BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS137E06

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764791.1|  PREDICTED: uncharacterized protein LOC104216...    195   3e-53   Nicotiana sylvestris
ref|XP_009764792.1|  PREDICTED: uncharacterized protein LOC104216...    195   3e-53   Nicotiana sylvestris
ref|XP_009764793.1|  PREDICTED: uncharacterized protein LOC104216...    194   3e-53   Nicotiana sylvestris
ref|XP_011097014.1|  PREDICTED: uncharacterized protein LOC105176035    192   3e-52   
gb|EYU33022.1|  hypothetical protein MIMGU_mgv1a000375mg                191   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_009616231.1|  PREDICTED: uncharacterized protein LOC104108...    190   1e-51   Nicotiana tomentosiformis
ref|XP_009616230.1|  PREDICTED: uncharacterized protein LOC104108...    190   1e-51   Nicotiana tomentosiformis
ref|XP_009616232.1|  PREDICTED: uncharacterized protein LOC104108...    190   1e-51   Nicotiana tomentosiformis
ref|XP_003532497.1|  PREDICTED: uncharacterized protein LOC100818...    188   6e-51   Glycine max [soybeans]
ref|XP_010318604.1|  PREDICTED: uncharacterized protein LOC101262...    186   2e-50   Solanum lycopersicum
ref|XP_010318603.1|  PREDICTED: uncharacterized protein LOC101262...    186   3e-50   Solanum lycopersicum
ref|XP_006341624.1|  PREDICTED: uncharacterized protein LOC102599875    186   3e-50   Solanum tuberosum [potatoes]
ref|XP_003634188.1|  PREDICTED: uncharacterized protein LOC100254...    184   1e-49   Vitis vinifera
emb|CBI15432.3|  unnamed protein product                                184   2e-49   Vitis vinifera
ref|XP_004512863.1|  PREDICTED: uncharacterized protein LOC101507...    183   3e-49   Cicer arietinum [garbanzo]
ref|XP_004512862.1|  PREDICTED: uncharacterized protein LOC101507...    183   3e-49   Cicer arietinum [garbanzo]
ref|XP_007036482.1|  Stomatal cytokinesis defective / SCD1 protei...    182   5e-49   
ref|XP_011011805.1|  PREDICTED: uncharacterized protein LOC105116...    182   5e-49   Populus euphratica
ref|XP_011011807.1|  PREDICTED: uncharacterized protein LOC105116...    182   5e-49   Populus euphratica
ref|XP_011011804.1|  PREDICTED: uncharacterized protein LOC105116...    182   5e-49   Populus euphratica
ref|XP_007036483.1|  Stomatal cytokinesis defective / SCD1 protei...    182   7e-49   
ref|XP_002322040.1|  STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein    182   9e-49   
emb|CAN64735.1|  hypothetical protein VITISV_022618                     174   1e-48   Vitis vinifera
ref|XP_010943385.1|  PREDICTED: uncharacterized protein LOC105061...    181   2e-48   
ref|XP_010943311.1|  PREDICTED: uncharacterized protein LOC105061...    181   2e-48   Elaeis guineensis
gb|AIG51125.1|  stomatal cytokinesis defective 1                        180   4e-48   Gossypium hirsutum [American cotton]
ref|XP_010265189.1|  PREDICTED: uncharacterized protein LOC104602...    179   8e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010265188.1|  PREDICTED: uncharacterized protein LOC104602...    179   8e-48   Nelumbo nucifera [Indian lotus]
gb|KJB37239.1|  hypothetical protein B456_006G195200                    178   2e-47   Gossypium raimondii
gb|KJB37240.1|  hypothetical protein B456_006G195200                    178   2e-47   Gossypium raimondii
gb|KJB37237.1|  hypothetical protein B456_006G195200                    178   2e-47   Gossypium raimondii
gb|KJB37238.1|  hypothetical protein B456_006G195200                    178   2e-47   Gossypium raimondii
gb|AGG55718.1|  stomatal cytokinesis defective 1                        177   3e-47   Gossypium arboreum [tree cotton]
gb|KJB37236.1|  hypothetical protein B456_006G195200                    176   4e-47   Gossypium raimondii
gb|EPS64327.1|  hypothetical protein M569_10454                         176   4e-47   Genlisea aurea
emb|CDO98446.1|  unnamed protein product                                177   5e-47   Coffea canephora [robusta coffee]
ref|XP_010094783.1|  hypothetical protein L484_019994                   172   6e-47   
gb|KDP20097.1|  hypothetical protein JCGZ_05866                         176   1e-46   Jatropha curcas
ref|XP_008457689.1|  PREDICTED: uncharacterized protein LOC103497299    176   1e-46   Cucumis melo [Oriental melon]
gb|KEH21369.1|  stomatal cytokinesis defective protein, putative        176   2e-46   Medicago truncatula
ref|XP_002511967.1|  F-box and wd40 domain protein, putative            174   4e-46   
gb|KGN64112.1|  hypothetical protein Csa_1G042240                       174   4e-46   Cucumis sativus [cucumbers]
ref|XP_004137469.1|  PREDICTED: uncharacterized protein LOC101212131    174   4e-46   
ref|XP_006485772.1|  PREDICTED: uncharacterized protein LOC102621...    174   4e-46   Citrus sinensis [apfelsine]
ref|XP_006440944.1|  hypothetical protein CICLE_v10018557mg             174   5e-46   Citrus clementina [clementine]
ref|XP_008797770.1|  PREDICTED: uncharacterized protein LOC103712...    174   6e-46   
ref|XP_008797769.1|  PREDICTED: uncharacterized protein LOC103712...    174   6e-46   Phoenix dactylifera
ref|XP_007160364.1|  hypothetical protein PHAVU_002G3153000g            171   8e-46   Phaseolus vulgaris [French bean]
ref|XP_011009995.1|  PREDICTED: uncharacterized protein LOC105114...    173   1e-45   Populus euphratica
ref|XP_011072936.1|  PREDICTED: uncharacterized protein LOC105158031    173   1e-45   Sesamum indicum [beniseed]
ref|XP_009383583.1|  PREDICTED: uncharacterized protein LOC103971285    173   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011465682.1|  PREDICTED: DENN domain and WD repeat-contain...    172   3e-45   Fragaria vesca subsp. vesca
ref|XP_010549132.1|  PREDICTED: uncharacterized protein LOC104820400    169   3e-44   Tarenaya hassleriana [spider flower]
gb|KDO41981.1|  hypothetical protein CISIN_1g0010392mg                  164   1e-43   Citrus sinensis [apfelsine]
ref|XP_009337275.1|  PREDICTED: myotubularin-related protein 13-like    167   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_009337189.1|  PREDICTED: myotubularin-related protein 13-like    167   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_010031872.1|  PREDICTED: uncharacterized protein LOC104421573    166   4e-43   Eucalyptus grandis [rose gum]
ref|XP_002317936.2|  STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein    166   5e-43   
ref|XP_008244008.1|  PREDICTED: uncharacterized protein LOC103342...    166   5e-43   Prunus mume [ume]
ref|XP_008244009.1|  PREDICTED: uncharacterized protein LOC103342...    165   6e-43   Prunus mume [ume]
ref|XP_007210443.1|  hypothetical protein PRUPE_ppa000437m1g            164   1e-42   
ref|XP_009346964.1|  PREDICTED: LOW QUALITY PROTEIN: myotubularin...    164   2e-42   
ref|XP_008393296.1|  PREDICTED: uncharacterized protein LOC103455486    164   2e-42   
ref|XP_010677974.1|  PREDICTED: uncharacterized protein LOC104893555    162   9e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE54850.1|  hypothetical protein OsJ_02315                          160   5e-41   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043390.1|  Os01g0575500                                       160   5e-41   
ref|XP_010479332.1|  PREDICTED: myotubularin-related protein 13-like    159   9e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006837773.1|  hypothetical protein AMTR_s00104p00054580          159   1e-40   
ref|XP_002894154.1|  stomatal cytokinesis-defective 1                   159   1e-40   
ref|XP_010461711.1|  PREDICTED: myotubularin-related protein 13-l...    159   1e-40   
ref|XP_010500445.1|  PREDICTED: myotubularin-related protein 13-like    159   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008672456.1|  PREDICTED: uncharacterized protein LOC100273...    157   3e-40   Zea mays [maize]
ref|XP_008672455.1|  PREDICTED: uncharacterized protein LOC100273...    157   3e-40   
ref|NP_850959.1|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1              157   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185177.1|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1           157   4e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010231941.1|  PREDICTED: uncharacterized protein LOC100845189    157   4e-40   Brachypodium distachyon [annual false brome]
ref|NP_175333.3|  protein STOMATAL CYTOKINESIS-DEFECTIVE 1              156   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393316.1|  hypothetical protein EUTSA_v10011186mg             156   1e-39   
ref|XP_006306610.1|  hypothetical protein CARUB_v10008124mg             155   2e-39   Capsella rubella
emb|CDY48854.1|  BnaA06g03280D                                          144   2e-39   Brassica napus [oilseed rape]
ref|XP_004969033.1|  PREDICTED: uncharacterized protein LOC101781233    155   2e-39   Setaria italica
emb|CDY48589.1|  BnaCnng16480D                                          154   4e-39   Brassica napus [oilseed rape]
ref|XP_009147917.1|  PREDICTED: myotubularin-related protein 13 i...    154   6e-39   Brassica rapa
emb|CDM83276.1|  unnamed protein product                                154   6e-39   Triticum aestivum [Canadian hard winter wheat]
gb|EMT33100.1|  hypothetical protein F775_01878                         144   9e-39   
gb|KFK36043.1|  hypothetical protein AALP_AA4G070500                    153   1e-38   Arabis alpina [alpine rockcress]
ref|XP_009147918.1|  PREDICTED: DENN domain-containing protein 4B...    152   1e-38   Brassica rapa
tpg|DAA58649.1|  TPA: hypothetical protein ZEAMMB73_444537              149   3e-38   
ref|XP_008349874.1|  PREDICTED: uncharacterized protein LOC103413159    138   9e-38   
ref|XP_006646026.1|  PREDICTED: uncharacterized protein LOC102710652    145   7e-36   
gb|EEC70939.1|  hypothetical protein OsI_02530                          141   2e-34   Oryza sativa Indica Group [Indian rice]
gb|AAF69702.1|AC016041_7  F27J15.16                                     137   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002989051.1|  hypothetical protein SELMODRAFT_129087             135   2e-32   
ref|XP_010677976.1|  PREDICTED: uncharacterized protein LOC104893...    134   4e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677977.1|  PREDICTED: myotubularin-related protein 13-l...    134   4e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677975.1|  PREDICTED: uncharacterized protein LOC104893...    134   4e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002983722.1|  hypothetical protein SELMODRAFT_118822             134   5e-32   
ref|XP_008351915.1|  PREDICTED: uncharacterized protein LOC103415353    104   6e-25   
ref|XP_008356651.1|  PREDICTED: uncharacterized protein LOC103420...    105   1e-24   
ref|XP_008356653.1|  PREDICTED: uncharacterized protein LOC103420...    103   1e-24   
ref|XP_001752748.1|  predicted protein                                  110   6e-24   
gb|EMS55158.1|  hypothetical protein TRIUR3_14216                       102   2e-22   Triticum urartu
ref|XP_011470710.1|  PREDICTED: DENN domain and WD repeat-contain...  86.7    2e-16   Fragaria vesca subsp. vesca
emb|CDX98751.1|  BnaA03g45360D                                        71.6    8e-12   
gb|KIY96716.1|  hypothetical protein MNEG_11246                       67.4    4e-10   Monoraphidium neglectum
ref|XP_002507362.1|  predicted protein                                53.9    4e-05   Micromonas commoda
emb|CDY72592.1|  BnaAnng41570D                                        52.0    8e-05   Brassica napus [oilseed rape]



