+YSSLLVIGCYQSL
Sbjct  811  DPSGELLASVSEDSVRVWTLRSGSEGDCLHELSCNGNKFHSCVFHPTYSSLLVIGCYQSL  870

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIASLAVST AGLVASASHDKI+KLWK
Sbjct  871  ELWNMSENKTMTLSAHEGLIASLAVSTGAGLVASASHDKIVKLWK  915


 Score = 69.3 bits (168),  Expect(2) = 7e-61, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPRLGRYLAAAAENVVSILD ET  CR +LK 
Sbjct  763  TAQVRFQPRLGRYLAAAAENVVSILDSETLACRHSLKG  800



>ref|XP_010526195.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Tarenaya hassleriana]
Length=829

 Score =   191 bits (485),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+LGSG+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSL
Sbjct  725  DPSGEFLASVSEDSVRVWSLGSGSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSL  784

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEG IA+LAVST  GLVASASHDK +KLWK
Sbjct  785  ELWNMSENKTMTLPAHEGRIAALAVSTATGLVASASHDKFVKLWK  829


 Score = 69.3 bits (168),  Expect(2) = 1e-60, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVS+LDVETQ CR +L+ 
Sbjct  677  TTQMRFQPRLGRYLAAAAENVVSVLDVETQACRHSLQG  714



>ref|XP_010526194.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=911

 Score =   190 bits (483),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+LGSG+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSL
Sbjct  807  DPSGEFLASVSEDSVRVWSLGSGSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSL  866

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEG IA+LAVST  GLVASASHDK +KLWK
Sbjct  867  ELWNMSENKTMTLPAHEGRIAALAVSTATGLVASASHDKFVKLWK  911


 Score = 69.7 bits (169),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVS+LDVETQ CR +L+ 
Sbjct  759  TTQMRFQPRLGRYLAAAAENVVSVLDVETQACRHSLQG  796



>ref|XP_010254246.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Nelumbo nucifera]
Length=902

 Score =   190 bits (482),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE  ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSL
Sbjct  798  DPSGELFASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSL  857

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  858  ELWNMSENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  902


 Score = 70.1 bits (170),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  750  TTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQG  787



>ref|XP_010254244.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Nelumbo nucifera]
Length=918

 Score =   190 bits (482),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE  ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSL
Sbjct  814  DPSGELFASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSL  873

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  874  ELWNMSENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  918


 Score = 70.1 bits (170),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  766  TTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQG  803



>ref|XP_010254245.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Nelumbo nucifera]
Length=911

 Score =   189 bits (481),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE  ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSL
Sbjct  807  DPSGELFASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSL  866

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  867  ELWNMSENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  911


 Score = 70.1 bits (170),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  759  TTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQG  796



>ref|XP_002515595.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF47044.1| WD-repeat protein, putative [Ricinus communis]
Length=708

 Score =   189 bits (481),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW LGSG+EG+CVH+LS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  604  DPSGEFLASVSEDSVRVWRLGSGSEGDCVHDLSCNGNKFHSCVFHPTYPSLLVIGCYQSL  663

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+LAVS V G+VASASHDK +KLWK
Sbjct  664  ELWNMTENKTMTLAAHEGLIAALAVSPVTGVVASASHDKFVKLWK  708


 Score = 70.1 bits (170),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAA AENVVSILDVETQ CR +L+ 
Sbjct  556  TAQMRFQPRLGRYLAAVAENVVSILDVETQACRHSLQG  593



>ref|XP_010254242.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nelumbo nucifera]
Length=927

 Score =   189 bits (481),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE  ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSL
Sbjct  823  DPSGELFASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSL  882

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  883  ELWNMSENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  927


 Score = 70.1 bits (170),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  775  TTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQG  812



>ref|XP_010526192.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=960

 Score =   190 bits (482),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+LGSG+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSL
Sbjct  856  DPSGEFLASVSEDSVRVWSLGSGSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSL  915

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEG IA+LAVST  GLVASASHDK +KLWK
Sbjct  916  ELWNMSENKTMTLPAHEGRIAALAVSTATGLVASASHDKFVKLWK  960


 Score = 69.7 bits (169),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVS+LDVETQ CR +L+ 
Sbjct  808  TTQMRFQPRLGRYLAAAAENVVSVLDVETQACRHSLQG  845



>ref|XP_010254243.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Nelumbo nucifera]
Length=922

 Score =   189 bits (481),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE  ASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSYSSLLVIGCYQSL
Sbjct  818  DPSGELFASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYSSLLVIGCYQSL  877

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  878  ELWNMSENKTMTLSAHEGLIAALAVSNATGLVASASHDKYVKLWK  922


 Score = 70.1 bits (170),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  770  TTQMRFQPRLGRYLAAAAENVVSILDVETQMCRHSLQG  807



>ref|XP_010526193.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=958

 Score =   190 bits (482),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+LGSG+EG CVHELS NGNKF SCVFHPSY SLLVIGCYQSL
Sbjct  854  DPSGEFLASVSEDSVRVWSLGSGSEGECVHELSCNGNKFQSCVFHPSYPSLLVIGCYQSL  913

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEG IA+LAVST  GLVASASHDK +KLWK
Sbjct  914  ELWNMSENKTMTLPAHEGRIAALAVSTATGLVASASHDKFVKLWK  958


 Score = 69.7 bits (169),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAENVVS+LDVETQ CR +L+ 
Sbjct  806  TTQMRFQPRLGRYLAAAAENVVSVLDVETQACRHSLQG  843



>ref|XP_003550164.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 
[Glycine max]
Length=912

 Score =   195 bits (496),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSL
Sbjct  808  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSL  867

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  868  ELWNMTENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  912


 Score = 63.9 bits (154),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGRYLAAAAENVVSILDVETQ  R +LK 
Sbjct  762  QMRFQPRLGRYLAAAAENVVSILDVETQASRYSLKG  797



>ref|XP_003550163.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 
[Glycine max]
Length=903

 Score =   196 bits (497),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+YSSLLV+GCYQSL
Sbjct  799  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYSSLLVVGCYQSL  858

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  859  ELWNMTENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  903


 Score = 63.9 bits (154),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGRYLAAAAENVVSILDVETQ  R +LK 
Sbjct  753  QMRFQPRLGRYLAAAAENVVSILDVETQASRYSLKG  788



>ref|XP_002309593.2| LEUNIG family protein [Populus trichocarpa]
 gb|EEE93116.2| LEUNIG family protein [Populus trichocarpa]
Length=900

 Score =   192 bits (488),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LAS SEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSL
Sbjct  796  DPSGEFLASASEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSL  855

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTLPAHEGLIA+LAVST  GLVASASHDK +KLWK
Sbjct  856  ELWNMNENKTMTLPAHEGLIAALAVSTATGLVASASHDKFVKLWK  900


 Score = 67.0 bits (162),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR+GRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  750  QMRFQPRVGRYLAAAAENVVSILDVETQACRHSLQG  785



>ref|XP_008359609.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=910

 Score =   188 bits (478),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  806  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  865

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  866  ELWNMTENKTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  910


 Score = 70.9 bits (172),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+ 
Sbjct  758  TAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQG  795



>ref|XP_008359611.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Malus domestica]
Length=901

 Score =   188 bits (478),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  797  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  856

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  857  ELWNMTENKTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  901


 Score = 70.9 bits (172),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+ 
Sbjct  749  TAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQG  786



>ref|XP_008359608.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=911

 Score =   188 bits (478),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  807  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  866

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  867  ELWNMTENKTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  911


 Score = 70.9 bits (172),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+ 
Sbjct  759  TAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQG  796



>ref|XP_008359612.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Malus domestica]
Length=895

 Score =   188 bits (478),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  791  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  850

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  851  ELWNMTENKTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  895


 Score = 70.9 bits (172),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+ 
Sbjct  743  TAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQG  780



>ref|XP_008359610.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=902

 Score =   188 bits (478),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  798  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  857

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+L+VST  GLVASASHDK +KLWK
Sbjct  858  ELWNMTENKTMTLSAHDGLIAALSVSTGTGLVASASHDKFVKLWK  902


 Score = 70.5 bits (171),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQTCR +L+ 
Sbjct  750  TAQMRFQPRLGRLLAAAAENVVSILDVETQTCRHSLQG  787



>ref|XP_009372950.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=913

 Score =   189 bits (480),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  809  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  868

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  869  ELWNMTENKTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  913


 Score = 68.6 bits (166),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+ 
Sbjct  761  TAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQG  798



>ref|XP_011019744.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Populus 
euphratica]
Length=849

 Score =   193 bits (491),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LAS SEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSL
Sbjct  745  DPSGEYLASASEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSL  804

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTLPAHEGLIA+LAVST  GLVASASHDK++KLWK
Sbjct  805  ELWNMDENKTMTLPAHEGLIAALAVSTATGLVASASHDKLVKLWK  849


 Score = 64.7 bits (156),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  11   VRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            +RFQPR+GRYLAA AENVVSILDVETQ CR +LK 
Sbjct  700  MRFQPRVGRYLAAVAENVVSILDVETQACRHSLKG  734



>ref|XP_009372954.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Pyrus x bretschneideri]
Length=903

 Score =   189 bits (480),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  799  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  858

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  859  ELWNMTENKTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  903


 Score = 68.6 bits (166),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+ 
Sbjct  751  TAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQG  788



>ref|XP_010112086.1| Transcriptional corepressor LEUNIG [Morus notabilis]
 gb|EXC32583.1| Transcriptional corepressor LEUNIG [Morus notabilis]
Length=924

 Score =   186 bits (473),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS +GNKFHSCVFHP+Y SLLV+GCYQSL
Sbjct  820  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCSGNKFHSCVFHPTYPSLLVVGCYQSL  879

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS + GLVASASHDK +KLWK
Sbjct  880  ELWNMSENKTMTLSAHEGLIAALAVSPLTGLVASASHDKYVKLWK  924


 Score = 71.2 bits (173),  Expect(2) = 8e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAAEN+VSILDVETQ CR +L+ 
Sbjct  772  TAQMRFQPRLGRYLAAAAENIVSILDVETQACRHSLQG  809



>ref|XP_009372951.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=912

 Score =   189 bits (480),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  808  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  867

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  868  ELWNMTENKTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  912


 Score = 68.6 bits (166),  Expect(2) = 8e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+ 
Sbjct  760  TAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQG  797



>ref|XP_009372955.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X5 
[Pyrus x bretschneideri]
Length=897

 Score =   189 bits (480),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  793  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  852

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  853  ELWNMTENKTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  897


 Score = 68.6 bits (166),  Expect(2) = 8e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+ 
Sbjct  745  TAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQG  782



>ref|XP_011019742.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Populus 
euphratica]
Length=858

 Score =   193 bits (490),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LAS SEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSL
Sbjct  754  DPSGEYLASASEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSL  813

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTLPAHEGLIA+LAVST  GLVASASHDK++KLWK
Sbjct  814  ELWNMDENKTMTLPAHEGLIAALAVSTATGLVASASHDKLVKLWK  858


 Score = 64.7 bits (156),  Expect(2) = 8e-60, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  11   VRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            +RFQPR+GRYLAA AENVVSILDVETQ CR +LK 
Sbjct  709  MRFQPRVGRYLAAVAENVVSILDVETQACRHSLKG  743



>ref|XP_011019743.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Populus 
euphratica]
Length=857

 Score =   193 bits (490),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LAS SEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSL
Sbjct  753  DPSGEYLASASEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTFPSLLVIGCYQSL  812

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTLPAHEGLIA+LAVST  GLVASASHDK++KLWK
Sbjct  813  ELWNMDENKTMTLPAHEGLIAALAVSTATGLVASASHDKLVKLWK  857


 Score = 64.7 bits (156),  Expect(2) = 8e-60, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  11   VRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            +RFQPR+GRYLAA AENVVSILDVETQ CR +LK 
Sbjct  708  MRFQPRVGRYLAAVAENVVSILDVETQACRHSLKG  742



>ref|XP_007013780.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 4 [Theobroma cacao]
 gb|EOY31399.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 4 [Theobroma cacao]
Length=911

 Score =   187 bits (475),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 96/106 (91%), Gaps = 1/106 (1%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCY-QS  279
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCY QS
Sbjct  806  DTSGELLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQQS  865

Query  280  LELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            LELWNMTENKTMTL AH+GLIA+LAVS V GLV+SASHDKI+KLWK
Sbjct  866  LELWNMTENKTMTLAAHDGLIAALAVSPVTGLVSSASHDKIVKLWK  911


 Score = 70.5 bits (171),  Expect(2) = 8e-60, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  758  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  795



>ref|XP_009372956.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X6 
[Pyrus x bretschneideri]
Length=814

 Score =   188 bits (478),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  710  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  769

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+L+VST  GLVASASHDK +KLWK
Sbjct  770  ELWNMTENKTMTLSAHEGLIAALSVSTGTGLVASASHDKYVKLWK  814


 Score = 68.6 bits (166),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR LAAAAENVVSILDVETQ CR +L+ 
Sbjct  662  TAQMRFQPRLGRLLAAAAENVVSILDVETQACRHSLQG  699



>ref|XP_008219868.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Prunus 
mume]
Length=923

 Score =   190 bits (482),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  819  DPSGEFLASVSEDSVRVWTLGSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSL  878

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  879  ELWNMTENKTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  923


 Score = 66.2 bits (160),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+ 
Sbjct  771  TAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQG  808



>ref|XP_008219867.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Prunus 
mume]
Length=924

 Score =   190 bits (482),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  820  DPSGEFLASVSEDSVRVWTLGSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSL  879

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  880  ELWNMTENKTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  924


 Score = 66.2 bits (160),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+ 
Sbjct  772  TAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQG  809



>ref|XP_008219869.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Prunus 
mume]
Length=914

 Score =   190 bits (482),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  810  DPSGEFLASVSEDSVRVWTLGSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSL  869

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  870  ELWNMTENKTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  914


 Score = 66.2 bits (160),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+ 
Sbjct  762  TAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQG  799



>ref|XP_004501291.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Cicer arietinum]
Length=897

 Score =   184 bits (467),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVR+WTLG+G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSL
Sbjct  793  DPSGELLASVSEDSVRIWTLGTGSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSL  852

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+GLI +L+VSTV GLVASASHDK IKLWK
Sbjct  853  ELWNMAENKTMTLSAHDGLITALSVSTVNGLVASASHDKFIKLWK  897


 Score = 70.1 bits (170),  Expect(2) = 7e-59, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LK 
Sbjct  745  TTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKG  782



>ref|XP_004501290.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Cicer arietinum]
Length=904

 Score =   184 bits (467),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVR+WTLG+G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSL
Sbjct  800  DPSGELLASVSEDSVRIWTLGTGSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSL  859

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+GLI +L+VSTV GLVASASHDK IKLWK
Sbjct  860  ELWNMAENKTMTLSAHDGLITALSVSTVNGLVASASHDKFIKLWK  904


 Score = 70.1 bits (170),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LK 
Sbjct  752  TTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKG  789



>ref|XP_004501292.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Cicer arietinum]
Length=888

 Score =   184 bits (467),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVR+WTLG+G+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSL
Sbjct  784  DPSGELLASVSEDSVRIWTLGTGSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSL  843

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+GLI +L+VSTV GLVASASHDK IKLWK
Sbjct  844  ELWNMAENKTMTLSAHDGLITALSVSTVNGLVASASHDKFIKLWK  888


 Score = 70.1 bits (170),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LK 
Sbjct  736  TTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKG  773



>gb|KDO79600.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
 gb|KDO79601.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=792

 Score =   187 bits (474),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  688  DPSGELLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  747

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  748  ELWNMSENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  792


 Score = 67.0 bits (162),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+ 
Sbjct  640  TAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQG  677



>ref|XP_007225318.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26517.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=636

 Score =   187 bits (475),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  532  DPSGEFLASVSEDSVRVWTLRSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSL  591

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  592  ELWNMTENKTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  636


 Score = 66.2 bits (160),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+ 
Sbjct  484  TAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQG  521



