BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS137E03

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002957821.1|  hypothetical protein VOLCADRAFT_77684              325   8e-100   Volvox carteri f. nagariensis
ref|XP_001693686.1|  alpha-COP                                          323   4e-99    Chlamydomonas reinhardtii
gb|KCW64034.1|  hypothetical protein EUGRSUZ_G017081                    298   6e-99    Eucalyptus grandis [rose gum]
ref|XP_005851353.1|  hypothetical protein CHLNCDRAFT_137537             314   6e-99    Chlorella variabilis
gb|KDO49492.1|  hypothetical protein CISIN_1g000933mg                   314   1e-97    Citrus sinensis [apfelsine]
ref|NP_001062612.1|  Os09g0127800                                       318   2e-97    
gb|EAZ08188.1|  hypothetical protein OsI_30447                          318   2e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_005651719.1|  Coatomer, alpha subunit                            318   2e-97    Coccomyxa subellipsoidea C-169
gb|KGN61838.1|  hypothetical protein Csa_2G249920                       305   5e-97    Cucumis sativus [cucumbers]
ref|XP_002321558.1|  coatomer alpha subunit-like family protein         317   6e-97    
ref|XP_004150072.1|  PREDICTED: coatomer subunit alpha-1-like           308   6e-97    
ref|XP_011028654.1|  PREDICTED: coatomer subunit alpha-1                317   6e-97    Populus euphratica
ref|XP_011042646.1|  PREDICTED: coatomer subunit alpha-1-like iso...    317   8e-97    Populus euphratica
ref|XP_002318013.1|  coatomer alpha subunit-like family protein         317   8e-97    Populus trichocarpa [western balsam poplar]
ref|XP_011042648.1|  PREDICTED: coatomer subunit alpha-1-like iso...    316   9e-97    Populus euphratica
ref|XP_011074632.1|  PREDICTED: coatomer subunit alpha-1-like           316   9e-97    Sesamum indicum [beniseed]
gb|KDP41738.1|  hypothetical protein JCGZ_26756                         316   1e-96    Jatropha curcas
gb|KDO49489.1|  hypothetical protein CISIN_1g000933mg                   316   1e-96    Citrus sinensis [apfelsine]
emb|CDP07449.1|  unnamed protein product                                316   1e-96    Coffea canephora [robusta coffee]
ref|XP_011083895.1|  PREDICTED: coatomer subunit alpha-1-like           315   2e-96    
ref|XP_006423409.1|  hypothetical protein CICLE_v10027697mg             315   2e-96    Citrus clementina [clementine]
ref|XP_002512969.1|  coatomer alpha subunit, putative                   315   2e-96    Ricinus communis
gb|EYU32877.1|  hypothetical protein MIMGU_mgv1a000353mg                315   2e-96    Erythranthe guttata [common monkey flower]
gb|KDO49490.1|  hypothetical protein CISIN_1g000933mg                   315   2e-96    Citrus sinensis [apfelsine]
ref|XP_006487332.1|  PREDICTED: coatomer subunit alpha-2-like iso...    315   2e-96    Citrus sinensis [apfelsine]
ref|XP_008240283.1|  PREDICTED: coatomer subunit alpha-1                315   2e-96    Prunus mume [ume]
ref|XP_007017678.1|  Coatomer, alpha subunit                            315   2e-96    
gb|EYU36749.1|  hypothetical protein MIMGU_mgv1a000357mg                315   2e-96    Erythranthe guttata [common monkey flower]
ref|XP_007210424.1|  hypothetical protein PRUPE_ppa000386mg             315   2e-96    Prunus persica
ref|XP_004165124.1|  PREDICTED: coatomer subunit alpha-1-like           310   2e-96    
ref|XP_002501894.1|  coatomer protein complex                           315   3e-96    Micromonas commoda
ref|XP_008448067.1|  PREDICTED: coatomer subunit alpha-1                314   4e-96    Cucumis melo [Oriental melon]
ref|XP_008393301.1|  PREDICTED: coatomer subunit alpha-1-like           314   4e-96    
ref|XP_006341999.1|  PREDICTED: coatomer subunit alpha-1-like           314   6e-96    Solanum tuberosum [potatoes]
ref|XP_004300535.1|  PREDICTED: coatomer subunit alpha-1-like           314   6e-96    Fragaria vesca subsp. vesca
ref|XP_004238316.1|  PREDICTED: coatomer subunit alpha-1                314   7e-96    Solanum lycopersicum