>ref|XP_009764791.1| PREDICTED: uncharacterized protein LOC104216452 isoform X1 [Nicotiana 
sylvestris]
Length=1215

 Score =   195 bits (495),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 102/115 (89%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_009764792.1| PREDICTED: uncharacterized protein LOC104216452 isoform X2 [Nicotiana 
sylvestris]
Length=1213

 Score =   195 bits (495),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 102/115 (89%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_009764793.1| PREDICTED: uncharacterized protein LOC104216452 isoform X3 [Nicotiana 
sylvestris]
Length=1205

 Score =   194 bits (494),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 102/115 (89%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G+MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGVMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSNDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_011097014.1| PREDICTED: uncharacterized protein LOC105176035 [Sesamum indicum]
Length=1205

 Score =   192 bits (488),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 101/115 (88%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G RGY+GTGIMYL SLLDQYP  NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGTGIMYLPSLLDQYPSSNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV+FY SGFDS++PS+FP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVQFYASGFDSSDPSSFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>gb|EYU33022.1| hypothetical protein MIMGU_mgv1a000375mg [Erythranthe guttata]
Length=1207

 Score =   191 bits (486),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 100/115 (87%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G RG++GTGIMYL+SLLDQYP LNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGFHGTGIMYLSSLLDQYPSLNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV+FY SGFDS +PS+FP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVQFYASGFDSTDPSSFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_009616231.1| PREDICTED: uncharacterized protein LOC104108811 isoform X2 [Nicotiana 
tomentosiformis]
Length=1213

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_009616230.1| PREDICTED: uncharacterized protein LOC104108811 isoform X1 [Nicotiana 
tomentosiformis]
Length=1215

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_009616232.1| PREDICTED: uncharacterized protein LOC104108811 isoform X3 [Nicotiana 
tomentosiformis]
Length=1205

 Score =   190 bits (482),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G RGY+G+G MYL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNRGYHGSGTMYLPSLLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDS +PSTFP+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSYDPSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_003532497.1| PREDICTED: uncharacterized protein LOC100818305 isoform X1 [Glycine 
max]
 gb|KHN16584.1| DENN domain-containing protein 5B [Glycine soja]
Length=1208

 Score =   188 bits (477),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M+ IFEYFVVCGIGPEIRT++G +GY+GTG +YL SLLDQYPP NH+LYP PPPQLSTCV
Sbjct  1    MSRIFEYFVVCGIGPEIRTMDGNKGYHGTGCLYLPSLLDQYPPPNHTLYPSPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+P++FP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAY
Sbjct  61   LPAGVEFYSSGFDSNDPASFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAY  115



>ref|XP_010318604.1| PREDICTED: uncharacterized protein LOC101262196 isoform X2 [Solanum 
lycopersicum]
Length=1212