>ref|XP_006476206.1| PREDICTED: transcriptional corepressor LEUNIG-like [Citrus sinensis]
 gb|KDO79595.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=918

 Score =   186 bits (473),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  814  DPSGELLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  873

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  874  ELWNMSENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  918


 Score = 67.0 bits (162),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+ 
Sbjct  766  TAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQG  803



>ref|XP_006450544.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
 gb|ESR63784.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
Length=920

 Score =   186 bits (473),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  816  DPSGELLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  875

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  876  ELWNMSENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  920


 Score = 67.0 bits (162),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+ 
Sbjct  768  TAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQG  805



>gb|KDO79596.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=913

 Score =   186 bits (473),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  809  DPSGELLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  868

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  869  ELWNMSENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  913


 Score = 67.0 bits (162),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+ 
Sbjct  761  TAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQG  798



>ref|XP_006578171.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=907

 Score =   184 bits (468),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSL
Sbjct  803  DPSGELLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSL  862

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  863  ELWNMSENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  907


 Score = 68.9 bits (167),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  755  TTQMRFQPRLGRYLAAAAENIVSIFDVETQACRYSLKG  792



>gb|KDO79598.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=915

 Score =   186 bits (473),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  811  DPSGELLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  870

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  871  ELWNMSENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  915


 Score = 67.0 bits (162),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+ 
Sbjct  763  TAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQG  800



>ref|XP_003522634.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX2 
[Glycine max]
Length=903

 Score =   184 bits (468),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSL
Sbjct  799  DPSGELLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSL  858

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  859  ELWNMSENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  903


 Score = 68.6 bits (166),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  751  TTQMRFQPRLGRYLAAAAENIVSIFDVETQACRYSLKG  788



>ref|XP_007225321.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26520.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=893

 Score =   187 bits (475),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  789  DPSGEFLASVSEDSVRVWTLRSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSL  848

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  849  ELWNMTENKTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  893


 Score = 66.2 bits (160),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+ 
Sbjct  741  TAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQG  778



>ref|XP_003522633.1| PREDICTED: transcriptional corepressor LEUNIG-like isoformX1 
[Glycine max]
Length=912

 Score =   184 bits (468),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFH+ VFHP+Y SLLVIGCYQSL
Sbjct  808  DPSGELLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHASVFHPTYPSLLVIGCYQSL  867

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  868  ELWNMSENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  912


 Score = 68.9 bits (167),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  760  TTQMRFQPRLGRYLAAAAENIVSIFDVETQACRYSLKG  797



>ref|XP_007225320.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26519.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=890

 Score =   187 bits (475),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  786  DPSGEFLASVSEDSVRVWTLRSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSL  845

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  846  ELWNMTENKTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  890


 Score = 66.2 bits (160),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+ 
Sbjct  738  TAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQG  775



>ref|XP_006450543.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
 gb|ESR63783.1| hypothetical protein CICLE_v10007390mg [Citrus clementina]
Length=917

 Score =   186 bits (473),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  813  DPSGELLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  872

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  873  ELWNMSENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  917


 Score = 67.0 bits (162),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+ 
Sbjct  765  TAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQG  802



>ref|XP_007225322.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
 gb|EMJ26521.1| hypothetical protein PRUPE_ppa001131mg [Prunus persica]
Length=899

 Score =   187 bits (475),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SG EG CVHELS NG+KFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  795  DPSGEFLASVSEDSVRVWTLRSGGEGECVHELSCNGSKFHSCVFHPTYTSLLVIGCYQSL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+GLIA+LA+STV GLVASASHDK +KLWK
Sbjct  855  ELWNMTENKTMTLSAHDGLIAALAMSTVTGLVASASHDKFVKLWK  899


 Score = 66.2 bits (160),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GR+LAAAA+NVVSILDVETQ CR +L+ 
Sbjct  747  TAQMRFQPRHGRFLAAAADNVVSILDVETQACRHSLQG  784



>gb|KDO79597.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=903

 Score =   186 bits (472),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  799  DPSGELLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  858

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  859  ELWNMSENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  903


 Score = 67.0 bits (162),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+ 
Sbjct  751  TAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQG  788



>gb|KDO79602.1| hypothetical protein CISIN_1g002471mg [Citrus sinensis]
Length=567

 Score =   186 bits (472),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT+GSG+EG CVHELS NGNKFHSCVFHP+Y SLLVIGCYQSL
Sbjct  463  DPSGELLASVSEDSVRVWTVGSGSEGECVHELSCNGNKFHSCVFHPTYPSLLVIGCYQSL  522

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVST  G VASASHDK +KLWK
Sbjct  523  ELWNMSENKTMTLTAHEGLIAALAVSTETGYVASASHDKFVKLWK  567


 Score = 66.6 bits (161),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQP LGRYLAAAAENVVSILD ETQ CR +L+ 
Sbjct  415  TAQMRFQPHLGRYLAAAAENVVSILDAETQACRLSLQG  452



>ref|XP_011026513.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Populus euphratica]
Length=945

 Score =   188 bits (477),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LAS SEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSL
Sbjct  841  DPSGEYLASASEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSL  900

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAH+G IA+LAVSTV G VASASHDK++KLWK
Sbjct  901  ELWNMSENKTMTLPAHDGQIAALAVSTVTGTVASASHDKLVKLWK  945


 Score = 64.7 bits (156),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQ+RFQPR G+YLAAA ENVVSILDVETQ CR +L+ 
Sbjct  794  AQMRFQPRAGKYLAAATENVVSILDVETQACRHSLQG  830



>ref|XP_011026511.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Populus euphratica]
Length=954

 Score =   188 bits (477),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LAS SEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSL
Sbjct  850  DPSGEYLASASEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSL  909

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAH+G IA+LAVSTV G VASASHDK++KLWK
Sbjct  910  ELWNMSENKTMTLPAHDGQIAALAVSTVTGTVASASHDKLVKLWK  954


 Score = 64.7 bits (156),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQ+RFQPR G+YLAAA ENVVSILDVETQ CR +L+ 
Sbjct  803  AQMRFQPRAGKYLAAATENVVSILDVETQACRHSLQG  839



>ref|XP_011026512.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Populus euphratica]
Length=949

 Score =   187 bits (476),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LAS SEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSL
Sbjct  845  DPSGEYLASASEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSL  904

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAH+G IA+LAVSTV G VASASHDK++KLWK
Sbjct  905  ELWNMSENKTMTLPAHDGQIAALAVSTVTGTVASASHDKLVKLWK  949


 Score = 64.7 bits (156),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQ+RFQPR G+YLAAA ENVVSILDVETQ CR +L+ 
Sbjct  798  AQMRFQPRAGKYLAAATENVVSILDVETQACRHSLQG  834



>ref|XP_011026514.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Populus euphratica]
Length=937

 Score =   187 bits (476),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LAS SEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSL
Sbjct  833  DPSGEYLASASEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSL  892

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAH+G IA+LAVSTV G VASASHDK++KLWK
Sbjct  893  ELWNMSENKTMTLPAHDGQIAALAVSTVTGTVASASHDKLVKLWK  937


 Score = 64.7 bits (156),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQ+RFQPR G+YLAAA ENVVSILDVETQ CR +L+ 
Sbjct  786  AQMRFQPRAGKYLAAATENVVSILDVETQACRHSLQG  822



>ref|XP_002284925.2| PREDICTED: transcriptional corepressor LEUNIG-like [Vitis vinifera]
Length=363

 Score =   186 bits (473),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS DS+RVWTLGSGNEG CVHELS N  KFHSCVFHP+YSSLLVIGCYQSL
Sbjct  259  DPSGEFLASVSVDSIRVWTLGSGNEGECVHELSCNDKKFHSCVFHPTYSSLLVIGCYQSL  318

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  319  ELWNMSENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  363


 Score = 65.9 bits (159),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR GRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  213  QIRFQPRHGRYLAAAAENVVSILDVETQACRHSLQG  248



>emb|CBI20989.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   186 bits (471),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS DS+RVWTLGSGNEG CVHELS N  KFHSCVFHP+YSSLLVIGCYQSL
Sbjct  252  DPSGEFLASVSVDSIRVWTLGSGNEGECVHELSCNDKKFHSCVFHPTYSSLLVIGCYQSL  311

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLIA+LAVSTV+GLVASASHDKI+KLWK
Sbjct  312  ELWNMSENKTMTLSAHDGLIAALAVSTVSGLVASASHDKIVKLWK  356


 Score = 66.2 bits (160),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR GRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  206  QIRFQPRHGRYLAAAAENVVSILDVETQACRHSLQG  241



>ref|XP_010548472.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Tarenaya hassleriana]
Length=894

 Score =   187 bits (474),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSEDSVRVW+LGSG EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  790  DPSGDFLASVSEDSVRVWSLGSGTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  849

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTM LPAH+GLIA+LAVST  GLVASASHDK++KLWK
Sbjct  850  ELWNMSENKTMALPAHDGLIAALAVSTATGLVASASHDKLVKLWK  894


 Score = 64.7 bits (156),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGR+L A AENVVS+LDVETQ CR +L+ 
Sbjct  742  TTQMRFQPRLGRFLVAGAENVVSVLDVETQACRHSLQG  779



>ref|XP_010548470.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Tarenaya hassleriana]
Length=904

 Score =   187 bits (474),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSEDSVRVW+LGSG EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  800  DPSGDFLASVSEDSVRVWSLGSGTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  859

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTM LPAH+GLIA+LAVST  GLVASASHDK++KLWK
Sbjct  860  ELWNMSENKTMALPAHDGLIAALAVSTATGLVASASHDKLVKLWK  904


 Score = 64.7 bits (156),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGR+L A AENVVS+LDVETQ CR +L+ 
Sbjct  752  TTQMRFQPRLGRFLVAGAENVVSVLDVETQACRHSLQG  789



>ref|XP_006581384.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Glycine max]
Length=883

 Score =   182 bits (463),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSL
Sbjct  779  DPSGELLASVSEDSVRVWTLGSGSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSL  838

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  839  ELWNMSENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  883


 Score = 68.9 bits (167),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  731  TTQMRFQPRLGRYLAAAAENIVSIFDVETQVCRYSLKG  768



>gb|KJB83303.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83311.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=942

 Score =   181 bits (458),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  838  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  897

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  898  ELWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  942


 Score = 70.9 bits (172),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK  112
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+
Sbjct  789  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQ  825



>ref|XP_006581383.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Glycine max]
Length=887

 Score =   182 bits (463),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSL
Sbjct  783  DPSGELLASVSEDSVRVWTLGSGSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSL  842

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  843  ELWNMSENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  887


 Score = 68.9 bits (167),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  735  TTQMRFQPRLGRYLAAAAENIVSIFDVETQVCRYSLKG  772



>gb|KJB83312.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=935

 Score =   181 bits (458),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  831  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  890

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  891  ELWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  935


 Score = 70.9 bits (172),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  783  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  820



>ref|XP_003526430.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Glycine max]
Length=892

 Score =   182 bits (463),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG++G CVHELS NGNKFH  VFHP+Y SLLVIGCYQSL
Sbjct  788  DPSGELLASVSEDSVRVWTLGSGSDGECVHELSCNGNKFHKSVFHPTYPSLLVIGCYQSL  847

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  848  ELWNMSENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  892


 Score = 68.9 bits (167),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  740  TTQMRFQPRLGRYLAAAAENIVSIFDVETQVCRYSLKG  777



>gb|KJB83302.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83307.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=941

 Score =   181 bits (458),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  837  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  896

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  897  ELWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  941


 Score = 70.9 bits (172),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  789  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  826



>gb|KJB83304.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83309.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=950

 Score =   181 bits (458),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  846  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  905

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  906  ELWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  950


 Score = 70.9 bits (172),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  798  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  835



>gb|KJB83300.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83310.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=936

 Score =   181 bits (458),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  832  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  891

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  892  ELWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  936


 Score = 70.9 bits (172),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  784  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  821



>ref|XP_010548471.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Tarenaya hassleriana]
Length=899

 Score =   186 bits (473),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSEDSVRVW+LGSG EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  795  DPSGDFLASVSEDSVRVWSLGSGTEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTM LPAH+GLIA+LAVST  GLVASASHDK++KLWK
Sbjct  855  ELWNMSENKTMALPAHDGLIAALAVSTATGLVASASHDKLVKLWK  899


 Score = 64.7 bits (156),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGR+L A AENVVS+LDVETQ CR +L+ 
Sbjct  747  TTQMRFQPRLGRFLVAGAENVVSVLDVETQACRHSLQG  784



>gb|KJB83314.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=945

 Score =   181 bits (458),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  841  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  900

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  901  ELWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  945


 Score = 70.9 bits (172),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  793  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  830



>gb|KJB83305.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83306.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=951

 Score =   181 bits (458),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  847  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  906

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  907  ELWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  951


 Score = 70.9 bits (172),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK  112
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+
Sbjct  798  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQ  834



>gb|KJB83301.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
 gb|KJB83308.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=937

 Score =   181 bits (458),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  833  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  892

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AHEGLIA+LAVS V  LV+SASHDK +KLWK
Sbjct  893  ELWNMSENKTMTLSAHEGLIAALAVSPVTRLVSSASHDKFVKLWK  937


 Score = 70.9 bits (172),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK  112
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+
Sbjct  784  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQ  820



>ref|XP_010914979.1| PREDICTED: transcriptional corepressor LEUNIG-like [Elaeis guineensis]
Length=772

 Score =   187 bits (474),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ L SVSEDSVRVW+L SGNEG CVHELS NGNKFHSCVFHPSY SLLVIGCYQSL
Sbjct  668  DPTGQLLVSVSEDSVRVWSLSSGNEGECVHELSCNGNKFHSCVFHPSYPSLLVIGCYQSL  727

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELW+M ENKTMTLPAHEGLIA+LAVS V GLVASASHDK +KLW+
Sbjct  728  ELWDMDENKTMTLPAHEGLIAALAVSNVNGLVASASHDKFVKLWR  772


 Score = 64.7 bits (156),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQP LGRYLAAAAENVVSILDVETQ C  +L+ 
Sbjct  620  TTQMRFQPHLGRYLAAAAENVVSILDVETQACLHSLEG  657



>ref|XP_010249918.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Nelumbo nucifera]
Length=897

 Score =   189 bits (479),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWT GSGNEG CVHELS NGNKFHSCVFHPSY SLLVIGCYQSL
Sbjct  793  DPSGELLASVSEDSVRVWTFGSGNEGECVHELSCNGNKFHSCVFHPSYPSLLVIGCYQSL  852

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMT+ AHEGLIA+LAVS   GLVASASHDK +KLWK
Sbjct  853  ELWNMAENKTMTMSAHEGLIAALAVSNATGLVASASHDKYVKLWK  897


 Score = 62.4 bits (150),  Expect(2) = 8e-58, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGR LAAAAENVVSILDVETQ  R +L+ 
Sbjct  745  TTQMRFQPRLGRCLAAAAENVVSILDVETQMSRHSLQG  782



>gb|KFK29865.1| hypothetical protein AALP_AA7G189100 [Arabis alpina]
Length=926

 Score =   187 bits (476),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  822  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  881

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  882  ELWNMSENKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  926


 Score = 63.5 bits (153),  Expect(2) = 9e-58, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + QVRFQPR+G+YLAA+A NVVS+LDVETQ CR +L+ 
Sbjct  774  STQVRFQPRVGKYLAASAANVVSVLDVETQACRHSLQG  811



>ref|XP_009377497.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Pyrus 
x bretschneideri]
Length=906

 Score =   180 bits (457),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  793  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  852

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIK  408
            ELWNMTENKTMTL AH+GLIA+L+VSTV GLVASASHD + K
Sbjct  853  ELWNMTENKTMTLSAHDGLIAALSVSTVTGLVASASHDNLSK  894


 Score = 70.5 bits (171),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+ 
Sbjct  745  TAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQG  782



>ref|XP_009377498.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Pyrus 
x bretschneideri]
Length=899

 Score =   180 bits (456),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  786  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  845