ref|XP_009346991.1|  PREDICTED: coatomer subunit alpha-2-like           314   7e-96    Pyrus x bretschneideri [bai li]
ref|XP_006356758.1|  PREDICTED: coatomer subunit alpha-1-like           314   7e-96    
ref|XP_004148533.1|  PREDICTED: coatomer subunit alpha-1-like           313   8e-96    Cucumis sativus [cucumbers]
ref|XP_004243143.1|  PREDICTED: coatomer subunit alpha-1-like           313   8e-96    Solanum lycopersicum
ref|XP_008460997.1|  PREDICTED: coatomer subunit alpha-1-like           313   1e-95    Cucumis melo [Oriental melon]
emb|CDY61804.1|  BnaC03g76410D                                          299   1e-95    Brassica napus [oilseed rape]
ref|XP_008374746.1|  PREDICTED: coatomer subunit alpha-1-like           313   1e-95    Malus domestica [apple tree]
ref|XP_009794496.1|  PREDICTED: coatomer subunit alpha-1-like           313   1e-95    Nicotiana sylvestris
ref|XP_010271512.1|  PREDICTED: coatomer subunit alpha-1-like           313   1e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010690807.1|  PREDICTED: coatomer subunit alpha-1                313   2e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010263850.1|  PREDICTED: coatomer subunit alpha-1                313   2e-95    Nelumbo nucifera [Indian lotus]
ref|XP_008461000.1|  PREDICTED: coatomer subunit alpha-1-like           313   2e-95    Cucumis melo [Oriental melon]
ref|XP_009599251.1|  PREDICTED: coatomer subunit alpha-1-like           313   2e-95    Nicotiana tomentosiformis
ref|XP_010555274.1|  PREDICTED: coatomer subunit alpha-1-like           312   2e-95    Tarenaya hassleriana [spider flower]
ref|XP_009790884.1|  PREDICTED: coatomer subunit alpha-1-like           312   2e-95    Nicotiana sylvestris
ref|XP_006828935.1|  hypothetical protein AMTR_s00001p00220200          312   2e-95    Amborella trichopoda
ref|XP_009598989.1|  PREDICTED: coatomer subunit alpha-1-like           312   2e-95    Nicotiana tomentosiformis
gb|AAS58474.1|  coatomer alpha subunit                                  312   2e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011398207.1|  Coatomer subunit alpha-2                           310   3e-95    Auxenochlorella protothecoides
ref|XP_010526595.1|  PREDICTED: coatomer subunit alpha-1                312   3e-95    Tarenaya hassleriana [spider flower]
gb|KGN61837.1|  hypothetical protein Csa_2G249910                       312   3e-95    Cucumis sativus [cucumbers]
ref|XP_010919610.1|  PREDICTED: coatomer subunit alpha-1                312   3e-95    
ref|XP_010109755.1|  hypothetical protein L484_008431                   311   4e-95    Morus notabilis
ref|XP_007213296.1|  hypothetical protein PRUPE_ppa000388mg             311   4e-95    Prunus persica
ref|XP_008802787.1|  PREDICTED: coatomer subunit alpha-1                311   4e-95    Phoenix dactylifera
ref|XP_008225617.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    311   5e-95    Prunus mume [ume]
ref|XP_004293978.1|  PREDICTED: coatomer subunit alpha-1-like           311   6e-95    Fragaria vesca subsp. vesca
ref|XP_010933643.1|  PREDICTED: coatomer subunit alpha-1-like           311   6e-95    
ref|XP_010933642.1|  PREDICTED: coatomer subunit alpha-1-like           311   7e-95    Elaeis guineensis
ref|XP_010096174.1|  Coatomer subunit alpha-1                           311   8e-95    
ref|XP_007042068.1|  Coatomer, alpha subunit                            311   8e-95    
gb|KJB77745.1|  hypothetical protein B456_012G154500                    306   9e-95    Gossypium raimondii
ref|XP_007042069.1|  Coatomer, alpha subunit                            311   9e-95    
ref|XP_004507488.1|  PREDICTED: coatomer subunit alpha-1-like iso...    310   1e-94    
ref|XP_003540979.1|  PREDICTED: coatomer subunit alpha-2-like iso...    310   1e-94    Glycine max [soybeans]
gb|KJB47565.1|  hypothetical protein B456_008G031400                    310   1e-94    Gossypium raimondii
ref|XP_004165122.1|  PREDICTED: coatomer subunit alpha-1-like           310   1e-94    
gb|KHN25415.1|  Coatomer subunit alpha-2                                310   1e-94    Glycine soja [wild soybean]