 Score =   186 bits (473),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 98/115 (85%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_010318603.1| PREDICTED: uncharacterized protein LOC101262196 isoform X1 [Solanum 
lycopersicum]
Length=1215

 Score =   186 bits (473),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 98/115 (85%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_006341624.1| PREDICTED: uncharacterized protein LOC102599875 [Solanum tuberosum]
Length=1215

 Score =   186 bits (472),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 98/115 (85%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIG EIRTL+G RGY+G G+MY+ +LLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGTEIRTLDGNRGYHGAGVMYMPALLDQYPPSNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PST P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  61   LPAGVEFYGSGFDSNDPSTLPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  115



>ref|XP_003634188.1| PREDICTED: uncharacterized protein LOC100254135 isoform X1 [Vitis 
vinifera]
Length=1215

 Score =   184 bits (468),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYL+SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLSSLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAY
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAY  115



>emb|CBI15432.3| unnamed protein product [Vitis vinifera]
Length=1254

 Score =   184 bits (467),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 97/115 (84%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYL+SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLSSLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAY
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAY  115



>ref|XP_004512863.1| PREDICTED: uncharacterized protein LOC101507359 isoform X2 [Cicer 
arietinum]
Length=1210

 Score =   183 bits (465),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M+ IFEYFVVCGIGPEIR+++G +GY GTG MY  SLLDQYPP  HSLYPPPPPQL TCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGTKGYQGTGCMYFPSLLDQYPPSTHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAY
Sbjct  61   LPAGVEFHSSGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAY  115



>ref|XP_004512862.1| PREDICTED: uncharacterized protein LOC101507359 isoform X1 [Cicer 
arietinum]
Length=1211

 Score =   183 bits (465),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M+ IFEYFVVCGIGPEIR+++G +GY GTG MY  SLLDQYPP  HSLYPPPPPQL TCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGTKGYQGTGCMYFPSLLDQYPPSTHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRDPVCEDIAEAY
Sbjct  61   LPAGVEFHSSGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDPVCEDIAEAY  115



>ref|XP_007036482.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
1 [Theobroma cacao]
 gb|EOY20983.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
1 [Theobroma cacao]
Length=1201

 Score =   182 bits (463),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 99/115 (86%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  MYL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYMYLPSLLDQYPPPNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PST+P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFYSSGFDSNDPSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_011011805.1| PREDICTED: uncharacterized protein LOC105116250 isoform X2 [Populus 
euphratica]
Length=1206

 Score =   182 bits (463),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_011011807.1| PREDICTED: uncharacterized protein LOC105116251 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   182 bits (463),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_011011804.1| PREDICTED: uncharacterized protein LOC105116250 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   182 bits (463),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M GIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MGGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFYPSGFD+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFYPSGFDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_007036483.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
2 [Theobroma cacao]
 gb|EOY20984.1| Stomatal cytokinesis defective / SCD1 protein (SCD1) isoform 
2 [Theobroma cacao]
Length=1035

 Score =   182 bits (461),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 99/115 (86%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  MYL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYMYLPSLLDQYPPPNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PST+P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFYSSGFDSNDPSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_002322040.1| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
 gb|EEF06167.1| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
Length=1197

 Score =   182 bits (461),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MAGIFEYFVVCG+GPE+RT++G +GY+G  ++YL SLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEMRTMDGNKGYHGMRVLYLPSLLDQYPPDNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFYPSG D+N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFYPSGLDANDSSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>emb|CAN64735.1| hypothetical protein VITISV_022618 [Vitis vinifera]
Length=371

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MAGIFEYFVVCG+GPE+RTL+G +G++G G+MYLASLLDQYPP NHSLYPPPPPQL TCV
Sbjct  1    MAGIFEYFVVCGLGPEVRTLDGNKGFHGMGVMYLASLLDQYPPSNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV +DIAEAY
Sbjct  61   LPAGVEFYSSGFDSNDVSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSDDIAEAY  115



>ref|XP_010943385.1| PREDICTED: uncharacterized protein LOC105061043 isoform X2 [Elaeis 
guineensis]
Length=1194

 Score =   181 bits (459),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 95/112 (85%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCGIGPEIR+L+G +G+ G G+MY+ SLLDQYPP NHSLYPPPPPQL TCVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDGNKGFQGMGVMYMPSLLDQYPPSNHSLYPPPPPQLPTCVLPA  65

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  117



>ref|XP_010943311.1| PREDICTED: uncharacterized protein LOC105061043 isoform X1 [Elaeis 
guineensis]
Length=1211

 Score =   181 bits (459),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 95/112 (85%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCGIGPEIR+L+G +G+ G G+MY+ SLLDQYPP NHSLYPPPPPQL TCVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDGNKGFQGMGVMYMPSLLDQYPPSNHSLYPPPPPQLPTCVLPA  65

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  117



>gb|AIG51125.1| stomatal cytokinesis defective 1 [Gossypium hirsutum]
Length=1135

 Score =   180 bits (456),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVE +PSGFDSN+P ++P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAY
Sbjct  61   LPAGVELFPSGFDSNDPLSYPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAY  115



>ref|XP_010265189.1| PREDICTED: uncharacterized protein LOC104602996 isoform X2 [Nelumbo 
nucifera]
Length=1195

 Score =   179 bits (454),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCGIGPEI TL+G +GY+GTG+MYL S+LDQYPP N++LYPPPPPQLSTCV
Sbjct  1    MTRIFEYFVVCGIGPEISTLDGNKGYHGTGVMYLPSVLDQYPPSNNALYPPPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SG + N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPVC+DIAEAY
Sbjct  61   LPAGVEFYSSGLNPNDASTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCDDIAEAY  115



>ref|XP_010265188.1| PREDICTED: uncharacterized protein LOC104602996 isoform X1 [Nelumbo 
nucifera]
Length=1209

 Score =   179 bits (454),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCGIGPEI TL+G +GY+GTG+MYL S+LDQYPP N++LYPPPPPQLSTCV
Sbjct  1    MTRIFEYFVVCGIGPEISTLDGNKGYHGTGVMYLPSVLDQYPPSNNALYPPPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SG + N+ STFPKSYPIVLTEGDGSKIYVSCIAFRDPVC+DIAEAY
Sbjct  61   LPAGVEFYSSGLNPNDASTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCDDIAEAY  115



>gb|KJB37239.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1191

 Score =   178 bits (452),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAY
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAY  115



>gb|KJB37240.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1199

 Score =   178 bits (452),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAY
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAY  115



>gb|KJB37237.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1197

 Score =   178 bits (452),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAY
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAY  115



>gb|KJB37238.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=1129

 Score =   178 bits (451),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAY
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAY  115



>gb|AGG55718.1| stomatal cytokinesis defective 1 [Gossypium arboreum]
Length=1181

 Score =   177 bits (450),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MTRIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVE +PSGFDSN+P ++P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAY
Sbjct  61   LPAGVELFPSGFDSNDPLSYPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAY  115



>gb|KJB37236.1| hypothetical protein B456_006G195200 [Gossypium raimondii]
Length=838

 Score =   176 bits (445),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 95/115 (83%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+GT  +YL SLLDQYPPLNH+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGTKGYHGTEYLYLPSLLDQYPPLNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVE +PSGFDSN+P + P+SYPIVLTEGDGSKIYVSCI FRDPVCEDIAEAY
Sbjct  61   LPAGVELFPSGFDSNDPLSHPRSYPIVLTEGDGSKIYVSCITFRDPVCEDIAEAY  115