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIK  408
            ELWNMTENKTMTL AH+GLIA+L+VSTV GLVASASHD + K
Sbjct  846  ELWNMTENKTMTLSAHDGLIAALSVSTVTGLVASASHDNLSK  887


 Score = 70.5 bits (171),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+ 
Sbjct  738  TAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQG  775



>ref|XP_006371728.1| LEUNIG family protein [Populus trichocarpa]
 gb|ERP49525.1| LEUNIG family protein [Populus trichocarpa]
Length=953

 Score =   186 bits (472),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVSEDSVRVWTLGSG+EG CVHELS NGN+FHSCVFHP++ SLLVIGCYQSL
Sbjct  849  DPSGEYLASVSEDSVRVWTLGSGSEGECVHELSCNGNEFHSCVFHPTFPSLLVIGCYQSL  908

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+G IA+LAVSTV G++ASASHDK +KLWK
Sbjct  909  ELWNMSENKTMTLAAHDGQIAALAVSTVTGMLASASHDKFVKLWK  953


 Score = 64.3 bits (155),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            A++RFQPR G+YLAAAAENVVSILDVETQ CR +L+ 
Sbjct  802  ARMRFQPRAGKYLAAAAENVVSILDVETQACRHSLQG  838



>ref|XP_009377494.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Pyrus 
x bretschneideri]
Length=915

 Score =   180 bits (456),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  802  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  861

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIK  408
            ELWNMTENKTMTL AH+GLIA+L+VSTV GLVASASHD + K
Sbjct  862  ELWNMTENKTMTLSAHDGLIAALSVSTVTGLVASASHDNLSK  903


 Score = 70.5 bits (171),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+ 
Sbjct  754  TAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQG  791



>ref|XP_006412457.1| hypothetical protein EUTSA_v10024343mg [Eutrema salsugineum]
 gb|ESQ53910.1| hypothetical protein EUTSA_v10024343mg [Eutrema salsugineum]
Length=917

 Score =   189 bits (480),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  813  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSL  872

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  873  ELWNMSENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  917


 Score = 60.8 bits (146),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  765  STQMRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  802



>ref|XP_009377500.1| PREDICTED: transcriptional corepressor LEUNIG isoform X6 [Pyrus 
x bretschneideri]
Length=816

 Score =   179 bits (455),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHELS NGNKFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  703  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELSCNGNKFHSCVFHPTYTSLLVIGCYQSL  762

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIK  408
            ELWNMTENKTMTL AH+GLIA+L+VSTV GLVASASHD + K
Sbjct  763  ELWNMTENKTMTLSAHDGLIAALSVSTVTGLVASASHDNLSK  804


 Score = 70.5 bits (171),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVETQ CR +L+ 
Sbjct  655  TAQMRFQPRLGRFLAAAAENVVSILDVETQNCRHSLQG  692



>emb|CDY51674.1| BnaC03g67130D [Brassica napus]
Length=884

 Score =   189 bits (481),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  780  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSL  839

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  840  ELWNMSENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  884


 Score = 60.5 bits (145),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  732  STQLRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  769



>emb|CDY23331.1| BnaA08g12150D [Brassica napus]
Length=912

 Score =   190 bits (482),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  808  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSL  867

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  868  ELWNMSENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  912


 Score = 60.1 bits (144),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  760  STQLRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  797



>ref|XP_010915881.1| PREDICTED: transcriptional corepressor LEUNIG isoform X4 [Elaeis 
guineensis]
Length=891

 Score =   184 bits (466),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            GE LASVSEDSV+VW+LGSG+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW
Sbjct  790  GELLASVSEDSVKVWSLGSGSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELW  849

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTMTLPAH+GLIA+LAVS V GLVASASHDK +KLWK
Sbjct  850  DMPENKTMTLPAHDGLIAALAVSNVTGLVASASHDKFVKLWK  891


 Score = 65.9 bits (159),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GRYLAAAA+N +SILDVETQ CR  LK 
Sbjct  739  TAQMRFQPRQGRYLAAAADNAISILDVETQVCRNLLKG  776



>ref|XP_009367963.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=419

 Score =   181 bits (458),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW LG+G +G CVHELS N NKFHSC FHP+ +SLLV+GCYQ+L
Sbjct  315  DPSGEFLASVSEDSVRVWALGAGGKGECVHELSCNRNKFHSCAFHPADTSLLVVGCYQTL  374

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN+TENKTMTLPAHEGLIASLAVSTV GL+ASASHDK +K+WK
Sbjct  375  ELWNITENKTMTLPAHEGLIASLAVSTVTGLIASASHDKFVKIWK  419


 Score = 68.6 bits (166),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVET TCR +L+ 
Sbjct  267  TAQMRFQPRLGRFLAAAAENVVSILDVETLTCRHSLQG  304



>ref|XP_010915657.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Elaeis 
guineensis]
Length=904

 Score =   183 bits (465),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            GE LASVSEDSV+VW+LGSG+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW
Sbjct  803  GELLASVSEDSVKVWSLGSGSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELW  862

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTMTLPAH+GLIA+LAVS V GLVASASHDK +KLWK
Sbjct  863  DMPENKTMTLPAHDGLIAALAVSNVTGLVASASHDKFVKLWK  904


 Score = 65.9 bits (159),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GRYLAAAA+N +SILDVETQ CR  LK 
Sbjct  752  TAQMRFQPRQGRYLAAAADNAISILDVETQVCRNLLKG  789



>ref|XP_010915804.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Elaeis 
guineensis]
Length=895

 Score =   183 bits (465),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            GE LASVSEDSV+VW+LGSG+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW
Sbjct  794  GELLASVSEDSVKVWSLGSGSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELW  853

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTMTLPAH+GLIA+LAVS V GLVASASHDK +KLWK
Sbjct  854  DMPENKTMTLPAHDGLIAALAVSNVTGLVASASHDKFVKLWK  895


 Score = 65.9 bits (159),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GRYLAAAA+N +SILDVETQ CR  LK 
Sbjct  743  TAQMRFQPRQGRYLAAAADNAISILDVETQVCRNLLKG  780



>ref|XP_010915729.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Elaeis 
guineensis]
Length=901

 Score =   183 bits (465),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            GE LASVSEDSV+VW+LGSG+EG CVHE+S NG+KFHSCVFHP+Y SLLVIGCYQSLELW
Sbjct  800  GELLASVSEDSVKVWSLGSGSEGECVHEMSCNGSKFHSCVFHPAYPSLLVIGCYQSLELW  859

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTMTLPAH+GLIA+LAVS V GLVASASHDK +KLWK
Sbjct  860  DMPENKTMTLPAHDGLIAALAVSNVTGLVASASHDKFVKLWK  901


 Score = 65.9 bits (159),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GRYLAAAA+N +SILDVETQ CR  LK 
Sbjct  749  TAQMRFQPRQGRYLAAAADNAISILDVETQVCRNLLKG  786



>ref|XP_009367962.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=428

 Score =   181 bits (458),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW LG+G +G CVHELS N NKFHSC FHP+ +SLLV+GCYQ+L
Sbjct  324  DPSGEFLASVSEDSVRVWALGAGGKGECVHELSCNRNKFHSCAFHPADTSLLVVGCYQTL  383

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN+TENKTMTLPAHEGLIASLAVSTV GL+ASASHDK +K+WK
Sbjct  384  ELWNITENKTMTLPAHEGLIASLAVSTVTGLIASASHDKFVKIWK  428


 Score = 68.6 bits (166),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGR+LAAAAENVVSILDVET TCR +L+ 
Sbjct  276  TAQMRFQPRLGRFLAAAAENVVSILDVETLTCRHSLQG  313



>ref|XP_009108869.1| PREDICTED: transcriptional corepressor LEUNIG [Brassica rapa]
Length=908

 Score =   189 bits (479),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  804  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSL  863

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  864  ELWNMSENKTMTLPAHEGLIASLAVSTSTGLVASASHDKLVKLWK  908


 Score = 59.7 bits (143),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  756  STQLRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  793



>ref|XP_010670737.1| PREDICTED: transcriptional corepressor LEUNIG [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score =   185 bits (470),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+LG GNEG CVHELS NGNKF+SC FHP+YSSLLVIGCYQS+
Sbjct  826  DTSGEFLASVSEDSVRVWSLGLGNEGECVHELSCNGNKFYSCAFHPTYSSLLVIGCYQSM  885

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLIA+L+VS+V GLVASASHDK +KLWK
Sbjct  886  ELWNMSENKTMTLSAHDGLIAALSVSSVTGLVASASHDKFVKLWK  930


 Score = 63.2 bits (152),  Expect(2) = 5e-57, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR GRYLAAAAENV+SILDVETQ C+  L+ 
Sbjct  778  STQIRFQPRHGRYLAAAAENVISILDVETQACQHRLQG  815



>ref|XP_007137062.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
 gb|ESW09056.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
Length=982

 Score =   181 bits (458),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSV+VW+LGSG+EG CVHELS NG+KFH+CVFHP+Y SLL IGCYQSL
Sbjct  878  DPSGELLASVSEDSVKVWSLGSGSEGECVHELSCNGSKFHACVFHPTYPSLLAIGCYQSL  937

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI +LAVSTV GLVASASHDK +KLWK
Sbjct  938  ELWNMSENKTMTLSAHDGLITALAVSTVNGLVASASHDKFLKLWK  982


 Score = 67.4 bits (163),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  830  TTQMRFQPRLGRYLAAAAENIVSIFDVETQACRFSLKG  867



>ref|XP_007137063.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
 gb|ESW09057.1| hypothetical protein PHAVU_009G096600g [Phaseolus vulgaris]
Length=991

 Score =   181 bits (458),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSV+VW+LGSG+EG CVHELS NG+KFH+CVFHP+Y SLL IGCYQSL
Sbjct  887  DPSGELLASVSEDSVKVWSLGSGSEGECVHELSCNGSKFHACVFHPTYPSLLAIGCYQSL  946

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI +LAVSTV GLVASASHDK +KLWK
Sbjct  947  ELWNMSENKTMTLSAHDGLITALAVSTVNGLVASASHDKFLKLWK  991


 Score = 67.4 bits (163),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  839  TTQMRFQPRLGRYLAAAAENIVSIFDVETQACRFSLKG  876



>gb|KDP32298.1| hypothetical protein JCGZ_13223 [Jatropha curcas]
Length=935

 Score =   177 bits (448),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVSEDSVRVW LGSG+EG  VH+L+ NGNKFHSCVFHP+Y SLLV+GCYQSL
Sbjct  820  DPSGEYLASVSEDSVRVWRLGSGSEGEFVHDLTCNGNKFHSCVFHPTYPSLLVLGCYQSL  879

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELW MTENKTM+L AHEGLIA+LA+S V GLVAS  HDK +KLWK
Sbjct  880  ELWKMTENKTMSLSAHEGLIAALAISPVTGLVASVGHDKFVKLWK  924


 Score = 71.2 bits (173),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR+GRYLAAAAENVVSILDVETQ CR +L+ 
Sbjct  772  TAQMRFQPRMGRYLAAAAENVVSILDVETQVCRHSLQG  809



>emb|CDX75254.1| BnaA01g04480D [Brassica napus]
Length=1117

 Score =   187 bits (475),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103   DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
             D  G+ LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSL
Sbjct  1013  DASGDFLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSL  1072

Query  283   ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
             ELWNM++NKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  1073  ELWNMSQNKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  1117


 Score = 60.5 bits (145),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2     TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
             + Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  965   STQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  1002



>gb|KCW81465.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81466.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81472.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81473.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81474.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81475.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   175 bits (443),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGCYQ+L
Sbjct  795  DSTGDLVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCYQTL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  855  ELWNMAENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  899


 Score = 72.4 bits (176),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAA+NV+SILDVETQ CRQTL+ 
Sbjct  747  TAQLRFQPRLGRYLAAAADNVLSILDVETQACRQTLQG  784



>ref|XP_010049005.1| PREDICTED: transcriptional corepressor LEUNIG [Eucalyptus grandis]
 ref|XP_010049006.1| PREDICTED: transcriptional corepressor LEUNIG [Eucalyptus grandis]
Length=910

 Score =   175 bits (443),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGCYQ+L
Sbjct  806  DSTGDLVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCYQTL  865

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  866  ELWNMAENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  910


 Score = 72.4 bits (176),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAA+NV+SILDVETQ CRQTL+ 
Sbjct  758  TAQLRFQPRLGRYLAAAADNVLSILDVETQACRQTLQG  795



>ref|XP_009138136.1| PREDICTED: transcriptional corepressor LEUNIG-like [Brassica 
rapa]
Length=902

 Score =   186 bits (472),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LA+VSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  798  DPSGDFLATVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSL  857

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTM LPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  858  ELWNMSENKTMALPAHEGLIASLAVSTATGLVASASHDKLVKLWK  902


 Score = 61.2 bits (147),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  750  STQMRFQPRVGKYLAASSSNVVSVLDVETQACRHSLQG  787



>ref|XP_009125844.1| PREDICTED: transcriptional corepressor LEUNIG isoform X1 [Brassica 
rapa]
Length=933

 Score =   186 bits (473),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSL
Sbjct  829  DASGDFLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSL  888

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM++NKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  889  ELWNMSQNKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  933


 Score = 60.5 bits (145),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  781  STQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  818



>ref|XP_009125852.1| PREDICTED: transcriptional corepressor LEUNIG isoform X2 [Brassica 
rapa]
Length=926

 Score =   186 bits (473),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSL
Sbjct  822  DASGDFLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSL  881

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM++NKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  882  ELWNMSQNKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  926


 Score = 60.5 bits (145),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  774  STQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  811



>ref|XP_009125860.1| PREDICTED: transcriptional corepressor LEUNIG isoform X3 [Brassica 
rapa]
Length=925

 Score =   186 bits (473),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSL
Sbjct  821  DASGDFLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSL  880

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM++NKTMTLPAH+GLIASLAVST  GLVASASHDK++KLWK
Sbjct  881  ELWNMSQNKTMTLPAHDGLIASLAVSTATGLVASASHDKLVKLWK  925


 Score = 60.5 bits (145),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  773  STQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  810



>emb|CDY13494.1| BnaA03g52120D [Brassica napus]
Length=887

 Score =   185 bits (470),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LA+VSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  783  DPSGDFLATVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPTYPSLLVIGCYQSL  842

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTM LPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  843  ELWNMSENKTMALPAHEGLIASLAVSTATGLVASASHDKLVKLWK  887


 Score = 61.2 bits (147),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  735  STQMRFQPRVGKYLAASSSNVVSVLDVETQACRHSLQG  772



>ref|XP_008352162.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=401

 Score =   182 bits (462),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLG+G EG CVHEL  NGNKFHSCVFHP+Y+SLLVIGCYQ+L
Sbjct  297  DPSGEFLASVSEDSVRVWTLGAGGEGECVHELICNGNKFHSCVFHPTYTSLLVIGCYQTL  356

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLI SLAVSTV GL+ SASHD  +K+WK
Sbjct  357  ELWNMTENKTMTLXAHEGLIDSLAVSTVTGLIXSASHDXFVKIWK  401


 Score = 64.3 bits (155),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQ+RFQPRLG +LAAAAENVVSILDVETQTC  +L+ 
Sbjct  250  AQIRFQPRLGXFLAAAAENVVSILDVETQTCXXSLQG  286



>emb|CDX72364.1| BnaC07g43860D [Brassica napus]
Length=694

 Score =   184 bits (468),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LA+VSED V+VWTLG+G+EG C+HELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  590  DPSGDFLATVSEDMVKVWTLGTGSEGECIHELSCNGNKFSSCVFHPTYPSLLVIGCYQSL  649

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTM LPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  650  ELWNMSENKTMALPAHEGLIASLAVSTATGLVASASHDKLVKLWK  694


 Score = 61.2 bits (147),  Expect(2) = 3e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  542  STQMRFQPRVGKYLAASSSNVVSVLDVETQACRHSLQG  579



>ref|XP_008811606.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Phoenix dactylifera]
Length=911