ref|XP_004150060.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    310   1e-94    
gb|KJB32566.1|  hypothetical protein B456_005G247300                    310   1e-94    Gossypium raimondii
ref|XP_003537852.1|  PREDICTED: coatomer subunit alpha-2-like           310   2e-94    Glycine max [soybeans]
gb|KHG26300.1|  hypothetical protein F383_08243                         310   2e-94    Gossypium arboreum [tree cotton]
gb|EPS65879.1|  hypothetical protein M569_08896                         310   2e-94    Genlisea aurea
gb|KHN39822.1|  Coatomer subunit alpha-1                                310   2e-94    Glycine soja [wild soybean]
ref|XP_002529504.1|  coatomer alpha subunit, putative                   310   2e-94    
gb|KJB32563.1|  hypothetical protein B456_005G247200                    310   2e-94    Gossypium raimondii
gb|KHG24640.1|  hypothetical protein F383_03247                         310   2e-94    Gossypium arboreum [tree cotton]
gb|KHG21379.1|  hypothetical protein F383_26788                         310   2e-94    Gossypium arboreum [tree cotton]
gb|KJB32565.1|  hypothetical protein B456_005G247300                    310   2e-94    Gossypium raimondii
ref|XP_007508098.1|  predicted protein                                  310   3e-94    Bathycoccus prasinos
ref|XP_009362204.1|  PREDICTED: coatomer subunit alpha-1-like           309   3e-94    Pyrus x bretschneideri [bai li]
ref|XP_008346150.1|  PREDICTED: coatomer subunit alpha-1-like           309   3e-94    
emb|CAE45585.1|  coatomer alpha subunit-like protein                    309   3e-94    Lotus japonicus
ref|XP_007131781.1|  hypothetical protein PHAVU_011G041000g             309   3e-94    Phaseolus vulgaris [French bean]
ref|XP_003057643.1|  predicted protein                                  309   3e-94    Micromonas pusilla CCMP1545
gb|KJB47562.1|  hypothetical protein B456_008G031300                    308   3e-94    Gossypium raimondii
ref|XP_008365997.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    303   4e-94    
ref|XP_009400896.1|  PREDICTED: coatomer subunit alpha-3                309   4e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006300379.1|  hypothetical protein CARUB_v10019676mg             309   4e-94    Capsella rubella
gb|KJB77746.1|  hypothetical protein B456_012G154500                    309   4e-94    Gossypium raimondii
ref|XP_003607006.1|  Coatomer alpha subunit-like protein                308   5e-94    
emb|CBI19788.3|  unnamed protein product                                307   5e-94    Vitis vinifera
ref|XP_002878550.1|  hypothetical protein ARALYDRAFT_900556             308   5e-94    
gb|KJB47564.1|  hypothetical protein B456_008G031300                    308   6e-94    Gossypium raimondii
ref|XP_010066199.1|  PREDICTED: coatomer subunit alpha-1                308   7e-94    Eucalyptus grandis [rose gum]
ref|XP_010672358.1|  PREDICTED: coatomer subunit alpha-2-like           308   7e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|KDD75879.1|  hypothetical protein H632_c457p0                        288   7e-94    Helicosporidium sp. ATCC 50920
ref|XP_002279779.1|  PREDICTED: coatomer subunit alpha-1                308   8e-94    Vitis vinifera
ref|XP_008383465.1|  PREDICTED: coatomer subunit alpha-1-like           306   8e-94    
ref|NP_176393.1|  coatomer subunit alpha-1                              308   9e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888041.1|  hypothetical protein ARALYDRAFT_475134             308   1e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_006411704.1|  hypothetical protein EUTSA_v10024240mg             308   1e-93    Eutrema salsugineum [saltwater cress]
ref|XP_009407817.1|  PREDICTED: coatomer subunit alpha-3-like           307   1e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388919.1|  PREDICTED: coatomer subunit alpha-1-like           307   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010472129.1|  PREDICTED: coatomer subunit alpha-2-like           306   2e-93    