>gb|EPS64327.1| hypothetical protein M569_10454 [Genlisea aurea]
Length=885

 Score =   176 bits (445),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 90/115 (78%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCGIGP+IRTL+G RGY+GT  +YL S+LDQYP  N+SLYPPPPPQL TC+
Sbjct  1    MPQIFEYFVVCGIGPDIRTLDGSRGYHGTSTVYLPSVLDQYPASNNSLYPPPPPQLPTCI  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAG++FY SG+DSN+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPVC+DI EAY
Sbjct  61   LPAGIQFYSSGYDSNDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVCQDICEAY  115



>emb|CDO98446.1| unnamed protein product [Coffea canephora]
Length=1209

 Score =   177 bits (449),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 92/112 (82%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCGIGPEIRTL+G+RGY+G+  +YL SLLDQYPP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGIGPEIRTLDGERGYHGSEFIYLPSLLDQYPPTDHTLYPPPPPQLPTCVLPA  64

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GV+F+ SGFDS +PSTFP++YPIVLTEGDGSKIYVSCIAFRDPVCEDI EAY
Sbjct  65   GVQFHASGFDSKDPSTFPRNYPIVLTEGDGSKIYVSCIAFRDPVCEDIVEAY  116



>ref|XP_010094783.1| hypothetical protein L484_019994 [Morus notabilis]
 gb|EXB56948.1| hypothetical protein L484_019994 [Morus notabilis]
Length=526

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G +G++GTGIMYL SLLDQYPPLNHSLYPPPPPQL TCV
Sbjct  1    MAPIFEYFVVCGIGPEIRTLDGNKGFHGTGIMYLPSLLDQYPPLNHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFYP GFDS++  TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFYPLGFDSSDALTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>gb|KDP20097.1| hypothetical protein JCGZ_05866 [Jatropha curcas]
Length=1205

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+GPEIRTL+G +GY+G  +MYL SLLDQYPP  H+LYPPPPPQL TCV
Sbjct  1    MARIFEYFVVCGLGPEIRTLDGNKGYHGKEVMYLPSLLDQYPPDYHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SGFD+N+ STFP+SYPIVLTEGDGSKIYVSCI+FRDPV EDIAEAY
Sbjct  61   LPAGVLFYSSGFDANDASTFPRSYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAY  115



>ref|XP_008457689.1| PREDICTED: uncharacterized protein LOC103497299 [Cucumis melo]
 ref|XP_008457770.1| PREDICTED: uncharacterized protein LOC103497299 [Cucumis melo]
Length=1209

 Score =   176 bits (445),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 92/115 (80%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S   PPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCSPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGFDS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFFSSGFDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>gb|KEH21369.1| stomatal cytokinesis defective protein, putative [Medicago truncatula]
Length=1209

 Score =   176 bits (445),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 92/115 (80%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M+ IFEYFVVCGIGPEIR+++G +GY+G G MYL SLLDQ+PP  HSLYPPPPPQLSTCV
Sbjct  1    MSRIFEYFVVCGIGPEIRSIDGNKGYHGPGWMYLPSLLDQFPPSTHSLYPPPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGFD N+PSTFP+SYPIVLTEGDGSKIYVSCI+FRD VCED+ EAY
Sbjct  61   LPAGVEFHASGFDPNDPSTFPRSYPIVLTEGDGSKIYVSCISFRDHVCEDVIEAY  115



>ref|XP_002511967.1| F-box and wd40 domain protein, putative [Ricinus communis]
 gb|EEF50636.1| F-box and wd40 domain protein, putative [Ricinus communis]
Length=1204

 Score =   174 bits (442),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 89/115 (77%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCG+G E+RTL+G +GY+G G+MYLASLLDQYPP NH   PPP     TCV
Sbjct  1    MARIFEYFVVCGLGAELRTLDGNKGYHGRGVMYLASLLDQYPPDNHHSPPPPQL--PTCV  58

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFD+N+ S+FP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  59   LPAGVEFYSSGFDANDASSFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  113



>gb|KGN64112.1| hypothetical protein Csa_1G042240 [Cucumis sativus]
Length=1209

 Score =   174 bits (442),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 92/115 (80%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S  PPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SG+DS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFFSSGYDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_004137469.1| PREDICTED: uncharacterized protein LOC101212131 [Cucumis sativus]
 ref|XP_004157419.1| PREDICTED: uncharacterized LOC101212131 [Cucumis sativus]
Length=1212

 Score =   174 bits (442),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 92/115 (80%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFEYFVVCGIGPEIRTL+G +G++G G +YL SLLDQYPP N+S  PPPPPQL TCV
Sbjct  1    MARIFEYFVVCGIGPEIRTLDGNKGFHGFGYLYLPSLLDQYPPSNNSRCPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SG+DS++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFFSSGYDSSDASTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_006485772.1| PREDICTED: uncharacterized protein LOC102621506 isoform X1 [Citrus 
sinensis]
Length=1206

 Score =   174 bits (442),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 93/115 (81%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLY PPPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYTPPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAY
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAY  115



>ref|XP_006440944.1| hypothetical protein CICLE_v10018557mg [Citrus clementina]
 gb|ESR54184.1| hypothetical protein CICLE_v10018557mg [Citrus clementina]
Length=1206

 Score =   174 bits (441),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 93/115 (81%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLYP PPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYPHPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAY
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAY  115



>ref|XP_008797770.1| PREDICTED: uncharacterized protein LOC103712861 isoform X2 [Phoenix 
dactylifera]
Length=1189

 Score =   174 bits (441),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCGIGPEIR+L+  +G+ G G+MY+ SLLDQYP  NHSLYPPPPPQL  CVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDENKGFQGMGVMYMPSLLDQYPSSNHSLYPPPPPQLPMCVLPA  65

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEA+
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAH  117



>ref|XP_008797769.1| PREDICTED: uncharacterized protein LOC103712861 isoform X1 [Phoenix 
dactylifera]
Length=1211

 Score =   174 bits (441),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCGIGPEIR+L+  +G+ G G+MY+ SLLDQYP  NHSLYPPPPPQL  CVLPA
Sbjct  6    IFEYFVVCGIGPEIRSLDENKGFQGMGVMYMPSLLDQYPSSNHSLYPPPPPQLPMCVLPA  65

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GVEFY SGFDSN+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEA+
Sbjct  66   GVEFYSSGFDSNDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAH  117



>ref|XP_007160364.1| hypothetical protein PHAVU_002G3153000g, partial [Phaseolus vulgaris]
 gb|ESW32358.1| hypothetical protein PHAVU_002G3153000g, partial [Phaseolus vulgaris]
Length=690

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M+ +FEYFVVCGIGPEIRT++G +GY+G G MYL SLLDQYPP NH+LYPPPPPQLSTCV
Sbjct  1    MSRMFEYFVVCGIGPEIRTIDGSKGYHGPGWMYLPSLLDQYPPPNHALYPPPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFY SGFDSN+PS+FP+SYPIVLTEGDGSKIYVSCI+FRD VCEDIAEAY
Sbjct  61   LPAGVEFYSSGFDSNDPSSFPRSYPIVLTEGDGSKIYVSCISFRDLVCEDIAEAY  115



>ref|XP_011009995.1| PREDICTED: uncharacterized protein LOC105114954 isoform X1 [Populus 
euphratica]
Length=1207