 Score =   179 bits (455),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            GE LASVSEDSVRVW+LGSG+EG CVHELS NG+KFHSCVFHP+Y SLLVIGCYQSLELW
Sbjct  810  GELLASVSEDSVRVWSLGSGSEGECVHELSCNGSKFHSCVFHPTYPSLLVIGCYQSLELW  869

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M EN T+TL AHEGLIA+LAVS V GLVASASHDK IKLWK
Sbjct  870  DMAENNTITLGAHEGLIAALAVSNVTGLVASASHDKFIKLWK  911


 Score = 66.2 bits (160),  Expect(2) = 3e-56, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR GRYLAAAA+N +SILDVETQ CRQ L+ 
Sbjct  759  TAQMRFQPRQGRYLAAAADNTISILDVETQACRQMLQG  796



>emb|CDX68860.1| BnaC01g05930D [Brassica napus]
Length=908

 Score =   185 bits (469),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LA+VSED V+VWT G+GNEG CVHELS NGNKF SCVFHP+Y SLLV+GCYQSL
Sbjct  804  DASGDFLATVSEDMVKVWTFGTGNEGECVHELSCNGNKFQSCVFHPTYPSLLVVGCYQSL  863

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM++NKTMTLPAH+GLI SLAVST  GLVASASHDK++KLWK
Sbjct  864  ELWNMSQNKTMTLPAHDGLITSLAVSTATGLVASASHDKLVKLWK  908


 Score = 60.1 bits (144),  Expect(2) = 5e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q RFQPR+G+YLAA++ NVVS+LDVETQ CR +L+ 
Sbjct  756  STQTRFQPRVGKYLAASSANVVSVLDVETQACRHSLQG  793



>gb|KCW81467.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81468.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   172 bits (437),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+L
Sbjct  795  DSTGDLVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  855  ELWNMAENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  899


 Score = 72.4 bits (176),  Expect(2) = 6e-56, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLGRYLAAAA+NV+SILDVETQ CRQTL+ 
Sbjct  747  TAQLRFQPRLGRYLAAAADNVLSILDVETQACRQTLQG  784



>gb|KJB64525.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=943

 Score =   177 bits (450),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D+ GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSL
Sbjct  835  DLSGELLASVSEDSVRVWSFRSGSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSL  894

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTE KT TL AHEGLIA+LAVS V GLV+SASHDK IKLWK
Sbjct  895  ELWNMTEGKTKTLSAHEGLIAALAVSPVTGLVSSASHDKFIKLWK  939


 Score = 67.0 bits (162),  Expect(2) = 7e-56, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR G+YLA AAENVVSILD ETQTCR +L+ 
Sbjct  787  TAQLRFQPRFGKYLALAAENVVSILDAETQTCRHSLQG  824



>gb|KJB64522.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=933

 Score =   177 bits (450),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D+ GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSL
Sbjct  825  DLSGELLASVSEDSVRVWSFRSGSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSL  884

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTE KT TL AHEGLIA+LAVS V GLV+SASHDK IKLWK
Sbjct  885  ELWNMTEGKTKTLSAHEGLIAALAVSPVTGLVSSASHDKFIKLWK  929


 Score = 66.6 bits (161),  Expect(2) = 8e-56, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR G+YLA AAENVVSILD ETQTCR +L+ 
Sbjct  777  TAQLRFQPRFGKYLALAAENVVSILDAETQTCRHSLQG  814



>gb|KJB64523.1| hypothetical protein B456_010G053000 [Gossypium raimondii]
Length=942

 Score =   177 bits (449),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D+ GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHP+  SLLVIGCYQSL
Sbjct  834  DLSGELLASVSEDSVRVWSFRSGSEGECVHELSCNGNKFHSCVFHPTSPSLLVIGCYQSL  893

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTE KT TL AHEGLIA+LAVS V GLV+SASHDK IKLWK
Sbjct  894  ELWNMTEGKTKTLSAHEGLIAALAVSPVTGLVSSASHDKFIKLWK  938


 Score = 67.0 bits (162),  Expect(2) = 8e-56, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR G+YLA AAENVVSILD ETQTCR +L+ 
Sbjct  786  TAQLRFQPRFGKYLALAAENVVSILDAETQTCRHSLQG  823



>gb|KEH35932.1| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=904

 Score =   174 bits (440),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 90/105 (86%), Gaps = 4/105 (4%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVR+WTL    EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSL
Sbjct  804  DPSGELLASVSEDSVRIWTL----EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSL  859

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+GLI +LAVSTV GLVASASHDK IKLWK
Sbjct  860  ELWNMAENKTMTLSAHDGLITALAVSTVNGLVASASHDKFIKLWK  904


 Score = 70.5 bits (171),  Expect(2) = 9e-56, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LK 
Sbjct  756  TTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKG  793



>gb|AES73711.2| transcriptional corepressor leunig-like protein [Medicago truncatula]
Length=897

 Score =   174 bits (440),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 90/105 (86%), Gaps = 4/105 (4%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVR+WTL    EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSL
Sbjct  797  DPSGELLASVSEDSVRIWTL----EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSL  852

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+GLI +LAVSTV GLVASASHDK IKLWK
Sbjct  853  ELWNMAENKTMTLSAHDGLITALAVSTVNGLVASASHDKFIKLWK  897


 Score = 70.5 bits (171),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LK 
Sbjct  749  TTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKG  786



>ref|XP_003603460.1| NAD(P)H-quinone oxidoreductase subunit [Medicago truncatula]
Length=941

 Score =   173 bits (439),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 90/105 (86%), Gaps = 4/105 (4%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVR+WTL    EG CVHELS NG+KFHSCVFHP++ SLLVIGCYQSL
Sbjct  841  DPSGELLASVSEDSVRIWTL----EGECVHELSCNGSKFHSCVFHPTFPSLLVIGCYQSL  896

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+GLI +LAVSTV GLVASASHDK IKLWK
Sbjct  897  ELWNMAENKTMTLSAHDGLITALAVSTVNGLVASASHDKFIKLWK  941


 Score = 70.5 bits (171),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSILDVETQ CR +LK 
Sbjct  793  TTQMRFQPRLGRYLAAAAENIVSILDVETQACRYSLKG  830



>ref|XP_010432701.1| PREDICTED: transcriptional corepressor LEUNIG-like [Camelina 
sativa]
Length=941

 Score =   189 bits (480),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  837  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  896

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  897  ELWNMSENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  941


 Score = 53.9 bits (128),  Expect(2) = 2e-55, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+ 
Sbjct  789  STQMRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQG  826



>ref|XP_010447372.1| PREDICTED: transcriptional corepressor LEUNIG [Camelina sativa]
Length=925

 Score =   189 bits (479),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  821  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  880

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLIASLAVST  GLVASASHDK++KLWK
Sbjct  881  ELWNMSENKTMTLPAHEGLIASLAVSTATGLVASASHDKLVKLWK  925


 Score = 53.9 bits (128),  Expect(2) = 2e-55, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+ 
Sbjct  773  STQMRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQG  810



>ref|XP_009407640.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=761

 Score =   182 bits (462),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE + SVSEDSVRVW+LGSG+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSL
Sbjct  657  DPSGELVVSVSEDSVRVWSLGSGSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSL  716

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELW+M E+KTMTLPAHEGLIA+LAVS V GLVASASHDK +KLWK
Sbjct  717  ELWDMNESKTMTLPAHEGLIAALAVSNVNGLVASASHDKFVKLWK  761


 Score = 60.5 bits (145),  Expect(2) = 3e-55, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GR LAAAAENVVSILDVETQ C   L+ 
Sbjct  609  TTQMRFQPRTGRCLAAAAENVVSILDVETQACLHQLQG  646



>gb|KCW81471.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   172 bits (437),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+L
Sbjct  795  DSTGDLVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  855  ELWNMAENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  899


 Score = 69.7 bits (169),  Expect(2) = 4e-55, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+ 
Sbjct  747  TAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQG  784



>gb|KCW81469.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
 gb|KCW81470.1| hypothetical protein EUGRSUZ_C028381, partial [Eucalyptus grandis]
Length=899

 Score =   172 bits (437),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+L
Sbjct  795  DSTGDLVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  855  ELWNMAENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  899


 Score = 69.7 bits (169),  Expect(2) = 4e-55, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+ 
Sbjct  747  TAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQG  784



>ref|XP_009407639.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=888

 Score =   181 bits (460),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE + SVSEDSVRVW+LGSG+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSL
Sbjct  784  DPSGELVVSVSEDSVRVWSLGSGSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSL  843

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELW+M E+KTMTLPAHEGLIA+LAVS V GLVASASHDK +KLWK
Sbjct  844  ELWDMNESKTMTLPAHEGLIAALAVSNVNGLVASASHDKFVKLWK  888


 Score = 60.5 bits (145),  Expect(2) = 4e-55, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GR LAAAAENVVSILDVETQ C   L+ 
Sbjct  736  TTQMRFQPRTGRCLAAAAENVVSILDVETQACLHQLQG  773



>ref|XP_009407638.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=889

 Score =   181 bits (460),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE + SVSEDSVRVW+LGSG+E +CVHELS NGNKFHSC FHP+Y SLLVIGCYQSL
Sbjct  785  DPSGELVVSVSEDSVRVWSLGSGSEADCVHELSCNGNKFHSCAFHPTYPSLLVIGCYQSL  844

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELW+M E+KTMTLPAHEGLIA+LAVS V GLVASASHDK +KLWK
Sbjct  845  ELWDMNESKTMTLPAHEGLIAALAVSNVNGLVASASHDKFVKLWK  889


 Score = 60.5 bits (145),  Expect(2) = 4e-55, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GR LAAAAENVVSILDVETQ C   L+ 
Sbjct  737  TTQMRFQPRTGRCLAAAAENVVSILDVETQACLHQLQG  774



>ref|NP_567896.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
 sp|Q9FUY2.2|LEUNG_ARATH RecName: Full=Transcriptional corepressor LEUNIG [Arabidopsis 
thaliana]
 gb|AEE86076.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
Length=931

 Score =   187 bits (475),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  827  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  886

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  887  ELWNMSENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  931


 Score = 54.3 bits (129),  Expect(2) = 4e-55, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+ 
Sbjct  779  STQIRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQG  816



>gb|AAG32022.1|AF277458_1 LEUNIG [Arabidopsis thaliana]
Length=931

 Score =   187 bits (475),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  827  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  886

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  887  ELWNMSENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  931


 Score = 54.3 bits (129),  Expect(2) = 5e-55, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+ 
Sbjct  779  STQIRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQG  816



>emb|CAB43692.1| putative protein [Arabidopsis thaliana]
 emb|CAB79972.1| putative protein [Arabidopsis thaliana]
Length=930

 Score =   187 bits (476),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  826  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  885

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  886  ELWNMSENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  930


 Score = 54.3 bits (129),  Expect(2) = 5e-55, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+ 
Sbjct  778  STQIRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQG  815



>ref|NP_001190891.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
 gb|AEE86077.1| transcriptional corepressor LEUNIG [Arabidopsis thaliana]
Length=969

 Score =   187 bits (475),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  865  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  924

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  925  ELWNMSENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  969


 Score = 54.3 bits (129),  Expect(2) = 5e-55, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+ 
Sbjct  817  STQIRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQG  854



>ref|XP_002869264.1| hypothetical protein ARALYDRAFT_491464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45523.1| hypothetical protein ARALYDRAFT_491464 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   187 bits (476),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVSED V+VWTLG+G+EG CVHELS NGNKF SCVFHP+Y SLLVIGCYQSL
Sbjct  816  DPSGDFLASVSEDMVKVWTLGTGSEGECVHELSCNGNKFQSCVFHPAYPSLLVIGCYQSL  875

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTLPAHEGLI SLAVST  GLVASASHDK++KLWK
Sbjct  876  ELWNMSENKTMTLPAHEGLITSLAVSTATGLVASASHDKLVKLWK  920


 Score = 53.9 bits (128),  Expect(2) = 6e-55, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            + Q+RFQPR+G+YLAA++ N+V++LDVETQ  R +L+ 
Sbjct  768  STQMRFQPRVGKYLAASSANLVNVLDVETQAIRHSLQG  805



>ref|XP_010049009.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Eucalyptus grandis]
Length=322

 Score =   171 bits (432),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+L
Sbjct  218  DSTGDLVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTL  277

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  278  ELWNMAENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  322


 Score = 68.9 bits (167),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+ 
Sbjct  170  TAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQG  207



>ref|XP_010049010.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Eucalyptus grandis]
Length=299

 Score =   170 bits (431),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+L
Sbjct  195  DSTGDLVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTL  254

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  255  ELWNMAENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  299


 Score = 68.9 bits (167),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+ 
Sbjct  147  TAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQG  184



>ref|XP_010049007.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010049008.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Eucalyptus grandis]
Length=325

 Score =   170 bits (431),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ +ASVSEDSVRVW +GSG+E +CVHELS NGNK HSCVFHP+Y SLLVIGC+Q+L
Sbjct  221  DSTGDLVASVSEDSVRVWAVGSGSEWDCVHELSCNGNKAHSCVFHPTYPSLLVIGCHQTL  280

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTM LPAH+GLI++LAVS V GLVASASHDK +KLWK
Sbjct  281  ELWNMAENKTMALPAHDGLISALAVSNVTGLVASASHDKTVKLWK  325


 Score = 68.9 bits (167),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG YLAAAA+NV+SILDVETQ CRQTL+ 
Sbjct  173  TAQLRFQPRLGMYLAAAADNVLSILDVETQACRQTLQG  210



>ref|XP_010925121.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Elaeis guineensis]
Length=868

 Score =   180 bits (456),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            G+ LASVSEDSVRVW+ GSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELW
Sbjct  767  GDLLASVSEDSVRVWSFGSGSEGECVHELSCNGNKFHSCVFHPTHPSLLVIGCYQSLELW  826

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M E+KTMTLPAHEGLIA+LAVS V G VASASHDK IKLWK
Sbjct  827  DMPESKTMTLPAHEGLIAALAVSNVTGSVASASHDKFIKLWK  868


 Score = 58.5 bits (140),  Expect(2) = 5e-54, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQ R GRYLAAAA+N +S++DVET+ CRQTLK 
Sbjct  716  TNQMRFQLRQGRYLAAAADNNISMIDVETRVCRQTLKG  753



>ref|XP_010925120.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Elaeis guineensis]
Length=877

 Score =   180 bits (456),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            G+ LASVSEDSVRVW+ GSG+EG CVHELS NGNKFHSCVFHP++ SLLVIGCYQSLELW
Sbjct  776  GDLLASVSEDSVRVWSFGSGSEGECVHELSCNGNKFHSCVFHPTHPSLLVIGCYQSLELW  835

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M E+KTMTLPAHEGLIA+LAVS V G VASASHDK IKLWK
Sbjct  836  DMPESKTMTLPAHEGLIAALAVSNVTGSVASASHDKFIKLWK  877


 Score = 58.5 bits (140),  Expect(2) = 5e-54, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQ R GRYLAAAA+N +S++DVET+ CRQTLK 
Sbjct  725  TNQMRFQLRQGRYLAAAADNNISMIDVETRVCRQTLKG  762



>ref|XP_007221603.1| hypothetical protein PRUPE_ppa026892mg [Prunus persica]
 gb|EMJ22802.1| hypothetical protein PRUPE_ppa026892mg [Prunus persica]
Length=420

 Score =   179 bits (454),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG E  CVHELS NG KFHSCVFHP+Y+SLLVIGCYQSL
Sbjct  316  DPSGEFLASVSEDSVRVWTLGSGGERECVHELSCNGTKFHSCVFHPTYTSLLVIGCYQSL  375

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENK MTL AH+GLI +L +STV GLVASASHDK  KLWK
Sbjct  376  ELWNMTENKIMTLSAHDGLIDALTMSTVTGLVASASHDKFFKLWK  420


 Score = 58.2 bits (139),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            ++RFQP  GR+LAAAA+N VSILDVETQ CR +L+ 
Sbjct  270  KMRFQPHHGRFLAAAADNAVSILDVETQACRHSLQG  305