ref|XP_010416888.1|  PREDICTED: coatomer subunit alpha-2-like           307   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010429041.1|  PREDICTED: coatomer subunit alpha-2-like           307   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010066202.1|  PREDICTED: coatomer subunit alpha-2-like           306   3e-93    Eucalyptus grandis [rose gum]
ref|XP_010429048.1|  PREDICTED: coatomer subunit alpha-2                306   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_003567287.2|  PREDICTED: coatomer subunit alpha-1-like           285   3e-93    Brachypodium distachyon [annual false brome]
ref|NP_179734.1|  coatomer subunit alpha-2                              306   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006743501.1|  PREDICTED: coatomer subunit alpha-like             301   3e-93    Leptonychotes weddellii
ref|XP_008349149.1|  PREDICTED: coatomer subunit alpha-1-like           306   3e-93    
emb|CDY53172.1|  BnaA06g40510D                                          301   4e-93    Brassica napus [oilseed rape]
emb|CDY41989.1|  BnaA01g05610D                                          301   5e-93    Brassica napus [oilseed rape]
emb|CDX90339.1|  BnaA08g16450D                                          302   6e-93    
gb|ACN31006.1|  unknown                                                 284   6e-93    Zea mays [maize]
gb|KEH43347.1|  coatomer subunit alpha-like protein                     305   7e-93    Medicago truncatula
ref|XP_006293578.1|  hypothetical protein CARUB_v10022525mg             305   8e-93    Capsella rubella
ref|XP_004496148.1|  PREDICTED: coatomer subunit alpha-1-like           305   8e-93    
ref|XP_010531460.1|  PREDICTED: coatomer subunit alpha-1-like           305   8e-93    
ref|XP_006404585.1|  hypothetical protein EUTSA_v10000016mg             305   1e-92    
tpg|DAA52914.1|  TPA: hypothetical protein ZEAMMB73_412502              283   1e-92    
gb|EWM26143.1|  Coatomer, WD associated region                          305   1e-92    Nannochloropsis gaditana
ref|XP_007144262.1|  hypothetical protein PHAVU_007G141700g             305   1e-92    Phaseolus vulgaris [French bean]
ref|XP_003536291.1|  PREDICTED: coatomer subunit alpha-1-like           305   1e-92    Glycine max [soybeans]
ref|XP_003556297.1|  PREDICTED: coatomer subunit alpha-2-like           305   1e-92    Glycine max [soybeans]
gb|KHN37868.1|  Coatomer subunit alpha-1                                305   2e-92    Glycine soja [wild soybean]
ref|XP_001771211.1|  predicted protein                                  304   2e-92    
ref|XP_010430239.1|  PREDICTED: coatomer subunit alpha-1                304   2e-92    Camelina sativa [gold-of-pleasure]
emb|CDY42637.1|  BnaC01g00490D                                          303   2e-92    Brassica napus [oilseed rape]
gb|EMS45609.1|  Coatomer subunit alpha-3                                304   2e-92    Triticum urartu
ref|XP_001753855.1|  predicted protein                                  304   3e-92    
ref|XP_009397879.1|  PREDICTED: coatomer subunit alpha-3-like           303   3e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009101857.1|  PREDICTED: coatomer subunit alpha-2-like           303   3e-92    Brassica rapa
gb|EMT27309.1|  Coatomer subunit alpha-3                                303   3e-92    
emb|CDY53168.1|  BnaA06g40470D                                          303   4e-92    Brassica napus [oilseed rape]
ref|XP_009101859.1|  PREDICTED: coatomer subunit alpha-2                303   4e-92    Brassica rapa
ref|XP_001417203.1|  predicted protein                                  303   4e-92    Ostreococcus lucimarinus CCE9901
ref|XP_009109461.1|  PREDICTED: coatomer subunit alpha-2-like           303   5e-92    Brassica rapa
ref|XP_003523472.1|  PREDICTED: coatomer subunit alpha-1-like iso...    303   6e-92    Glycine max [soybeans]
gb|KHN00939.1|  Coatomer subunit alpha-1                                303   6e-92    Glycine soja [wild soybean]
ref|XP_006411687.1|  hypothetical protein EUTSA_v10024239mg             303   6e-92    Eutrema salsugineum [saltwater cress]