 Score =   173 bits (439),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 92/115 (80%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  +FEYFVVCG+GPEIRT++G +GY+G  + Y +SLLDQYPP NHSLYPPPPPQL  CV
Sbjct  1    MGRLFEYFVVCGLGPEIRTVDGNKGYHGMRVFYQSSLLDQYPPDNHSLYPPPPPQLPICV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEFYPSGFD+N+ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVEFYPSGFDANDSSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_011072936.1| PREDICTED: uncharacterized protein LOC105158031 [Sesamum indicum]
Length=1198

 Score =   173 bits (438),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCGIGPEIRTL+G RGY+GT  MYL +LLDQYP  N+SLYPPPPPQLSTCV
Sbjct  1    MPQIFEYFVVCGIGPEIRTLDGSRGYHGTDTMYLPALLDQYPHSNNSLYPPPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV+F+ SG DSN+ ++FP+SYPIVLTEGDGSKIYVSCIAFRD VCEDIAEAY
Sbjct  61   LPAGVQFHSSGCDSNDLTSFPRSYPIVLTEGDGSKIYVSCIAFRDRVCEDIAEAY  115



>ref|XP_009383583.1| PREDICTED: uncharacterized protein LOC103971285 [Musa acuminata 
subsp. malaccensis]
Length=1211

 Score =   173 bits (438),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 92/116 (79%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  277  AMAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  456
            A + IFEYFVVCGIGPEIRTLEG +G+ G  +MY+ SLLDQYPP NHSLYPPPPPQL TC
Sbjct  4    ASSRIFEYFVVCGIGPEIRTLEGNKGFQGMEVMYMPSLLDQYPPSNHSLYPPPPPQLPTC  63

Query  457  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            VLPAGVEFY SGF+S++ +T+P+SYPIVLTEGDGSKIYV+CIAFRDPVCEDI EAY
Sbjct  64   VLPAGVEFYSSGFNSDDVTTYPRSYPIVLTEGDGSKIYVACIAFRDPVCEDIIEAY  119



>ref|XP_011465682.1| PREDICTED: DENN domain and WD repeat-containing protein SCD1 
[Fragaria vesca subsp. vesca]
Length=1157

 Score =   172 bits (435),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G RG++G   MYL SLLDQ+PP NH+LYPPPPPQL TCV
Sbjct  1    MAQIFEHFVVCGIGPEIRTLDGGRGFHGFAEMYLPSLLDQFPPANHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SGFD+N+ +TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVSFYSSGFDANDATTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_010549132.1| PREDICTED: uncharacterized protein LOC104820400 [Tarenaya hassleriana]
Length=1186

 Score =   169 bits (428),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 90/115 (78%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPEIRTL+G  G++GT  +YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEIRTLDGDIGFHGTQTLYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGFDS++P++FP+SYPIVLTEGDGSKIYVSCIAFRDPV EDI EAY
Sbjct  61   LPAGVEFHSSGFDSSDPASFPRSYPIVLTEGDGSKIYVSCIAFRDPVAEDIIEAY  115



>gb|KDO41981.1| hypothetical protein CISIN_1g0010392mg, partial [Citrus sinensis]
 gb|KDO41982.1| hypothetical protein CISIN_1g0010392mg, partial [Citrus sinensis]
Length=583

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA +FEYFVVCGIGPEIRTL+G +GY+G    YL+S+LDQ+PPLNHSLY PPPPQLSTCV
Sbjct  1    MARVFEYFVVCGIGPEIRTLDGSKGYHGPEYYYLSSVLDQFPPLNHSLYTPPPPQLSTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV+FY SGFDS++PSTFP++YPIVLTEGDGSKIYVSCI+FRDPV EDIAEAY
Sbjct  61   LPAGVQFYSSGFDSDDPSTFPRTYPIVLTEGDGSKIYVSCISFRDPVSEDIAEAY  115



>ref|XP_009337275.1| PREDICTED: myotubularin-related protein 13-like [Pyrus x bretschneideri]
Length=1207

 Score =   167 bits (423),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 92/115 (80%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_009337189.1| PREDICTED: myotubularin-related protein 13-like [Pyrus x bretschneideri]
Length=1208

 Score =   167 bits (423),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 92/115 (80%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_010031872.1| PREDICTED: uncharacterized protein LOC104421573 [Eucalyptus grandis]
 gb|KCW83843.1| hypothetical protein EUGRSUZ_B00711 [Eucalyptus grandis]
Length=1213

 Score =   166 bits (419),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIRTL+  +G++GT ++Y+ S LDQ+P  +HSLYPPPPPQLSTCVLPA
Sbjct  5    IFEYFVVCGLGPEIRTLDMDKGFHGTEVLYMPSQLDQFPSSDHSLYPPPPPQLSTCVLPA  64

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GVE Y SGFD N P+TFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  65   GVEVYSSGFDPNIPATFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  116



>ref|XP_002317936.2| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
 gb|EEE96156.2| STOMATAL CYTOKINESIS-DEFECTIVE 1 family protein [Populus trichocarpa]
Length=1197

 Score =   166 bits (419),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  +FEYFVVCG+GPE+RT++  +GY+G  + Y +SLLDQYPP NHSLYPPPPPQL  CV
Sbjct  1    MGRLFEYFVVCGLGPEMRTVDRNKGYHGMRVFYQSSLLDQYPPDNHSLYPPPPPQLPICV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV+FYPSGFD+++ STFP+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVQFYPSGFDADDSSTFPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_008244008.1| PREDICTED: uncharacterized protein LOC103342183 isoform X1 [Prunus 
mume]
Length=1207

 Score =   166 bits (419),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_008244009.1| PREDICTED: uncharacterized protein LOC103342183 isoform X2 [Prunus 
mume]
Length=1193

 Score =   165 bits (418),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_007210443.1| hypothetical protein PRUPE_ppa000437m1g, partial [Prunus persica]
 gb|EMJ11642.1| hypothetical protein PRUPE_ppa000437m1g, partial [Prunus persica]
Length=1016

 Score =   164 bits (415),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+ VVCGIGPEIRTL+G +G++G G  Y+ SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHLVVCGIGPEIRTLDGSKGFHGFGTYYMPSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SG+DSN+ ST P+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY
Sbjct  61   LPAGVLFYSSGYDSNDASTIPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAY  115



>ref|XP_009346964.1| PREDICTED: LOW QUALITY PROTEIN: myotubularin-related protein 
13-like [Pyrus x bretschneideri]
Length=1207

 Score =   164 bits (415),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 83/115 (72%), Positives = 91/115 (79%), Gaps = 2/115 (2%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G +G++G G  Y  SLLDQYP       PPP     TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFGTYYQTSLLDQYPXHTLYPPPPPQL--PTCV  58

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV EDIAEAY
Sbjct  59   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDIAEAY  113



>ref|XP_008393296.1| PREDICTED: uncharacterized protein LOC103455486 [Malus domestica]
Length=1208

 Score =   164 bits (415),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 91/115 (79%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGDG+KIYVSCIAFRDPV ED+AEAY
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDGTKIYVSCIAFRDPVSEDVAEAY  115



>ref|XP_010677974.1| PREDICTED: uncharacterized protein LOC104893555 [Beta vulgaris 
subsp. vulgaris]
Length=1198