>ref|XP_002970913.1| hypothetical protein SELMODRAFT_94317 [Selaginella moellendorffii]
 gb|EFJ28239.1| hypothetical protein SELMODRAFT_94317 [Selaginella moellendorffii]
Length=860

 Score =   180 bits (456),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G++LASVSEDSVRVWTL SG +G CVHEL SNGNKFHSCVFHPSY SLL+IGCY+SL
Sbjct  756  DQNGDYLASVSEDSVRVWTLRSGGDGECVHELCSNGNKFHSCVFHPSYPSLLIIGCYESL  815

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK+MT+PAH+GLIA+LA S   G+VASASHDK +KLW+
Sbjct  816  ELWNMVENKSMTIPAHQGLIAALAQSPATGMVASASHDKCVKLWR  860


 Score = 56.2 bits (134),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK  112
            Q+RFQPR GR LAAAAENVVSI DV+ +TCR +L+
Sbjct  710  QMRFQPRHGRLLAAAAENVVSIFDVDAETCRHSLQ  744



>ref|XP_002969651.1| hypothetical protein SELMODRAFT_410492 [Selaginella moellendorffii]
 gb|EFJ29739.1| hypothetical protein SELMODRAFT_410492 [Selaginella moellendorffii]
Length=835

 Score =   181 bits (458),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G++LASVSEDSVRVWTL SG +G CVHEL SNGNKFHSCVFHPSY SLL+IGCY+SL
Sbjct  731  DQNGDYLASVSEDSVRVWTLRSGGDGECVHELCSNGNKFHSCVFHPSYPSLLIIGCYESL  790

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK+MT+PAH+GLIA+LA S   G+VASASHDK +KLW+
Sbjct  791  ELWNMVENKSMTIPAHQGLIAALAQSPATGMVASASHDKCVKLWR  835


 Score = 55.8 bits (133),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK  112
            Q+RFQPR GR LAAAAENVVSI DV+ +TCR +L+
Sbjct  685  QMRFQPRHGRLLAAAAENVVSIFDVDAETCRHSLQ  719



>ref|XP_008445143.1| PREDICTED: LOW QUALITY PROTEIN: transcriptional corepressor LEUNIG 
[Cucumis melo]
Length=899

 Score =   184 bits (467),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SL
Sbjct  795  DPSGEFLASVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESL  854

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN TENKTMTL AHEGL++SLAVST +GLVASASHD+ IKLWK
Sbjct  855  ELWNTTENKTMTLSAHEGLVSSLAVSTASGLVASASHDRFIKLWK  899


 Score = 51.6 bits (122),  Expect(2) = 3e-53, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T  +RFQPRLGRY AA  +N+VSI DVETQ    +L+ 
Sbjct  747  TGPMRFQPRLGRYFAAVVDNIVSIFDVETQARLHSLRG  784



>gb|KDP23675.1| hypothetical protein JCGZ_23508 [Jatropha curcas]
Length=299

 Score =   175 bits (444),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE++ASVSED+VR+WT+GSGNEG C+HELSS+ N+FHSCVFHP+  SLL+IGCYQ+L
Sbjct  195  DPSGEYIASVSEDTVRIWTIGSGNEGECIHELSSDSNRFHSCVFHPTNPSLLIIGCYQTL  254

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLW  414
            ++WNM ENKT+TLPAHEGLIASLAVSTV  LVASASHDK +KLW
Sbjct  255  KIWNMIENKTVTLPAHEGLIASLAVSTVNRLVASASHDKFVKLW  298


 Score = 60.5 bits (145),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKASI  121
            TA +RFQPRLGRYLAAA EN V+++DVETQ C  +L+  +
Sbjct  147  TALIRFQPRLGRYLAAAEENFVAVIDVETQACLHSLEGHV  186



>gb|KFK29867.1| hypothetical protein AALP_AA7G189300 [Arabis alpina]
Length=382

 Score =   174 bits (441),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+D V+VWTLG+G+EG CVHELS NG+ F SCVFHP+Y SLLVIGCYQSL
Sbjct  278  DPSGDFLASVSKDKVKVWTLGTGSEGECVHELSFNGSNFLSCVFHPAYPSLLVIGCYQSL  337

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM E+KTMTLPAHE LIASLAVST  GLVASASHD+++KLWK
Sbjct  338  ELWNMLEHKTMTLPAHEALIASLAVSTATGLVASASHDQLVKLWK  382


 Score = 61.2 bits (147),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQVRFQPR G+YLAA++ NVVSILDVETQ CR +L+ 
Sbjct  231  AQVRFQPRAGKYLAASSANVVSILDVETQACRYSLQG  267



>gb|KFK29866.1| hypothetical protein AALP_AA7G189300 [Arabis alpina]
Length=388

 Score =   174 bits (440),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+D V+VWTLG+G+EG CVHELS NG+ F SCVFHP+Y SLLVIGCYQSL
Sbjct  284  DPSGDFLASVSKDKVKVWTLGTGSEGECVHELSFNGSNFLSCVFHPAYPSLLVIGCYQSL  343

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM E+KTMTLPAHE LIASLAVST  GLVASASHD+++KLWK
Sbjct  344  ELWNMLEHKTMTLPAHEALIASLAVSTATGLVASASHDQLVKLWK  388


 Score = 61.2 bits (147),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQVRFQPR G+YLAA++ NVVSILDVETQ CR +L+ 
Sbjct  237  AQVRFQPRAGKYLAASSANVVSILDVETQACRYSLQG  273



>gb|KHN08101.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=901

 Score =   163 bits (413),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 88/105 (84%), Gaps = 6/105 (6%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFH+ VFHP+Y SLL      SL
Sbjct  803  DPSGELLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHASVFHPTYPSLL------SL  856

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  857  ELWNMSENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  901


 Score = 68.9 bits (167),  Expect(2) = 4e-52, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  755  TTQMRFQPRLGRYLAAAAENIVSIFDVETQACRYSLKG  792



>ref|XP_004138745.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 1 
[Cucumis sativus]
Length=900

 Score =   183 bits (464),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SL
Sbjct  796  DPSGEFLASVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESL  855

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN TENKTMTL AHEGL++SLAVS  +GLVASASHD+ IKLWK
Sbjct  856  ELWNTTENKTMTLSAHEGLVSSLAVSAASGLVASASHDRFIKLWK  900


 Score = 49.3 bits (116),  Expect(2) = 4e-52, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T  +RFQPRLGRY +A  +N+V+I DVETQ    +L+ 
Sbjct  748  TGPMRFQPRLGRYFSAVVDNIVTIFDVETQARVHSLRG  785



>ref|XP_004138746.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform 2 
[Cucumis sativus]
Length=891

 Score =   182 bits (463),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SL
Sbjct  787  DPSGEFLASVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESL  846

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN TENKTMTL AHEGL++SLAVS  +GLVASASHD+ IKLWK
Sbjct  847  ELWNTTENKTMTLSAHEGLVSSLAVSAASGLVASASHDRFIKLWK  891


 Score = 49.3 bits (116),  Expect(2) = 4e-52, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T  +RFQPRLGRY +A  +N+V+I DVETQ    +L+ 
Sbjct  739  TGPMRFQPRLGRYFSAVVDNIVTIFDVETQARVHSLRG  776



>ref|XP_004168288.1| PREDICTED: transcriptional corepressor LEUNIG-like [Cucumis sativus]
Length=900

 Score =   182 bits (463),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SL
Sbjct  796  DPSGEFLASVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESL  855

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN TENKTMTL AHEGL++SLAVS  +GLVASASHD+ IKLWK
Sbjct  856  ELWNTTENKTMTLSAHEGLVSSLAVSAASGLVASASHDRFIKLWK  900


 Score = 49.3 bits (116),  Expect(2) = 4e-52, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T  +RFQPRLGRY +A  +N+V+I DVETQ    +L+ 
Sbjct  748  TGPMRFQPRLGRYFSAVVDNIVTIFDVETQARVHSLRG  785



>gb|KGN62903.1| hypothetical protein Csa_2G379340 [Cucumis sativus]
Length=838

 Score =   182 bits (463),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTL SGNEG  +HELS NGNKFHSCVFHP+YS+LLVIGCY+SL
Sbjct  734  DPSGEFLASVSEDSVRVWTLASGNEGESIHELSCNGNKFHSCVFHPTYSTLLVIGCYESL  793

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN TENKTMTL AHEGL++SLAVS  +GLVASASHD+ IKLWK
Sbjct  794  ELWNTTENKTMTLSAHEGLVSSLAVSAASGLVASASHDRFIKLWK  838


 Score = 48.9 bits (115),  Expect(2) = 6e-52, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T  +RFQPRLGRY +A  +N+V+I DVETQ    +L+ 
Sbjct  686  TGPMRFQPRLGRYFSAVVDNIVTIFDVETQARVHSLRG  723



>gb|KHN16498.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=886

 Score =   161 bits (408),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 87/105 (83%), Gaps = 6/105 (6%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG++G CVHELS NGNKFH  VFHP+Y SLL      SL
Sbjct  788  DPSGELLASVSEDSVRVWTLGSGSDGECVHELSCNGNKFHKSVFHPTYPSLL------SL  841

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENKTMTL AH+GLI SLAVSTV GLVASASHDK +KLWK
Sbjct  842  ELWNMSENKTMTLSAHDGLITSLAVSTVNGLVASASHDKFLKLWK  886


 Score = 68.9 bits (167),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPRLGRYLAAAAEN+VSI DVETQ CR +LK 
Sbjct  740  TTQMRFQPRLGRYLAAAAENIVSIFDVETQVCRYSLKG  777



>ref|XP_002514368.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF48322.1| WD-repeat protein, putative [Ricinus communis]
Length=547

 Score =   174 bits (440),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+D VRVWT+GSG++G C+HELS  GNKFH+CVFHP++SSLL+IGCY++L
Sbjct  443  DPSGEYLASVSDDLVRVWTVGSGSKGECMHELSCTGNKFHTCVFHPTFSSLLIIGCYETL  502

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM E KTMTLPAH+ L+++LAVS V GLVASASHDK+IKLWK
Sbjct  503  ELWNMAEKKTMTLPAHDKLVSALAVSNVTGLVASASHDKLIKLWK  547


 Score = 56.6 bits (135),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q RFQP  GR LAAAAENV+SILDVETQ CR  L+ 
Sbjct  397  QTRFQPHHGRILAAAAENVISILDVETQQCRLKLQG  432



>gb|KDP32334.1| hypothetical protein JCGZ_13259 [Jatropha curcas]
Length=852

 Score =   170 bits (430),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE++ASVS+D VRVWT+GSG++G  +HELS +GNKFH+CVFHP+YSSLL+IGCY++L
Sbjct  748  DPSGEYVASVSDDLVRVWTVGSGSKGEYIHELSCSGNKFHTCVFHPTYSSLLIIGCYETL  807

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN+ ENKTMTLPAH+ L+++LAVS V GLVASASHDK++K WK
Sbjct  808  ELWNLAENKTMTLPAHDKLVSALAVSNVTGLVASASHDKMVKFWK  852


 Score = 58.2 bits (139),  Expect(2) = 7e-51, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q RFQP +GR LAAAAEN++SILDVETQ CR  L+ 
Sbjct  702  QTRFQPHVGRILAAAAENIISILDVETQVCRLKLQG  737



>gb|EPS73524.1| hypothetical protein M569_01232, partial [Genlisea aurea]
Length=340

 Score =   163 bits (413),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSG-NEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQS  279
            D  GE LASVSEDSV+VWT  SG +EG CVH+LS N +KFHSC FHP+YSS+L+IGCYQS
Sbjct  236  DQSGELLASVSEDSVKVWTFRSGASEGECVHQLSCNVSKFHSCAFHPTYSSVLIIGCYQS  295

Query  280  LELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLW  414
            LELWNM EN T++LPAH+GLIASLAVS  AGLVASA HDK++KLW
Sbjct  296  LELWNMNENATVSLPAHDGLIASLAVSPAAGLVASAGHDKVVKLW  340


 Score = 64.3 bits (155),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            +AQVRFQPRLGR+LAAAAENVVSILD ET  C  +LK+
Sbjct  188  SAQVRFQPRLGRFLAAAAENVVSILDAETLNCLHSLKS  225



>ref|XP_002962710.1| hypothetical protein SELMODRAFT_79275 [Selaginella moellendorffii]
 gb|EFJ36173.1| hypothetical protein SELMODRAFT_79275 [Selaginella moellendorffii]
Length=908

 Score =   169 bits (427),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+++ASVSEDSVRVW L +G++G+C+HEL+ NGNKFHSCVFHP   +LLVIGCYQSL
Sbjct  805  DATGDYVASVSEDSVRVWAL-NGSDGDCIHELNCNGNKFHSCVFHPKLPTLLVIGCYQSL  863

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMT+PAH+GLIA+LA S   G+VASASHDK ++LWK
Sbjct  864  ELWNMQENKTMTIPAHDGLIAALAQSPATGMVASASHDKCVRLWK  908


 Score = 58.9 bits (141),  Expect(2) = 7e-51, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK  112
            AQ RFQPR+GR LAAAAENVVSI DV+T+TC  +L+
Sbjct  758  AQTRFQPRVGRLLAAAAENVVSIFDVDTETCVHSLQ  793



>ref|XP_002980381.1| hypothetical protein SELMODRAFT_112245 [Selaginella moellendorffii]
 gb|EFJ18641.1| hypothetical protein SELMODRAFT_112245 [Selaginella moellendorffii]
Length=913

 Score =   169 bits (427),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 1/105 (1%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+++ASVSEDSVRVW L +G++G+C+HEL+ NGNKFHSCVFHP   +LLVIGCYQSL
Sbjct  810  DATGDYVASVSEDSVRVWAL-NGSDGDCIHELNCNGNKFHSCVFHPKLPTLLVIGCYQSL  868

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMT+PAH+GLIA+LA S   G+VASASHDK ++LWK
Sbjct  869  ELWNMQENKTMTIPAHDGLIAALAQSPATGMVASASHDKCVRLWK  913


 Score = 58.9 bits (141),  Expect(2) = 8e-51, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK  112
            AQ RFQPR+GR LAAAAENVVSI DV+T+TC  +L+
Sbjct  763  AQTRFQPRVGRLLAAAAENVVSIFDVDTETCVHSLQ  798



>ref|XP_010656382.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Vitis vinifera]
 emb|CBI28132.3| unnamed protein product [Vitis vinifera]
Length=871

 Score =   163 bits (412),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEG-NCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQS  279
            D  G +LA+VSED V+VWT+GSG +   C+HEL  +GNKF+SC FHP+Y+SLLVIGCYQS
Sbjct  766  DSSGSYLATVSEDLVKVWTVGSGGKAAECIHELHYSGNKFNSCAFHPTYTSLLVIGCYQS  825

Query  280  LELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            LELWNMTENKTMTLPAH+ LI+SLAVS V GLVASASHD  +KLWK
Sbjct  826  LELWNMTENKTMTLPAHDKLISSLAVSNVTGLVASASHDNCVKLWK  871


 Score = 63.5 bits (153),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T  +RFQPR GRYLAAAAE VVSILDVETQ CRQ L+ 
Sbjct  719  TNHMRFQPRHGRYLAAAAEGVVSILDVETQACRQKLQG  756



>ref|XP_010656383.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Vitis vinifera]
Length=870

 Score =   163 bits (412),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEG-NCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQS  279
            D  G +LA+VSED V+VWT+GSG +   C+HEL  +GNKF+SC FHP+Y+SLLVIGCYQS
Sbjct  765  DSSGSYLATVSEDLVKVWTVGSGGKAAECIHELHYSGNKFNSCAFHPTYTSLLVIGCYQS  824

Query  280  LELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            LELWNMTENKTMTLPAH+ LI+SLAVS V GLVASASHD  +KLWK
Sbjct  825  LELWNMTENKTMTLPAHDKLISSLAVSNVTGLVASASHDNCVKLWK  870