ref|XP_002455000.1|  hypothetical protein SORBIDRAFT_03g002780          301   1e-91    
ref|XP_002466586.1|  hypothetical protein SORBIDRAFT_01g010390          302   1e-91    Sorghum bicolor [broomcorn]
ref|XP_004982004.1|  PREDICTED: coatomer subunit alpha-3-like           302   1e-91    Setaria italica
ref|NP_001051056.1|  Os03g0711400                                       302   1e-91    
ref|XP_002966115.1|  hypothetical protein SELMODRAFT_85610              301   1e-91    
ref|XP_002982185.1|  hypothetical protein SELMODRAFT_154977             302   1e-91    
ref|XP_001766709.1|  predicted protein                                  302   1e-91    
ref|XP_008646256.1|  PREDICTED: uncharacterized protein LOC100384...    302   1e-91    Zea mays [maize]
ref|XP_008644216.1|  PREDICTED: uncharacterized protein LOC100502...    302   1e-91    Zea mays [maize]
ref|XP_009526440.1|  hypothetical protein PHYSODRAFT_545018             301   2e-91    Phytophthora sojae
emb|CDY13820.1|  BnaA09g43220D                                          286   7e-91    Brassica napus [oilseed rape]
ref|XP_005759442.1|  COPA1, alpha subunit of the coatomer               300   1e-90    Emiliania huxleyi CCMP1516
sp|Q9AUR7.1|COPA2_ORYSJ  RecName: Full=Coatomer subunit alpha-2; ...    298   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010229358.1|  PREDICTED: coatomer subunit alpha-3                298   3e-90    Brachypodium distachyon [annual false brome]
emb|CDX82024.1|  BnaC08g35770D                                          284   3e-90    
ref|XP_006650487.1|  PREDICTED: coatomer subunit alpha-3-like           298   3e-90    Oryza brachyantha
ref|XP_003564667.1|  PREDICTED: coatomer subunit alpha-3-like           297   6e-90    Brachypodium distachyon [annual false brome]
gb|EPS70817.1|  hypothetical protein M569_03938                         296   1e-89    Genlisea aurea
ref|XP_004333061.1|  alphaCOP, putative                                 296   2e-89    Acanthamoeba castellanii str. Neff
ref|XP_002990232.1|  hypothetical protein SELMODRAFT_447957             295   2e-89    Selaginella moellendorffii
ref|XP_002961902.1|  hypothetical protein SELMODRAFT_77651              295   3e-89    Selaginella moellendorffii
emb|CDQ86226.1|  unnamed protein product                                283   4e-89    Oncorhynchus mykiss
ref|XP_009400691.1|  PREDICTED: coatomer subunit alpha-3-like           294   6e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008672096.1|  PREDICTED: uncharacterized protein LOC100192...    291   6e-88    
ref|XP_008544952.1|  PREDICTED: coatomer subunit alpha                  291   7e-88    Microplitis demolitor
emb|CBN77093.1|  Vesicle coat complex COPI, alpha subunit               291   8e-88    Ectocarpus siliculosus
dbj|BAE02266.1|  unnamed protein product                                283   8e-88    Macaca fascicularis [crab eating macaque]
ref|NP_001166192.1|  coatomer protein complex subunit alpha             290   2e-87    Bombyx mori [silk moth]
ref|XP_005710742.1|  Coatomer subunit alpha, WD40 repeat-containi...    290   3e-87    Chondrus crispus [carageen]
ref|XP_002896974.1|  coatomer protein complex, putative                 289   4e-87    Phytophthora infestans T30-4
gb|ETL92039.1|  hypothetical protein L917_09539                         289   5e-87    Phytophthora parasitica
gb|ETI45564.1|  hypothetical protein F443_09913                         289   5e-87    Phytophthora parasitica P1569
gb|ETM45336.1|  hypothetical protein L914_09580                         289   5e-87    Phytophthora parasitica
ref|XP_008892963.1|  hypothetical protein PPTG_01415                    289   5e-87    Phytophthora parasitica INRA-310
gb|ETK85490.1|  hypothetical protein L915_09709                         289   5e-87    Phytophthora parasitica
gb|ETP15371.1|  hypothetical protein F441_09860                         289   5e-87    Phytophthora parasitica CJ01A1
ref|XP_005768226.1|  COPA1, alpha subunit of the coatomer               284   6e-87    Emiliania huxleyi CCMP1516