 Score =   162 bits (409),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 86/116 (74%), Positives = 96/116 (83%), Gaps = 1/116 (1%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST-C  456
            MA IFEYF+VCGIGPEIRTL+G +G+ GT   YL SLLDQYPP N SL PPPPP     C
Sbjct  1    MAPIFEYFIVCGIGPEIRTLDGDKGFYGTNYRYLPSLLDQYPPSNPSLRPPPPPPQLPIC  60

Query  457  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            VLPAGVEFY SGFD N+P T+P++YPIVLTEGDGSKIYV+CIAFRDPV EDI EA+
Sbjct  61   VLPAGVEFYASGFDGNDPLTYPRTYPIVLTEGDGSKIYVTCIAFRDPVDEDIVEAH  116



>gb|EEE54850.1| hypothetical protein OsJ_02315 [Oryza sativa Japonica Group]
Length=1202

 Score =   160 bits (404),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDILEAY  116



>ref|NP_001043390.1| Os01g0575500 [Oryza sativa Japonica Group]
 dbj|BAF05304.1| Os01g0575500 [Oryza sativa Japonica Group]
Length=1248

 Score =   160 bits (404),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDILEAY  116



>ref|XP_010479332.1| PREDICTED: myotubularin-related protein 13-like [Camelina sativa]
Length=1185

 Score =   159 bits (402),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+P  + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPSTDQSPYPAPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAY  115



>ref|XP_006837773.1| hypothetical protein AMTR_s00104p00054580 [Amborella trichopoda]
 gb|ERN00342.1| hypothetical protein AMTR_s00104p00054580 [Amborella trichopoda]
Length=1221

 Score =   159 bits (402),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            +FEY VVCG+GPE+R+L+G RG+ GT +MY+ SLLDQ+P    +LYPPPPPQL TCVLPA
Sbjct  8    LFEYVVVCGLGPELRSLDGTRGFQGTNVMYMPSLLDQFPSSKDALYPPPPPQLPTCVLPA  67

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GVEFY SG +  + ST P+SYPIVLTEGDGSKIYVSCIAFRDPV EDIAEAY
Sbjct  68   GVEFYSSGLNPIDVSTHPRSYPIVLTEGDGSKIYVSCIAFRDPVSEDIAEAY  119



>ref|XP_002894154.1| stomatal cytokinesis-defective 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70413.1| stomatal cytokinesis-defective 1 [Arabidopsis lyrata subsp. lyrata]
Length=1187

 Score =   159 bits (401),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPEIRT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEIRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAY  115



>ref|XP_010461711.1| PREDICTED: myotubularin-related protein 13-like isoform X1 [Camelina 
sativa]
 ref|XP_010461712.1| PREDICTED: myotubularin-related protein 13-like isoform X2 [Camelina 
sativa]
 ref|XP_010461713.1| PREDICTED: myotubularin-related protein 13-like isoform X3 [Camelina 
sativa]
Length=1185

 Score =   159 bits (401),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPPTDQSPYPAPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAY  115



>ref|XP_010500445.1| PREDICTED: myotubularin-related protein 13-like [Camelina sativa]
Length=1185

 Score =   159 bits (401),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RT++G  G++G    YL S LDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPSPLDQFPPTDQSPYPAPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGF SN+P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  61   LPAGVEFHSSGFASNDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAY  115



>ref|XP_008672456.1| PREDICTED: uncharacterized protein LOC100273771 isoform X2 [Zea 
mays]
Length=1185

 Score =   157 bits (398),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVLPA  66

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  67   GVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  118



>ref|XP_008672455.1| PREDICTED: uncharacterized protein LOC100273771 isoform X1 [Zea 
mays]
Length=1201

 Score =   157 bits (398),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 82/112 (73%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVLPA  66

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  67   GVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  118



>ref|NP_850959.1| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 sp|Q8RXA7.1|SCD1_ARATH RecName: Full=DENN domain and WD repeat-containing protein SCD1; 
AltName: Full=Protein STOMATAL CYTOKINESIS DEFECTIVE 1 [Arabidopsis 
thaliana]
 gb|AAL92456.1| stomatal cytokinesis defective [Arabidopsis thaliana]
 gb|AEE32385.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=1187

 Score =   157 bits (398),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAY  115



>ref|NP_001185177.1| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AEE32387.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=1040

 Score =   157 bits (397),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAY  115



>ref|XP_010231941.1| PREDICTED: uncharacterized protein LOC100845189 [Brachypodium 
distachyon]
Length=1205

 Score =   157 bits (397),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 80/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGVKGFHGADEMYMPAFIDQFPHSGHALYPPPPPQLPTCVLPA  66

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  67   GVRVYSSGLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  118



>ref|NP_175333.3| protein STOMATAL CYTOKINESIS-DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AEE32386.1| stomatal cytokinesis defective / SCD1 protein (SCD1) [Arabidopsis 
thaliana]
Length=909

 Score =   156 bits (394),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  61   LPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAY  115



>ref|XP_006393316.1| hypothetical protein EUTSA_v10011186mg [Eutrema salsugineum]
 gb|ESQ30602.1| hypothetical protein EUTSA_v10011186mg [Eutrema salsugineum]
Length=1248

 Score =   156 bits (394),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  60   MGRIFEYFVVCGLGPEMRTLDGDLGFHGLETHYLPSLLDQFPPSDHSLYPPPPPQLPTCV  119

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV F+ SGF S++P+ FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  120  LPAGVAFHSSGFVSSDPANFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDITEAY  174



>ref|XP_006306610.1| hypothetical protein CARUB_v10008124mg [Capsella rubella]
 gb|EOA39508.1| hypothetical protein CARUB_v10008124mg [Capsella rubella]
Length=1185

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RT++G  G++G    YL SLLDQ+PP + S YP PPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDPGFHGIQTFYLPSLLDQFPPTDQSPYPAPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV F+ SGF S++P++FP+SYPIVLTEGDGSKI+VSCIAFRD VCEDI EAY
Sbjct  61   LPAGVVFHSSGFVSSDPASFPRSYPIVLTEGDGSKIFVSCIAFRDRVCEDIIEAY  115



>emb|CDY48854.1| BnaA06g03280D [Brassica napus]
Length=157

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAY  115



>ref|XP_004969033.1| PREDICTED: uncharacterized protein LOC101781233 [Setaria italica]
Length=1205

 Score =   155 bits (392),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + L+Q+PP NH+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGAKGFHGVEDMYMPAFLEQFPPSNHALYPPPPPQLPTCVLPA  66

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  67   GVRIYSSGLDTDDISTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  118



>emb|CDY48589.1| BnaCnng16480D [Brassica napus]
Length=1187

 Score =   154 bits (389),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+P  +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPSSDHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAY  115



>ref|XP_009147917.1| PREDICTED: myotubularin-related protein 13 isoform X1 [Brassica 
rapa]
Length=1187

 Score =   154 bits (388),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAY  115



>emb|CDM83276.1| unnamed protein product [Triticum aestivum]
Length=1205

 Score =   154 bits (388),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TCVLPA
Sbjct  7    IFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQFPHSGHALYPPPPPQLPTCVLPA  66

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            GV  Y S  D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  67   GVRIYSSRLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  118



>gb|EMT33100.1| hypothetical protein F775_01878 [Aegilops tauschii]
Length=231

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  277  AMAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  456
            + + IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+P   H+LYPPPPPQL TC
Sbjct  3    STSRIFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQFPHSGHALYPPPPPQLPTC  62

Query  457  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            VLPAGV  Y S  D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  63   VLPAGVRIYSSRLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  118