 Score = 63.5 bits (153),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T  +RFQPR GRYLAAAAE VVSILDVETQ CRQ L+ 
Sbjct  718  TNHMRFQPRHGRYLAAAAEGVVSILDVETQACRQKLQG  755



>gb|KJB83315.1| hypothetical protein B456_013G240700 [Gossypium raimondii]
Length=928

 Score =   155 bits (392),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVW+  SG+EG CVHELS NGNKFHSCVFHPS+ SLLVIGCYQSL
Sbjct  837  DPSGELLASVSEDSVRVWSFASGSEGECVHELSCNGNKFHSCVFHPSFQSLLVIGCYQSL  896

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTV  366
            ELWNM+ENKTMTL AHEGLIA+LAVS V
Sbjct  897  ELWNMSENKTMTLSAHEGLIAALAVSPV  924


 Score = 70.9 bits (172),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPRLG+YLAAAAENVVSILD ETQTCR +L+ 
Sbjct  789  TAQLRFQPRLGKYLAAAAENVVSILDTETQTCRHSLQG  826



>ref|XP_009405115.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=846

 Score =   170 bits (431),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            G+ LASVSEDSVRVW+LGSGN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W
Sbjct  745  GDILASVSEDSVRVWSLGSGNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIW  804

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTM LPAH+GLIA+LAVS   G+VASASHDK +KLWK
Sbjct  805  DMKENKTMMLPAHDGLIAALAVSNATGVVASASHDKCVKLWK  846


 Score = 55.8 bits (133),  Expect(2) = 3e-50, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GRY+AAAAEN + +LDVETQ  R  L+ 
Sbjct  694  TTQMRFQPRHGRYIAAAAENAICVLDVETQVRRHLLQG  731



>ref|XP_009405109.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   170 bits (431),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            G+ LASVSEDSVRVW+LGSGN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W
Sbjct  757  GDILASVSEDSVRVWSLGSGNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIW  816

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTM LPAH+GLIA+LAVS   G+VASASHDK +KLWK
Sbjct  817  DMKENKTMMLPAHDGLIAALAVSNATGVVASASHDKCVKLWK  858


 Score = 55.5 bits (132),  Expect(2) = 3e-50, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GRY+AAAAEN + +LDVETQ  R  L+ 
Sbjct  706  TTQMRFQPRHGRYIAAAAENAICVLDVETQVRRHLLQG  743



>ref|XP_009405103.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=859

 Score =   170 bits (431),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            G+ LASVSEDSVRVW+LGSGN+  CVHELS  GNKFHSCVF P+Y SLLVIGCYQSLE+W
Sbjct  758  GDILASVSEDSVRVWSLGSGNDSECVHELSCIGNKFHSCVFLPNYPSLLVIGCYQSLEIW  817

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTM LPAH+GLIA+LAVS   G+VASASHDK +KLWK
Sbjct  818  DMKENKTMMLPAHDGLIAALAVSNATGVVASASHDKCVKLWK  859


 Score = 55.5 bits (132),  Expect(2) = 3e-50, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GRY+AAAAEN + +LDVETQ  R  L+ 
Sbjct  707  TTQMRFQPRHGRYIAAAAENAICVLDVETQVRRHLLQG  744



>ref|XP_006451037.1| hypothetical protein CICLE_v10007449mg [Citrus clementina]
 gb|ESR64277.1| hypothetical protein CICLE_v10007449mg [Citrus clementina]
Length=837

 Score =   166 bits (421),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            +  GE+LASVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++L
Sbjct  733  NTSGEYLASVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETL  792

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  793  ELWNMTENKTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  837


 Score = 58.5 bits (140),  Expect(2) = 5e-50, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+ 
Sbjct  687  QMRFQPRLGRILAAAVENYISILDVETQVCRLKLQG  722



>gb|KDO80395.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=835

 Score =   166 bits (421),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            +  GE+LASVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++L
Sbjct  731  NTSGEYLASVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETL  790

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  791  ELWNMTENKTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  835


 Score = 58.2 bits (139),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+ 
Sbjct  685  QMRFQPRLGRILAAAIENYISILDVETQVCRLKLQG  720



>ref|XP_006475763.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Citrus sinensis]
 gb|KDO80393.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=837

 Score =   166 bits (421),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            +  GE+LASVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++L
Sbjct  733  NTSGEYLASVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETL  792

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  793  ELWNMTENKTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  837


 Score = 58.2 bits (139),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+ 
Sbjct  687  QMRFQPRLGRILAAAIENYISILDVETQVCRLKLQG  722



>ref|XP_006475762.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Citrus sinensis]
 gb|KDO80392.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=842

 Score =   166 bits (421),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            +  GE+LASVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++L
Sbjct  738  NTSGEYLASVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETL  797

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  798  ELWNMTENKTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  842


 Score = 58.2 bits (139),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+ 
Sbjct  692  QMRFQPRLGRILAAAIENYISILDVETQVCRLKLQG  727



>gb|KDO80404.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=732

 Score =   167 bits (422),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            +  GE+LASVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++L
Sbjct  628  NTSGEYLASVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETL  687

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  688  ELWNMTENKTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  732


 Score = 57.8 bits (138),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+ 
Sbjct  582  QMRFQPRLGRILAAAIENYISILDVETQVCRLKLQG  617



>gb|KDO80396.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=834

 Score =   166 bits (421),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            +  GE+LASVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++L
Sbjct  730  NTSGEYLASVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETL  789

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  790  ELWNMTENKTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  834


 Score = 58.2 bits (139),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+ 
Sbjct  684  QMRFQPRLGRILAAAIENYISILDVETQVCRLKLQG  719



>gb|KDO80403.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=761

 Score =   167 bits (422),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            +  GE+LASVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++L
Sbjct  657  NTSGEYLASVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETL  716

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  717  ELWNMTENKTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  761


 Score = 57.8 bits (138),  Expect(2) = 7e-50, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+ 
Sbjct  611  QMRFQPRLGRILAAAIENYISILDVETQVCRLKLQG  646



>gb|KDO80405.1| hypothetical protein CISIN_1g003177mg [Citrus sinensis]
Length=545

 Score =   166 bits (420),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            +  GE+LASVS++ VRVW++GSG++G C+HELS  GNKFHSCVFHP++ SLLVIGCY++L
Sbjct  441  NTSGEYLASVSDELVRVWSIGSGSKGECIHELSCTGNKFHSCVFHPTFPSLLVIGCYETL  500

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AH+ L++SLA STV G+VASASHDK +K+WK
Sbjct  501  ELWNMTENKTLTLSAHDKLVSSLAASTVNGMVASASHDKCVKIWK  545


 Score = 57.4 bits (137),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR LAAA EN +SILDVETQ CR  L+ 
Sbjct  395  QMRFQPRLGRILAAAIENYISILDVETQVCRLKLQG  430



>gb|KHG05392.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=755

 Score =   157 bits (396),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 86/105 (82%), Gaps = 6/105 (6%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D+ GE LASVSEDSVRVW+ GSG+EG CVHELS NGNKFHSCVFHP+  SLL      SL
Sbjct  653  DLSGELLASVSEDSVRVWSFGSGSEGECVHELSCNGNKFHSCVFHPTSPSLL------SL  706

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN+TE KT TL AHEGLIA+LAVS V GLV+SASHDK IKLWK
Sbjct  707  ELWNLTEGKTKTLSAHEGLIAALAVSPVTGLVSSASHDKFIKLWK  751


 Score = 66.2 bits (160),  Expect(2) = 1e-49, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQ+RFQPR G+YLA AAENVVSILD ETQTCR +L+ 
Sbjct  605  TAQLRFQPRFGKYLALAAENVVSILDAETQTCRYSLQG  642



>ref|XP_002531278.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF31091.1| WD-repeat protein, putative [Ricinus communis]
Length=316

 Score =   159 bits (402),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            GE++ASVSED+VRVW LGSGN+G C+HELS    KFHSC+FHP+  SLL+IG YQSL +W
Sbjct  215  GEYVASVSEDAVRVWALGSGNDGECIHELSLKNTKFHSCIFHPTNPSLLIIGSYQSLVIW  274

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLW  414
            +MTENKTM LPAHE +IASLAVST   L+ASASHDK++KLW
Sbjct  275  DMTENKTMVLPAHEAIIASLAVSTATRLIASASHDKLVKLW  315


 Score = 61.2 bits (147),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            +A +RFQPRLGRY+AAA ENVVS+LDVETQ C ++L+ 
Sbjct  164  SAMIRFQPRLGRYVAAAEENVVSVLDVETQACLRSLQG  201



>ref|XP_009403020.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=858

 Score =   165 bits (417),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            G+ LASVSEDSVRVW+ G G+EG C+ ELS NGNKFHSCVFHPSY S LVIG Y+SLE+W
Sbjct  757  GDCLASVSEDSVRVWSFGLGSEGECMKELSCNGNKFHSCVFHPSYPSFLVIGSYRSLEIW  816

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTMTL AH+GLIA+LAVS V G++ASASHDK +KLWK
Sbjct  817  DMNENKTMTLTAHDGLIAALAVSNVTGVIASASHDKCVKLWK  858


 Score = 55.1 bits (131),  Expect(2) = 1e-48, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GRYLA AAEN + +LDVETQ  R  L+ 
Sbjct  706  TTQMRFQPRQGRYLAVAAENTICVLDVETQARRHLLQG  743



>ref|XP_009403018.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009403019.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=863

 Score =   165 bits (417),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            G+ LASVSEDSVRVW+ G G+EG C+ ELS NGNKFHSCVFHPSY S LVIG Y+SLE+W
Sbjct  762  GDCLASVSEDSVRVWSFGLGSEGECMKELSCNGNKFHSCVFHPSYPSFLVIGSYRSLEIW  821

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTMTL AH+GLIA+LAVS V G++ASASHDK +KLWK
Sbjct  822  DMNENKTMTLTAHDGLIAALAVSNVTGVIASASHDKCVKLWK  863


 Score = 55.1 bits (131),  Expect(2) = 1e-48, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GRYLA AAEN + +LDVETQ  R  L+ 
Sbjct  711  TTQMRFQPRQGRYLAVAAENTICVLDVETQARRHLLQG  748



>ref|XP_006838727.1| hypothetical protein AMTR_s00002p00252820 [Amborella trichopoda]
 gb|ERN01296.1| hypothetical protein AMTR_s00002p00252820 [Amborella trichopoda]
Length=854

 Score =   162 bits (411),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+++AS SEDSVRVW +G  + G CVHELS +GNKFHSCVFHP Y SLLV+GCYQSL
Sbjct  750  DQSGDYVASASEDSVRVWAVGGRSRGECVHELSCHGNKFHSCVFHPIYPSLLVVGCYQSL  809

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELW+M+E K MT+PAHEGL+A+LA S V G VASASHDK +K+WK
Sbjct  810  ELWDMSEGKCMTVPAHEGLVAALAASNVTGTVASASHDKHVKIWK  854


 Score = 57.0 bits (136),  Expect(2) = 2e-48, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            +Q+RFQP +GR LAAAAENVVSILDVE+Q C  +L+ 
Sbjct  703  SQMRFQPHVGRLLAAAAENVVSILDVESQVCCHSLQG  739



>ref|XP_009387170.1| PREDICTED: transcriptional corepressor LEUNIG-like [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   162 bits (409),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            G+ LASVSEDSVR+W+LG G++G C+ EL+ +G KFHSCVFHPSY SLLVIGCYQSLELW
Sbjct  786  GDRLASVSEDSVRIWSLGLGSDGECIKELNCSGTKFHSCVFHPSYPSLLVIGCYQSLELW  845

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            +M ENKTM   AHEGLIA+LA S V G++AS SHDK +KLWK
Sbjct  846  DMNENKTMPSSAHEGLIAALAASNVTGVIASVSHDKCVKLWK  887


 Score = 57.4 bits (137),  Expect(2) = 2e-48, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T Q+RFQPR GRYLAAAAEN + ILDVETQ  R  L+ 
Sbjct  735  TTQMRFQPRHGRYLAAAAENTIGILDVETQARRHLLQG  772



>ref|XP_009371419.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Pyrus x bretschneideri]
Length=853

 Score =   160 bits (405),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHPSY +LL+IGCY++L
Sbjct  749  DPSGENLASVSDDLVRVWTVGSSCKGEFIHELSCSGNKFNTCVFHPSYPALLIIGCYENL  808

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AHE L++SLAVS+  GLVASASHDK +KLWK
Sbjct  809  ELWNMAENKTMTLHAHEKLVSSLAVSSATGLVASASHDKCVKLWK  853


 Score = 58.9 bits (141),  Expect(2) = 2e-48, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            QVRFQPR GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  703  QVRFQPRFGRNLAAAADNFVSILDVETQICRLKLQG  738



>ref|XP_009371420.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Pyrus x bretschneideri]
Length=851

 Score =   160 bits (405),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHPSY +LL+IGCY++L
Sbjct  747  DPSGENLASVSDDLVRVWTVGSSCKGEFIHELSCSGNKFNTCVFHPSYPALLIIGCYENL  806

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AHE L++SLAVS+  GLVASASHDK +KLWK
Sbjct  807  ELWNMAENKTMTLHAHEKLVSSLAVSSATGLVASASHDKCVKLWK  851


 Score = 58.9 bits (141),  Expect(2) = 2e-48, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            QVRFQPR GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  701  QVRFQPRFGRNLAAAADNFVSILDVETQICRLKLQG  736



>ref|XP_010533194.1| PREDICTED: transcriptional corepressor LEUNIG-like [Tarenaya 
hassleriana]
Length=855

 Score =   163 bits (412),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS D VRVW++GS N+G C+HELSS+GNK+++CVFHP+Y+ LL+IGCY++L
Sbjct  751  DPSGEYLASVSSDMVRVWSIGSSNKGECIHELSSSGNKYNTCVFHPTYTPLLIIGCYETL  810

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+ L+++LA S V+G++ASASHDK  K+WK
Sbjct  811  ELWNMAENKTMTLHAHDNLVSALAASNVSGMIASASHDKFFKIWK  855


 Score = 55.5 bits (132),  Expect(2) = 4e-48, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQP  GR LAAAA+N VSILDVETQ CR+ L+ 
Sbjct  705  QMRFQPGAGRILAAAADNYVSILDVETQVCRRKLQG  740



>ref|XP_007013296.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
 gb|EOY30915.1| LisH dimerization motif,WD40/YVTN repeat-like-containing domain 
isoform 1 [Theobroma cacao]
Length=863

 Score =   161 bits (407),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS+D VRVWT+ SG +G CVHEL+  GNKF++CVFHP+Y SLLVIGCY++L
Sbjct  759  DPTGEFLASVSDDLVRVWTVSSGGKGECVHELNCTGNKFNTCVFHPTYPSLLVIGCYETL  818

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKT+TL AHE L+++LAVS    +VASASHDK +KLWK
Sbjct  819  ELWNMTENKTLTLHAHEKLVSALAVSNATSMVASASHDKCVKLWK  863


 Score = 56.6 bits (135),  Expect(2) = 7e-48, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR+GR+LAAAA+N VS+LDVE Q CR  L+ 
Sbjct  713  QMRFQPRVGRFLAAAADNSVSLLDVENQVCRAKLQG  748



>ref|XP_010245978.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Nelumbo nucifera]
Length=802

 Score =   164 bits (414),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+DSVRVW+L +G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSL
Sbjct  701  DSTGDRLASVSQDSVRVWSLSTGE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSL  757

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  758  ELWNMSENKSMTVPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  802


 Score = 53.5 bits (127),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+G+ LAAAA+NVVSI DVET      L+ 
Sbjct  653  TAQVRFQPRIGQLLAAAADNVVSIFDVETDRLTHALQG  690



>ref|XP_010245980.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Nelumbo nucifera]
Length=772

 Score =   164 bits (414),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+DSVRVW+L +G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSL
Sbjct  671  DSTGDRLASVSQDSVRVWSLSTGE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSL  727

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  728  ELWNMSENKSMTVPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  772