emb|CDS11681.1|  hypothetical protein LRAMOSA03944                      288   1e-86    Lichtheimia ramosa
emb|CDH50700.1|  coatomer alpha subunit                                 288   1e-86    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_009117406.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    286   2e-86    Brassica rapa
ref|XP_002878551.1|  hypothetical protein ARALYDRAFT_900557             287   2e-86    
ref|XP_010888093.1|  PREDICTED: coatomer subunit alpha                  287   3e-86    Esox lucius
ref|XP_005704483.1|  coatomer (COPI) alpha subunit                      287   3e-86    Galdieria sulphuraria
emb|CDQ67339.1|  unnamed protein product                                287   3e-86    Oncorhynchus mykiss
ref|NP_001001941.2|  coatomer subunit alpha                             286   3e-86    Danio rerio [leopard danio]
ref|NP_001133825.1|  Coatomer subunit alpha                             287   3e-86    Salmo salar
ref|XP_007234429.1|  PREDICTED: coatomer subunit alpha-like             286   3e-86    
gb|AAI62474.1|  Copa protein                                            286   3e-86    Danio rerio [leopard danio]
gb|AAQ63170.1|  coatomer protein complex subunit alpha                  286   4e-86    Danio rerio [leopard danio]
ref|XP_008432228.1|  PREDICTED: coatomer subunit alpha                  286   4e-86    Poecilia reticulata
ref|XP_008293242.1|  PREDICTED: coatomer subunit alpha                  286   5e-86    Stegastes partitus
ref|XP_005796611.1|  PREDICTED: coatomer subunit alpha-like isofo...    286   5e-86    Xiphophorus maculatus
ref|XP_007552064.1|  PREDICTED: coatomer subunit alpha                  286   5e-86    Poecilia formosa
ref|XP_010750764.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    286   5e-86    
ref|XP_003447511.1|  PREDICTED: coatomer subunit alpha-like             286   6e-86    Oreochromis niloticus
ref|XP_004078629.1|  PREDICTED: coatomer subunit alpha                  286   6e-86    Oryzias latipes [Japanese rice fish]
gb|EPB81110.1|  coatomer protein complex, subunit alpha (xenin)         286   6e-86    Mucor circinelloides f. circinelloides 1006PhL
emb|CEF97511.1|  Coatomer, alpha subunit, C-terminal                    286   6e-86    Ostreococcus tauri
ref|XP_005796610.1|  PREDICTED: coatomer subunit alpha-like isofo...    286   6e-86    
ref|XP_003978283.1|  PREDICTED: coatomer subunit alpha-like             286   6e-86    Takifugu rubripes [tiger puffer]
ref|XP_004555248.1|  PREDICTED: coatomer subunit alpha-like             286   7e-86    Maylandia zebra
ref|XP_001743343.1|  hypothetical protein                               286   7e-86    Monosiga brevicollis MX1
ref|XP_006792415.1|  PREDICTED: coatomer subunit alpha-like             286   7e-86    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005729030.1|  PREDICTED: coatomer subunit alpha-like isofo...    286   7e-86    Pundamilia nyererei
ref|XP_005729029.1|  PREDICTED: coatomer subunit alpha-like isofo...    285   8e-86    
ref|XP_005918171.1|  PREDICTED: coatomer subunit alpha-like             285   9e-86    
ref|XP_005368658.1|  PREDICTED: coatomer subunit alpha                  285   1e-85    
ref|XP_004210494.1|  PREDICTED: coatomer subunit alpha-like             275   1e-85    
ref|XP_008152468.1|  PREDICTED: coatomer subunit alpha isoform X2       285   1e-85    Eptesicus fuscus
ref|XP_006001922.1|  PREDICTED: coatomer subunit alpha isoform X1       285   1e-85    
ref|XP_006096969.1|  PREDICTED: coatomer subunit alpha isoform X1       285   1e-85    
ref|XP_006096970.1|  PREDICTED: coatomer subunit alpha isoform X2       285   1e-85    Myotis lucifugus
ref|XP_008152467.1|  PREDICTED: coatomer subunit alpha isoform X1       285   1e-85    
ref|XP_004775909.1|  PREDICTED: coatomer subunit alpha isoform X1       285   1e-85    
ref|XP_006267538.1|  PREDICTED: coatomer subunit alpha                  285   1e-85    Alligator mississippiensis
ref|XP_004589141.1|  PREDICTED: coatomer subunit alpha isoform X2       285   1e-85    Ochotona princeps [southern American pika]