>gb|KFK36043.1| hypothetical protein AALP_AA4G070500 [Arabis alpina]
Length=1188

 Score =   153 bits (386),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLEANYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGVEF  +GF S++P++FP+SYP+VLTEGDG+KI+VSC+AFRD VCEDI EAY
Sbjct  61   LPAGVEFRTTGFVSSDPASFPRSYPLVLTEGDGAKIFVSCVAFRDRVCEDIVEAY  115



>ref|XP_009147918.1| PREDICTED: DENN domain-containing protein 4B isoform X2 [Brassica 
rapa]
Length=880

 Score =   152 bits (384),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            M  IFEYFVVCG+GPE+RTL+G  G++G    YL SLLDQ+PP +HSLYPPPPPQL TCV
Sbjct  1    MGRIFEYFVVCGLGPEMRTLDGDLGFHGLDTNYLPSLLDQFPPSDHSLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV F+ SGF S++P +FP+SYPIVLTEGDG+KI+VSCIAFRD VCED+ EAY
Sbjct  61   LPAGVAFHSSGFVSSDPVSFPRSYPIVLTEGDGAKIFVSCIAFRDRVCEDVTEAY  115



>tpg|DAA58649.1| TPA: hypothetical protein ZEAMMB73_444537 [Zea mays]
Length=695

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +1

Query  283  AGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVL  462
            + IFEYFVVCG+GPEIR+L+G +G++G   MY+++ LDQ+PP NH+LYPPPPPQL TCVL
Sbjct  5    SRIFEYFVVCGLGPEIRSLDGIKGFHGVEEMYMSAFLDQFPPSNHALYPPPPPQLPTCVL  64

Query  463  PAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            PAGV  Y SG D+++ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  65   PAGVRIYSSGLDTDDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  118



>ref|XP_008349874.1| PREDICTED: uncharacterized protein LOC103413159 [Malus domestica]
Length=123

 Score =   138 bits (348),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGP IRT +G +G +G    Y  SLLDQYPP NH+LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPXIRTJDGAKGXHGFXTYYQTSLLDQYPPPNHTLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEA  621
            LPAGV FY SGFDSN+  TFP+SYPIVLTEGD +KIYVSCIAFR  V EDIAEA
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTEGDTTKIYVSCIAFRGTVSEDIAEA  114



>ref|XP_006646026.1| PREDICTED: uncharacterized protein LOC102710652 [Oryza brachyantha]
Length=1210

 Score =   145 bits (365),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 71/115 (62%), Positives = 83/115 (72%), Gaps = 3/115 (3%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASL---LDQYpplnhslypppppqlSTCV  459
            IFEYFVVCG+GPEIRTL+G +G++G   M L S+   L+      H L          CV
Sbjct  9    IFEYFVVCGLGPEIRTLDGVKGFHGADDMDLNSVYLWLESLYREGHYLVHHDAAVAEMCV  68

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            LPAGV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  69   LPAGVRIYSSGLDANDLSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  123



>gb|EEC70939.1| hypothetical protein OsI_02530 [Oryza sativa Indica Group]
Length=1118

 Score =   141 bits (355),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 11/123 (9%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCVLPA  468
            IFEYFVVCG+GPEIRTL+G +GY+G   MY+ + LDQ PP +H+LYPPPPPQL TCVLPA
Sbjct  5    IFEYFVVCGMGPEIRTLDGVKGYHGVDDMYMPAFLDQLPPSSHALYPPPPPQLPTCVLPA  64

Query  469  GVEFYPSGFDSNNPSTFPKSYPIVLTE-----------GDGSKIYVSCIAFRDPVCEDIA  615
            GV  Y SG D+N+ ST+P+SYPIVLT+           G   KIYVSCIAFRDP+CEDI 
Sbjct  65   GVRIYSSGLDANDFSTYPRSYPIVLTDCSLTFVLTSCRGRWLKIYVSCIAFRDPICEDIL  124

Query  616  EAY  624
            EAY
Sbjct  125  EAY  127



>gb|AAF69702.1|AC016041_7 F27J15.16 [Arabidopsis thaliana]
Length=931

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 97/139 (70%), Gaps = 24/139 (17%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST--  453
            M  IFEYFVVCG+GPE+RT++G  G++G    YL +LLDQ+PP + S YP PPPQL T  
Sbjct  1    MGRIFEYFVVCGLGPEMRTVDGDLGFHGMQTFYLPALLDQFPPTDQSPYPAPPPQLPTVK  60

Query  454  ----------------------CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKI  567
                                  CVLPAGVEF+ SGF S++P++FP+SYPIVLTEGDGSKI
Sbjct  61   FFTTSFVILVEIRILIGFRSMLCVLPAGVEFHSSGFVSSDPASFPRSYPIVLTEGDGSKI  120

Query  568  YVSCIAFRDPVCEDIAEAY  624
            +VSCIAFRD VCEDI EAY
Sbjct  121  FVSCIAFRDRVCEDIIEAY  139



>ref|XP_002989051.1| hypothetical protein SELMODRAFT_129087 [Selaginella moellendorffii]
 gb|EFJ09845.1| hypothetical protein SELMODRAFT_129087 [Selaginella moellendorffii]
Length=1180

 Score =   135 bits (340),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 70/116 (60%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNG-TGIMYLASLLDQYpplnhslypppppqlSTC  456
            MA + EYF+VCG+GPE++   G RGY+G TG+ Y  SLLDQ+PP +    PPPP     C
Sbjct  1    MAKLVEYFLVCGLGPEVQASNGARGYHGSTGVSYSPSLLDQFPPASTDRPPPPPQL-PMC  59

Query  457  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            VLP GV F+ +GF   + S++P+SYPI+LT+GDGSKIYVSC+AFRDPV EDIAEAY
Sbjct  60   VLPGGVAFHSTGFIITDESSYPRSYPIILTDGDGSKIYVSCVAFRDPVDEDIAEAY  115



>ref|XP_010677976.1| PREDICTED: uncharacterized protein LOC104893556 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1200

 Score =   134 bits (338),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 78/116 (67%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  456
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  457  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAY  116



>ref|XP_010677977.1| PREDICTED: myotubularin-related protein 13-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=1175

 Score =   134 bits (337),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 78/116 (67%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  456
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  457  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAY  116



>ref|XP_010677975.1| PREDICTED: uncharacterized protein LOC104893556 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1232

 Score =   134 bits (337),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 78/116 (67%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTL-EGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTC  456
            MA +FEYFVVCG+GPEIRTL E   GY G    Y  SL+DQYPPL HSLY P PP+L  C
Sbjct  1    MAPLFEYFVVCGLGPEIRTLYESSSGYYGIDCTYEPSLIDQYPPLGHSLYAPLPPELPMC  60

Query  457  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            V+P GVEF  SGFD+ + S++P+SYPIVLT GDGSKIYVSCIAF D V EDI +AY
Sbjct  61   VMPEGVEFCKSGFDAKDSSSYPRSYPIVLTAGDGSKIYVSCIAFWDSVDEDIGKAY  116



>ref|XP_002983722.1| hypothetical protein SELMODRAFT_118822 [Selaginella moellendorffii]
 gb|EFJ15218.1| hypothetical protein SELMODRAFT_118822 [Selaginella moellendorffii]
Length=1180