 Score = 53.5 bits (127),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+G+ LAAAA+NVVSI DVET      L+ 
Sbjct  623  TAQVRFQPRIGQLLAAAADNVVSIFDVETDRLTHALQG  660



>ref|XP_010245979.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Nelumbo nucifera]
Length=788

 Score =   163 bits (413),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+DSVRVW+L +G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSL
Sbjct  687  DSTGDRLASVSQDSVRVWSLSTGE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSL  743

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  744  ELWNMSENKSMTVPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  788


 Score = 53.5 bits (127),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+G+ LAAAA+NVVSI DVET      L+ 
Sbjct  639  TAQVRFQPRIGQLLAAAADNVVSIFDVETDRLTHALQG  676



>ref|XP_008337351.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Malus domestica]
Length=854

 Score =   159 bits (401),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+D VRVWT+GS  +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++L
Sbjct  750  DPSGEYLASVSDDLVRVWTVGSSCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETL  809

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  810  ELWNMAENKTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  854


 Score = 58.2 bits (139),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  704  QMRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQG  739



>ref|XP_008337350.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=857

 Score =   159 bits (401),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+D VRVWT+GS  +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++L
Sbjct  753  DPSGEYLASVSDDLVRVWTVGSSCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETL  812

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  813  ELWNMAENKTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  857


 Score = 58.2 bits (139),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  707  QMRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQG  742



>ref|XP_010245981.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Nelumbo nucifera]
Length=758

 Score =   163 bits (413),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+DSVRVW+L +G    C+HELSSN NKFHSCVFHP+Y +LLVIG YQSL
Sbjct  657  DSTGDRLASVSQDSVRVWSLSTGE---CIHELSSNANKFHSCVFHPAYPTLLVIGGYQSL  713

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM+ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  714  ELWNMSENKSMTVPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  758


 Score = 53.5 bits (127),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+G+ LAAAA+NVVSI DVET      L+ 
Sbjct  609  TAQVRFQPRIGQLLAAAADNVVSIFDVETDRLTHALQG  646



>ref|XP_008337347.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=863

 Score =   159 bits (401),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+D VRVWT+GS  +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++L
Sbjct  759  DPSGEYLASVSDDLVRVWTVGSSCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETL  818

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  819  ELWNMAENKTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  863


 Score = 58.2 bits (139),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  713  QMRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQG  748



>ref|XP_009374058.1| PREDICTED: transcriptional corepressor LEUNIG-like [Pyrus x bretschneideri]
Length=843

 Score =   157 bits (398),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = +1

Query  112  GEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSLELW  291
            GE+LASVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++LELW
Sbjct  742  GEYLASVSDDLVRVWTVGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETLELW  801

Query  292  NMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            NM ENKTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  802  NMAENKTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  843


 Score = 59.3 bits (142),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            QVRFQPR GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  693  QVRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQG  728



>ref|XP_008337349.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=859

 Score =   159 bits (401),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+D VRVWT+GS  +G  +HELS +GNKF +CVFHP+Y +LLVIGCY++L
Sbjct  755  DPSGEYLASVSDDLVRVWTVGSSCKGELIHELSCSGNKFKTCVFHPTYPALLVIGCYETL  814

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  815  ELWNMAENKTMTLHAHDKLVSSLAVSNATGLVASASHDKCVKLWK  859


 Score = 58.2 bits (139),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  709  QMRFQPRFGRNLAAAADNFVSILDVETQVCRLKLQG  744



>gb|ACZ98534.1| LisH-SSDP-WD40 [Malus domestica]
Length=905

 Score =   160 bits (405),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G++LASVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++L
Sbjct  753  DPSGDYLASVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETL  812

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  813  ELWNMTENKTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  857


 Score = 56.2 bits (134),  Expect(2) = 2e-47, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            +QVRFQP  GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  706  SQVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQG  742



>ref|XP_008386062.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Malus domestica]
Length=855

 Score =   160 bits (406),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G++LASVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++L
Sbjct  751  DPSGDYLASVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETL  810

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  811  ELWNMTENKTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  855


 Score = 55.5 bits (132),  Expect(2) = 2e-47, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            QVRFQP  GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  705  QVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQG  740



>ref|XP_008386048.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Malus domestica]
Length=860

 Score =   160 bits (405),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G++LASVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++L
Sbjct  756  DPSGDYLASVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETL  815

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  816  ELWNMTENKTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  860


 Score = 55.5 bits (132),  Expect(2) = 2e-47, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            QVRFQP  GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  710  QVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQG  745



>ref|XP_008386053.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Malus domestica]
Length=856

 Score =   160 bits (405),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G++LASVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++L
Sbjct  752  DPSGDYLASVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETL  811

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  812  ELWNMTENKTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  856


 Score = 55.5 bits (132),  Expect(2) = 3e-47, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            QVRFQP  GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  706  QVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQG  741



>ref|XP_002518113.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF44246.1| WD-repeat protein, putative [Ricinus communis]
Length=782

 Score =   162 bits (411),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            DV G++LASVS++SVRVW+L SG    C+HELSS+GNKFHSCVFHPSYS+LLVIG YQSL
Sbjct  681  DVNGDYLASVSQESVRVWSLASGE---CIHELSSSGNKFHSCVFHPSYSTLLVIGGYQSL  737

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT+PAHE +I++LA S V G+VASASHDK +K+WK
Sbjct  738  ELWNMAENKCMTIPAHECVISALAQSPVTGMVASASHDKCVKIWK  782


 Score = 53.1 bits (126),  Expect(2) = 3e-47, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQT  106
            AQVRFQPR+G  LAAAAENVVSI DVET   RQT
Sbjct  634  AQVRFQPRIGHLLAAAAENVVSIFDVETD--RQT  665



>gb|KHN15508.1| Transcriptional corepressor LEUNIG [Glycine soja]
Length=864

 Score =   151 bits (381),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 81/105 (77%), Gaps = 16/105 (15%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVSEDSVRVWTLGSG+EG CVHELS NGNKFHSC                SL
Sbjct  776  DPSGEFLASVSEDSVRVWTLGSGSEGECVHELSCNGNKFHSC----------------SL  819

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AHEGLIA+LAVSTV GLVASASHDK +KLWK
Sbjct  820  ELWNMTENKTMTLSAHEGLIAALAVSTVNGLVASASHDKFVKLWK  864


 Score = 64.3 bits (155),  Expect(2) = 4e-47, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGRYLAAAAENVVSILDVETQ  R +LK 
Sbjct  730  QMRFQPRLGRYLAAAAENVVSILDVETQASRYSLKG  765



>ref|XP_008390143.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=448

 Score =   160 bits (404),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G++LASVS+D VRVWT+GS  +G  +HELS +GNKF++CVFHP+Y +LLVIGCY++L
Sbjct  344  DPSGDYLASVSDDLVRVWTIGSSCKGEFIHELSCSGNKFNTCVFHPTYPALLVIGCYETL  403

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+ L++SLAVS+  GLVASASHDK +KLWK
Sbjct  404  ELWNMTENKTMTLHAHDKLVSSLAVSSATGLVASASHDKCVKLWK  448


 Score = 55.5 bits (132),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            QVRFQP  GR LAAAA+N VSILDVETQ CR  L+ 
Sbjct  298  QVRFQPCFGRNLAAAADNFVSILDVETQVCRLKLQG  333



>ref|XP_010264093.1| PREDICTED: transcriptional corepressor LEUNIG-like [Nelumbo nucifera]
Length=799

 Score =   162 bits (410),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+DSVRVW++   N G C+HEL+SN NKFHSCVFHP+Y SLLVIG YQSL
Sbjct  698  DANGDLLASVSQDSVRVWSV---NTGECLHELNSNANKFHSCVFHPTYHSLLVIGGYQSL  754

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK+MT+PAHEG+IA+LA S V G+VASASHDK +KLWK
Sbjct  755  ELWNMAENKSMTIPAHEGVIAALAQSPVTGMVASASHDKSVKLWK  799


 Score = 52.8 bits (125),  Expect(2) = 5e-47, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVET  88
            TAQVRFQPR+G+ LAAAA+N+VSI DVET
Sbjct  650  TAQVRFQPRIGQLLAAAADNIVSIFDVET  678



>gb|KHG11579.1| Transcriptional corepressor LEUNIG -like protein [Gossypium arboreum]
Length=774

 Score =   158 bits (400),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS+D VRVWT+GS  +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++L
Sbjct  670  DATGEFLASVSDDLVRVWTVGSSGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETL  729

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT  AHE L+++LA ST   +VASASHDK +KLWK
Sbjct  730  ELWNMLENKIMTRHAHENLVSALAASTSTRMVASASHDKCVKLWK  774


 Score = 56.2 bits (134),  Expect(2) = 6e-47, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR+GR+LAAA +N VS+LDVE Q CR  L+ 
Sbjct  624  QIRFQPRVGRFLAAATDNSVSLLDVEAQVCRAKLQG  659



>ref|XP_006857440.1| hypothetical protein AMTR_s00067p00167320 [Amborella trichopoda]
 gb|ERN18907.1| hypothetical protein AMTR_s00067p00167320 [Amborella trichopoda]
Length=839

 Score =   157 bits (397),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G++LASVSEDSVRVW+L SG E  C+HEL+SNGN FHSCVFHPS+ +LLVIG YQ+L
Sbjct  737  DASGDYLASVSEDSVRVWSLASGEE--CIHELNSNGNNFHSCVFHPSFPTLLVIGGYQTL  794

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM E+  M++ AHEGLIA+LA S   G+VASASHDK +K+WK
Sbjct  795  ELWNMAEDSRMSIQAHEGLIAALAQSPATGMVASASHDKCVKIWK  839


 Score = 57.0 bits (136),  Expect(2) = 9e-47, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLK  112
            TAQVRFQPR+G+ LAAAAENVVSI DVET     TLK
Sbjct  689  TAQVRFQPRVGQLLAAAAENVVSIFDVETDRRTHTLK  725



>ref|XP_008394021.1| PREDICTED: transcriptional corepressor LEUNIG-like [Malus domestica]
Length=342

 Score =   151 bits (382),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS+DSVRVW LG+G EG CVHELS  GNKF SCVFH +Y+SLLVIGCYQ+L
Sbjct  230  DPSGEFLASVSDDSVRVWALGAGGEGECVHELSCXGNKFQSCVFHHTYTSLLVIGCYQTL  289

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAG  372
            ELWNMTENK MTLPAHEGLIASLAVS V G
Sbjct  290  ELWNMTENKVMTLPAHEGLIASLAVSNVTG  319


 Score = 62.0 bits (149),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPRLGR+LA AAENVV ILDVET+ CR +L+ 
Sbjct  184  QLRFQPRLGRFLATAAENVVHILDVETZACRHSLQG  219



>gb|KDP39380.1| hypothetical protein JCGZ_01137 [Jatropha curcas]
Length=781

 Score =   161 bits (407),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 91/105 (87%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            DV G++LASVS++SVRVW+L SG    C+HELSS+GNKFHSCVFHPSYS+LLVIG YQSL
Sbjct  680  DVNGDYLASVSQESVRVWSLASGE---CIHELSSSGNKFHSCVFHPSYSTLLVIGGYQSL  736

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT+PAHE +I++LA S + G+VASASHDK +K+WK
Sbjct  737  ELWNMAENKCMTIPAHECVISALAQSPLTGMVASASHDKCVKIWK  781


 Score = 52.0 bits (123),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 2/35 (6%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQT  106
            TAQVRFQPR+G  LAAAAEN VSI DVE    RQT
Sbjct  632  TAQVRFQPRIGHLLAAAAENTVSIFDVEAD--RQT  664



>gb|KJB64846.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=867

 Score =   157 bits (396),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS+D VRVWT+GS  +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++L
Sbjct  763  DATGEFLASVSDDLVRVWTVGSSGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETL  822

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT  AHE L+++LA S    +VASASHDK +KLWK
Sbjct  823  ELWNMLENKIMTRHAHENLVSALAASNSTRMVASASHDKCVKLWK  867


 Score = 55.8 bits (133),  Expect(2) = 3e-46, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR+GR+LAAA +N VS+LDVE Q CR  L+ 
Sbjct  717  QIRFQPRVGRFLAAATDNSVSLLDVEAQVCRAKLQG  752



>gb|KJB64850.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=847

 Score =   157 bits (396),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS+D VRVWT+GS  +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++L
Sbjct  743  DATGEFLASVSDDLVRVWTVGSSGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETL  802

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT  AHE L+++LA S    +VASASHDK +KLWK
Sbjct  803  ELWNMLENKIMTRHAHENLVSALAASNSTRMVASASHDKCVKLWK  847


 Score = 55.5 bits (132),  Expect(2) = 3e-46, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR+GR+LAAA +N VS+LDVE Q CR  L+ 
Sbjct  697  QIRFQPRVGRFLAAATDNSVSLLDVEAQVCRAKLQG  732



>gb|KJB64845.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=846

 Score =   157 bits (396),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS+D VRVWT+GS  +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++L
Sbjct  742  DATGEFLASVSDDLVRVWTVGSSGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETL  801

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT  AHE L+++LA S    +VASASHDK +KLWK
Sbjct  802  ELWNMLENKIMTRHAHENLVSALAASNSTRMVASASHDKCVKLWK  846


 Score = 55.5 bits (132),  Expect(2) = 3e-46, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR+GR+LAAA +N VS+LDVE Q CR  L+ 
Sbjct  696  QIRFQPRVGRFLAAATDNSVSLLDVEAQVCRAKLQG  731



>gb|KJB64849.1| hypothetical protein B456_010G067800 [Gossypium raimondii]
Length=882

 Score =   156 bits (395),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE LASVS+D VRVWT+GS  +G CVHEL+  GNKF++CVFHPSYSSLLVIGCY++L
Sbjct  778  DATGEFLASVSDDLVRVWTVGSSGKGECVHELNRTGNKFNTCVFHPSYSSLLVIGCYETL  837

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT  AHE L+++LA S    +VASASHDK +KLWK
Sbjct  838  ELWNMLENKIMTRHAHENLVSALAASNSTRMVASASHDKCVKLWK  882


 Score = 55.8 bits (133),  Expect(2) = 3e-46, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQPR+GR+LAAA +N VS+LDVE Q CR  L+ 
Sbjct  732  QIRFQPRVGRFLAAATDNSVSLLDVEAQVCRAKLQG  767



>ref|XP_008785186.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Phoenix dactylifera]
Length=798

 Score =   157 bits (396),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+HLASVS+DSV+VW+L SG    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+L
Sbjct  697  DANGDHLASVSQDSVKVWSLTSGE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTL  753

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM EN+TMT  AH+GLIA+LA S V G+VASASHD+ +K+WK
Sbjct  754  ELWNMAENQTMTAQAHDGLIAALAQSPVTGIVASASHDRSVKIWK  798


 Score = 54.7 bits (130),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQVRFQPR+G  LAAAAENVVSI+DVET    +TL+ 
Sbjct  650  AQVRFQPRIGHLLAAAAENVVSIIDVETDMKTRTLQG  686



>ref|XP_008785188.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Phoenix dactylifera]
Length=797

 Score =   157 bits (396),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+HLASVS+DSV+VW+L SG    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+L
Sbjct  696  DANGDHLASVSQDSVKVWSLTSGE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTL  752

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM EN+TMT  AH+GLIA+LA S V G+VASASHD+ +K+WK
Sbjct  753  ELWNMAENQTMTAQAHDGLIAALAQSPVTGIVASASHDRSVKIWK  797


 Score = 54.7 bits (130),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQVRFQPR+G  LAAAAENVVSI+DVET    +TL+ 
Sbjct  649  AQVRFQPRIGHLLAAAAENVVSIIDVETDMKTRTLQG  685



>ref|XP_008785183.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008785184.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008785185.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
Length=799

 Score =   157 bits (396),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+HLASVS+DSV+VW+L SG    C+HELSSNGN+FHSC FHP Y  LLVIG YQ+L
Sbjct  698  DANGDHLASVSQDSVKVWSLTSGE---CIHELSSNGNQFHSCTFHPRYPKLLVIGGYQTL  754

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM EN+TMT  AH+GLIA+LA S V G+VASASHD+ +K+WK
Sbjct  755  ELWNMAENQTMTAQAHDGLIAALAQSPVTGIVASASHDRSVKIWK  799


 Score = 54.3 bits (129),  Expect(2) = 6e-46, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  5    AQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            AQVRFQPR+G  LAAAAENVVSI+DVET    +TL+ 
Sbjct  651  AQVRFQPRIGHLLAAAAENVVSIIDVETDMKTRTLQG  687



>ref|XP_003570372.1| PREDICTED: transcriptional corepressor LEUNIG [Brachypodium distachyon]
Length=800

 Score =   154 bits (388),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G +LASVS+D V+VW++ SG+   C+HE+SSNGNKFHSCVFHPSY++LLVIG YQSL
Sbjct  699  DNTGSYLASVSQDLVKVWSISSGD---CIHEVSSNGNKFHSCVFHPSYTNLLVIGGYQSL  755

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM +N++MT+ AHEGLIA+LA S V G+VASASHD  +KLWK
Sbjct  756  ELWNMVKNQSMTVQAHEGLIAALAQSPVTGMVASASHDNSVKLWK  800


 Score = 55.8 bits (133),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQP  G++LAAA ENVVSI DVET T + TL+ 
Sbjct  651  TAQVRFQPNTGQFLAAATENVVSIFDVETHTKKYTLQG  688



>ref|XP_007204646.1| hypothetical protein PRUPE_ppa001612mg [Prunus persica]
 gb|EMJ05845.1| hypothetical protein PRUPE_ppa001612mg [Prunus persica]
Length=792

 Score =   155 bits (393),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+D VRVW++ S   G C+HELS +GNKF++CVFHP+  SLLVIGCY++L
Sbjct  688  DPSGDFLASVSDDLVRVWSVVSSARGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETL  747

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNMTENKTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  748  ELWNMTENKTMTLHAHDKLVSSLAVSDATGLVASASHDKFVKLWK  792


 Score = 53.5 bits (127),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            Q+RFQP+ GR LAAAA+N VSILDVETQ C + L+ 
Sbjct  642  QMRFQPKAGRNLAAAADNFVSILDVETQACVRKLQG  677



>ref|XP_008802406.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
 ref|XP_008802407.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Phoenix dactylifera]
Length=807

 Score =   154 bits (388),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+DSV+VW+L SG    C+HELSSNGN+FH+C+FHP Y  LL+IG YQ+L
Sbjct  706  DANGDQLASVSQDSVKVWSLTSGE---CIHELSSNGNQFHTCIFHPRYPKLLIIGAYQTL  762

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM EN+TMT+ AHEGLIA LA S   G+VAS SHD+ +K+WK
Sbjct  763  ELWNMAENQTMTVQAHEGLIADLAQSPFTGIVASVSHDRSVKIWK  807


 Score = 54.7 bits (130),  Expect(2) = 4e-45, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+G  LAAAAENVVSI+DVET     TL+ 
Sbjct  658  TAQVRFQPRIGHLLAAAAENVVSIIDVETDMKTLTLQG  695



>ref|XP_008802409.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Phoenix dactylifera]
Length=795

 Score =   154 bits (388),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+DSV+VW+L SG    C+HELSSNGN+FH+C+FHP Y  LL+IG YQ+L
Sbjct  694  DANGDQLASVSQDSVKVWSLTSGE---CIHELSSNGNQFHTCIFHPRYPKLLIIGAYQTL  750

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM EN+TMT+ AHEGLIA LA S   G+VAS SHD+ +K+WK
Sbjct  751  ELWNMAENQTMTVQAHEGLIADLAQSPFTGIVASVSHDRSVKIWK  795


 Score = 54.7 bits (130),  Expect(2) = 5e-45, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQPR+G  LAAAAENVVSI+DVET     TL+ 
Sbjct  646  TAQVRFQPRIGHLLAAAAENVVSIIDVETDMKTLTLQG  683



>ref|XP_006420876.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 ref|XP_006420878.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 ref|XP_006420879.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 gb|ESR34116.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 gb|ESR34118.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 gb|ESR34119.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 gb|KDO61139.1| hypothetical protein CISIN_1g044075mg [Citrus sinensis]
Length=786

 Score =   155 bits (393),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+DSVRVW+L SG    C+HELSS+GNKFHSC+FHPSY +L+VIG YQSL
Sbjct  685  DTNGEYLASVSQDSVRVWSLASGE---CIHELSSSGNKFHSCIFHPSYPTLMVIGGYQSL  741

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT+ AH+ +I++LA S V G+VASASHDK +K+WK
Sbjct  742  ELWNMAENKCMTIAAHDCVISALAQSPVTGMVASASHDKSVKIWK  786


 Score = 52.8 bits (125),  Expect(2) = 5e-45, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T QVRFQPRLG  LAAA+ENVVSI DVET     + K 
Sbjct  637  TVQVRFQPRLGLLLAAASENVVSIFDVETDRLTHSFKG  674



>ref|XP_006420877.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 gb|ESR34117.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
Length=779

 Score =   155 bits (393),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+DSVRVW+L SG    C+HELSS+GNKFHSC+FHPSY +L+VIG YQSL
Sbjct  678  DTNGEYLASVSQDSVRVWSLASGE---CIHELSSSGNKFHSCIFHPSYPTLMVIGGYQSL  734

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT+ AH+ +I++LA S V G+VASASHDK +K+WK
Sbjct  735  ELWNMAENKCMTIAAHDCVISALAQSPVTGMVASASHDKSVKIWK  779


 Score = 52.8 bits (125),  Expect(2) = 5e-45, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T QVRFQPRLG  LAAA+ENVVSI DVET     + K 
Sbjct  630  TVQVRFQPRLGLLLAAASENVVSIFDVETDRLTHSFKG  667



>ref|XP_010934267.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Elaeis guineensis]
Length=799

 Score =   153 bits (387),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+HLASVS+DSV+VW+L SG    C+HELSSNGN+FHSC+FHP Y  LLVIG YQ+L
Sbjct  698  DANGDHLASVSQDSVKVWSLTSGE---CIHELSSNGNQFHSCIFHPRYPKLLVIGGYQTL  754

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM EN+++ + AH+GLIA+LA S   GLVASASHDK +K+WK
Sbjct  755  ELWNMAENQSIPVLAHDGLIAALAESPFTGLVASASHDKSVKIWK  799


 Score = 54.7 bits (130),  Expect(2) = 6e-45, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TA+VRFQPR+G  LAAAAENVVSI+DVET    +TL+ 
Sbjct  650  TARVRFQPRIGHLLAAAAENVVSIIDVETDMKTRTLQG  687



>ref|XP_010934265.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Elaeis guineensis]
 ref|XP_010934266.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Elaeis guineensis]
Length=801

 Score =   153 bits (387),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 86/105 (82%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+HLASVS+DSV+VW+L SG    C+HELSSNGN+FHSC+FHP Y  LLVIG YQ+L
Sbjct  700  DANGDHLASVSQDSVKVWSLTSGE---CIHELSSNGNQFHSCIFHPRYPKLLVIGGYQTL  756

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM EN+++ + AH+GLIA+LA S   GLVASASHDK +K+WK
Sbjct  757  ELWNMAENQSIPVLAHDGLIAALAESPFTGLVASASHDKSVKIWK  801


 Score = 54.7 bits (130),  Expect(2) = 6e-45, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TA+VRFQPR+G  LAAAAENVVSI+DVET    +TL+ 
Sbjct  652  TARVRFQPRIGHLLAAAAENVVSIIDVETDMKTRTLQG  689



>ref|XP_006420880.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
 gb|ESR34120.1| hypothetical protein CICLE_v10004358mg [Citrus clementina]
Length=552

 Score =   154 bits (390),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+DSVRVW+L SG    C+HELSS+GNKFHSC+FHPSY +L+VIG YQSL
Sbjct  451  DTNGEYLASVSQDSVRVWSLASGE---CIHELSSSGNKFHSCIFHPSYPTLMVIGGYQSL  507

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT+ AH+ +I++LA S V G+VASASHDK +K+WK
Sbjct  508  ELWNMAENKCMTIAAHDCVISALAQSPVTGMVASASHDKSVKIWK  552


 Score = 52.8 bits (125),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T QVRFQPRLG  LAAA+ENVVSI DVET     + K 
Sbjct  403  TVQVRFQPRLGLLLAAASENVVSIFDVETDRLTHSFKG  440



>ref|XP_006493701.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Citrus sinensis]
 ref|XP_006493702.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Citrus sinensis]
 ref|XP_006493703.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X3 
[Citrus sinensis]
Length=786

 Score =   154 bits (390),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 88/105 (84%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+DSVRVW+L +G    C+HELSS+GNKFHSC+FHPSY +L+VIG YQSL
Sbjct  685  DTNGEYLASVSQDSVRVWSLATGE---CIHELSSSGNKFHSCIFHPSYPTLMVIGGYQSL  741

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT+ AH+ +I++LA S V G+VASASHDK +K+WK
Sbjct  742  ELWNMAENKCMTIAAHDCVISALAQSPVTGMVASASHDKSVKIWK  786


 Score = 52.8 bits (125),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T QVRFQPRLG  LAAA+ENVVSI DVET     + K 
Sbjct  637  TVQVRFQPRLGLLLAAASENVVSIFDVETDRLTHSFKG  674



>ref|XP_008242693.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Prunus mume]
Length=869

 Score =   156 bits (394),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+D VRVW++GS   G C+HELS +GNKF++CVFHP+  SLLVIGCY++L
Sbjct  765  DPSGDFLASVSDDLVRVWSVGSSVRGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETL  824

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  825  ELWNMNENKTMTLHAHDKLVSSLAVSDATGLVASASHDKCVKLWK  869


 Score = 51.2 bits (121),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            ++RFQP  GR LAAAA+N VSILDVETQ C + L+ 
Sbjct  719  KMRFQPNAGRNLAAAADNYVSILDVETQACMRKLQG  754



>ref|XP_006493704.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X4 
[Citrus sinensis]
Length=779

 Score =   154 bits (390),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 88/105 (84%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+DSVRVW+L +G    C+HELSS+GNKFHSC+FHPSY +L+VIG YQSL
Sbjct  678  DTNGEYLASVSQDSVRVWSLATGE---CIHELSSSGNKFHSCIFHPSYPTLMVIGGYQSL  734

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT+ AH+ +I++LA S V G+VASASHDK +K+WK
Sbjct  735  ELWNMAENKCMTIAAHDCVISALAQSPVTGMVASASHDKSVKIWK  779


 Score = 52.8 bits (125),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            T QVRFQPRLG  LAAA+ENVVSI DVET     + K 
Sbjct  630  TVQVRFQPRLGLLLAAASENVVSIFDVETDRLTHSFKG  667



>ref|XP_008242692.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X1 
[Prunus mume]
Length=874

 Score =   156 bits (394),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  G+ LASVS+D VRVW++GS   G C+HELS +GNKF++CVFHP+  SLLVIGCY++L
Sbjct  770  DPSGDFLASVSDDLVRVWSVGSSVRGECIHELSCSGNKFNTCVFHPTCPSLLVIGCYETL  829

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENKTMTL AH+ L++SLAVS   GLVASASHDK +KLWK
Sbjct  830  ELWNMNENKTMTLHAHDKLVSSLAVSDATGLVASASHDKCVKLWK  874


 Score = 51.2 bits (121),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  8    QVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            ++RFQP  GR LAAAA+N VSILDVETQ C + L+ 
Sbjct  724  KMRFQPNAGRNLAAAADNYVSILDVETQACMRKLQG  759



>gb|EEC74226.1| hypothetical protein OsI_09411 [Oryza sativa Indica Group]
Length=802

 Score =   155 bits (392),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GEHLASVS+D V+VW++ SG    C+HE+SSNGNKFHSCVFHPSY++LLVIG YQSL
Sbjct  701  DSSGEHLASVSQDLVKVWSISSGE---CIHEVSSNGNKFHSCVFHPSYANLLVIGGYQSL  757

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWN+ +N++MT+ AHEGLIA+LA S V G+VASASHD  +KLWK
Sbjct  758  ELWNIVKNQSMTIQAHEGLIAALAQSPVNGMVASASHDNSVKLWK  802


 Score = 51.6 bits (122),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQP  G++LAAAAE +V+I DVET + + TL+ 
Sbjct  653  TAQVRFQPNTGQFLAAAAETMVAIFDVETHSKKYTLQG  690



>ref|XP_006385922.1| hypothetical protein POPTR_0003s17700g [Populus trichocarpa]
 ref|XP_002303828.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|ERP63719.1| hypothetical protein POPTR_0003s17700g [Populus trichocarpa]
 gb|EEE78807.2| WD-40 repeat family protein [Populus trichocarpa]
Length=785

 Score =   155 bits (391),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            DV G++LASVS++SVRVW+L +G    C+HELSS+GNKFHSCVFHPSYS+LLVIG YQSL
Sbjct  684  DVNGDYLASVSQESVRVWSLATGE---CIHELSSSGNKFHSCVFHPSYSTLLVIGGYQSL  740

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            ELWNM ENK MT+ AHE +I++LA S   G+VASASHDK +K+WK
Sbjct  741  ELWNMAENKCMTVAAHECVISALAQSQATGMVASASHDKCVKIWK  785


 Score = 52.0 bits (123),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 2/35 (6%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQT  106
            T QVRFQPR+G+ LAAAAENVVSI DVE    RQT
Sbjct  636  TTQVRFQPRIGQLLAAAAENVVSIFDVEAD--RQT  668



>ref|XP_002454764.1| hypothetical protein SORBIDRAFT_04g036910 [Sorghum bicolor]
 gb|EES07740.1| hypothetical protein SORBIDRAFT_04g036910 [Sorghum bicolor]
Length=803

 Score =   152 bits (385),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE++ASVS+D V+VW++ SG    C+HELSSNGNKFHSCVFHPSYS+LLVIG YQSL
Sbjct  702  DNNGEYIASVSQDLVKVWSISSGE---CIHELSSNGNKFHSCVFHPSYSNLLVIGGYQSL  758

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            E+WNM +N+++T+ AHEGLIA+LA S V G+VASASHD  +K+WK
Sbjct  759  EVWNMVKNQSLTVQAHEGLIAALAQSPVTGMVASASHDNSVKVWK  803


 Score = 54.3 bits (129),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            +AQVRFQP +G++LAAAAENVVSI D+ET   + TL+ 
Sbjct  654  SAQVRFQPHVGQFLAAAAENVVSIFDIETHGKKYTLQG  691



>ref|XP_004954333.1| PREDICTED: transcriptional corepressor LEUNIG-like isoform X2 
[Setaria italica]
Length=796

 Score =   153 bits (387),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 89/105 (85%), Gaps = 3/105 (3%)
 Frame = +1

Query  103  DVKGEHLASVSEDSVRVWTLGSGNEGNCVHELSSNGNKFHSCVFHPSYSSLLVIGCYQSL  282
            D  GE+LASVS+D V+VW++ SG    C+HELSSNGNKFHSCVFHPSY+SLLVIG YQSL
Sbjct  695  DNSGEYLASVSQDLVKVWSISSGE---CIHELSSNGNKFHSCVFHPSYTSLLVIGGYQSL  751

Query  283  ELWNMTENKTMTLPAHEGLIASLAVSTVAGLVASASHDKIIKLWK  417
            E+WNM +N+++T+ AHEGLIA+LA S V G+VASASHD  +K+WK
Sbjct  752  EVWNMVKNQSLTVQAHEGLIAALAQSPVTGMVASASHDNSVKVWK  796


 Score = 53.5 bits (127),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    TAQVRFQPRLGRYLAAAAENVVSILDVETQTCRQTLKA  115
            TAQVRFQP  G++LAAAAEN+VSI D+ET   + TL+ 
Sbjct  647  TAQVRFQPNAGQFLAAAAENMVSIFDIETHGKKYTLQG  684



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090