 Score =   134 bits (336),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 69/116 (59%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGT-GIMYLASLLDQYpplnhslypppppqlSTC  456
            MA + EYF+VCG+GPE++   G RGY+G+ G+ Y  SLLDQ+PP +    PPPP     C
Sbjct  1    MAKLVEYFLVCGLGPEVQASNGARGYHGSSGVSYSPSLLDQFPPASTDRPPPPPQL-PMC  59

Query  457  VLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            VLP GV F+ +GF   + S++P+SYPI+LT+GDGSKIYVSC+AFRDPV EDIAEAY
Sbjct  60   VLPGGVAFHSTGFIITDESSYPRSYPIILTDGDGSKIYVSCVAFRDPVDEDIAEAY  115



>ref|XP_008351915.1| PREDICTED: uncharacterized protein LOC103415353 [Malus domestica]
Length=108

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G +G++G    YL SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFDTYYLPSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLT  546
            LPAGV FY SGFDSN+  TFP+SYPIVLT
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLT  89



>ref|XP_008356651.1| PREDICTED: uncharacterized protein LOC103420367 isoform X1 [Malus 
domestica]
Length=131

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G +G++G    Y  SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFRTYYQTSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTE  549
            LPAGV FY SGFDSN+  TFP+SYPIVLT+
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLTD  90



>ref|XP_008356653.1| PREDICTED: uncharacterized protein LOC103420367 isoform X2 [Malus 
domestica]
Length=90

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G +G++G    Y  SLLDQYPP NH LYPPPPPQL TCV
Sbjct  1    MARIFEHFVVCGIGPEIRTLDGAKGFHGFRTYYQTSLLDQYPPPNHXLYPPPPPQLPTCV  60

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLT  546
            LPAGV FY SGFDSN+  TFP+SYPIVLT
Sbjct  61   LPAGVLFYSSGFDSNDAYTFPRSYPIVLT  89



>ref|XP_001752748.1| predicted protein [Physcomitrella patens]
 gb|EDQ82252.1| predicted protein [Physcomitrella patens]
Length=1149

 Score =   110 bits (276),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRT--LEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST  453
            M  + EYF+VCG+GP+++T  +   RGY GT   Y  +LLDQ+PP   +  P PP QL  
Sbjct  1    MGRLLEYFLVCGLGPDLQTTYIPPTRGYFGTNAYYQPALLDQFPPSELAACPDPPDQLPV  60

Query  454  CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
            CVLP GV  Y  G  S +PS+ P+SYPIVLTEGDGSKIY+SCIAFRDPV +D+A+AY
Sbjct  61   CVLPDGVRIYSQGPSSQDPSSSPRSYPIVLTEGDGSKIYLSCIAFRDPVDDDVAQAY  117



>gb|EMS55158.1| hypothetical protein TRIUR3_14216 [Triticum urartu]
Length=309

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  448  STCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRDPVCEDIAEAY  624
             +CVLPAGV  Y SG D+N+ ST+P+SYPIVLTEGDGSKIYVSCIAFRDP+CEDI EAY
Sbjct  138  KSCVLPAGVRIYSSGLDANDVSTYPRSYPIVLTEGDGSKIYVSCIAFRDPICEDIIEAY  196


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  289  IFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQY  402
            IFEYFVVCG+GPEIR L+G +G++G   MY+ + +DQ+
Sbjct  7    IFEYFVVCGLGPEIRALDGLKGFHGAEEMYMPAFIDQF  44



>ref|XP_011470710.1| PREDICTED: DENN domain and WD repeat-containing protein SCD1-like 
[Fragaria vesca subsp. vesca]
Length=440

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 56/92 (61%), Gaps = 15/92 (16%)
 Frame = +1

Query  280  MAGIFEYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlSTCV  459
            MA IFE+FVVCGIGPEIRTL+G RG++G   MYL                      +   
Sbjct  1    MAQIFEHFVVCGIGPEIRTLDGGRGFHGFAEMYLPH---------------SLSSSAASA  45

Query  460  LPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGD  555
               GV FY SGFD+N+ +TFP+SYPIVLTEG+
Sbjct  46   PHPGVSFYSSGFDANDATTFPRSYPIVLTEGE  77



>emb|CDX98751.1| BnaA03g45360D [Brassica napus]
Length=278

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 14/83 (17%)
 Frame = +1

Query  376  YLASLLDQYpplnhslypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGD  555
            YL+SLLDQ+PP +HSLYPPPPPQL TC+LPAGV F+ SGF S++P++FP+SYPI      
Sbjct  50   YLSSLLDQFPPSDHSLYPPPPPQLPTCILPAGVAFHSSGFVSSDPASFPRSYPI------  103

Query  556  GSKIYVSCIAFRDPVCEDIAEAY  624
                    IAFRD VCED+ EAY
Sbjct  104  --------IAFRDRVCEDVTEAY  118



>gb|KIY96716.1| hypothetical protein MNEG_11246 [Monoraphidium neglectum]
Length=298

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 68/118 (58%), Gaps = 6/118 (5%)
 Frame = +1

Query  244  VTDLRGFGFW*AMAGIFEYFVVCGI-GPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhs  420
            + D R  G   A   +FE+FVVCG+ G  ++T++G+ G+ GT + Y  S LD+ P  ++ 
Sbjct  7    MVDARAAG---ATLPLFEHFVVCGLSGHGLQTVQGEPGFLGTDVNYKPSFLDRLPHSDNP  63

Query  421  lypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAFRD  594
               PPP    TC LPAGV       D       P+ Y +VLTEGDG+K+Y SC+A+ D
Sbjct  64   KRQPPPQL-PTCCLPAGVNII-LKEDIAGAVLNPRMYAVVLTEGDGTKVYASCLAYYD  119



>ref|XP_002507362.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68620.1| predicted protein [Micromonas sp. RCC299]
Length=2680

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 55/124 (44%), Gaps = 23/124 (19%)
 Frame = +1

Query  295  EYFVVCGIGPEIRTLEGQRGYNGTGIMYLASLLDQYpplnhslypppppqlST-------  453
            E FVVCG+     T++G  G+ G G  Y   +L  YPP           +  T       
Sbjct  7    ECFVVCGLPASPVTVDGVAGFVGAGESYRPEVLSSYPPRARPPRGAGTNRGETDEPSTTG  66

Query  454  ---------------CVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGDGSKIYVSCIAF  588
                           C +P GV+ + +  D    +  P SYPIVLT+GDG+ +Y +C+AF
Sbjct  67   DDQGSRPPWPPHLALCAMPLGVDVHVAS-DPPRDALAPTSYPIVLTDGDGAPVYCACLAF  125

Query  589  RDPV  600
              PV
Sbjct  126  LAPV  129



>emb|CDY72592.1| BnaAnng41570D, partial [Brassica napus]
Length=235

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 49/83 (59%), Gaps = 23/83 (28%)
 Frame = +1

Query  376  YLASLLDQYpplnhslypppppqlSTCVLPAGVEFYPSGFDSNNPSTFPKSYPIVLTEGD  555
            YL SLLDQ+PP +HSLYPP PP   TCVLPAGV F+ SGF S++P               
Sbjct  28   YLPSLLDQFPPSDHSLYPPHPPHFPTCVLPAGVAFHSSGFVSSDP---------------  72

Query  556  GSKIYVSCIAFRDPVCEDIAEAY  624
                    IAFRD VCED+ EAY
Sbjct  73   --------IAFRDRVCEDVTEAY  87



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380