ref|XP_004671175.1|  PREDICTED: coatomer subunit alpha isoform X2       285   1e-85    Jaculus jaculus
ref|XP_006999128.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer pro...    285   1e-85    Peromyscus maniculatus bairdii
ref|XP_005400264.1|  PREDICTED: coatomer subunit alpha isoform X2       285   1e-85    Chinchilla lanigera
ref|XP_005981769.1|  PREDICTED: coatomer subunit alpha isoform X2       285   1e-85    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004775910.1|  PREDICTED: coatomer subunit alpha isoform X2       285   1e-85    Mustela putorius furo [black ferret]
ref|XP_008056902.1|  PREDICTED: coatomer subunit alpha                  285   1e-85    Carlito syrichta
ref|NP_004362.2|  coatomer subunit alpha isoform 2                      285   1e-85    Homo sapiens [man]
ref|XP_001171574.1|  PREDICTED: coatomer subunit alpha isoform X2       285   1e-85    Pan troglodytes
ref|XP_004442852.1|  PREDICTED: coatomer subunit alpha isoform 2        285   2e-85    Ceratotherium simum simum [southern square-lipped rhinoceros]
sp|Q27954.1|COPA_BOVIN  RecName: Full=Coatomer subunit alpha; Alt...    285   2e-85    Bos taurus [bovine]
ref|XP_004442851.1|  PREDICTED: coatomer subunit alpha isoform 1        285   2e-85    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003415233.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Loxodonta africana [African bush elephant]
ref|XP_010359050.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Rhinopithecus roxellana
ref|XP_007945901.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Orycteropus afer afer
ref|XP_002715282.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Oryctolagus cuniculus [domestic rabbit]
ref|NP_001099115.1|  coatomer subunit alpha                             285   2e-85    Bos taurus [bovine]
ref|XP_007129696.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    Physeter catodon
ref|XP_006001923.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Latimeria chalumnae
ref|XP_002928486.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Ailuropoda melanoleuca
ref|XP_005981768.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    Pantholops hodgsonii [Tibetan antelope]
ref|XP_008698915.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    Ursus maritimus [white bear]
ref|XP_006060555.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Bubalus bubalis [domestic water buffalo]
ref|XP_009240111.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    Pongo abelii [orang utan]
ref|XP_008518689.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Equus przewalskii [Przewalski horse]
ref|XP_007974683.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Chlorocebus sabaeus
ref|XP_007171826.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Balaenoptera acutorostrata scammoni
ref|XP_005141102.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Melopsittacus undulatus
ref|XP_004716570.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004284479.1|  PREDICTED: coatomer subunit alpha isoform 2        285   2e-85    Orcinus orca [Orca]
ref|XP_004027748.1|  PREDICTED: coatomer subunit alpha isoform 1        285   2e-85    
ref|XP_004002718.1|  PREDICTED: coatomer subunit alpha isoform 1        285   2e-85    Ovis aries [domestic sheep]
ref|XP_003892962.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Papio anubis [baboon]
ref|XP_008518688.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    Equus przewalskii [Przewalski horse]
ref|XP_006861713.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Chrysochloris asiatica
ref|XP_003213999.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Meleagris gallopavo [common turkey]
ref|XP_006895530.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004407936.1|  PREDICTED: coatomer subunit alpha isoform 2        285   2e-85    Odobenus rosmarus divergens
ref|XP_011371370.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    Pteropus vampyrus
ref|XP_004671174.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    Jaculus jaculus
ref|XP_002801923.1|  PREDICTED: coatomer subunit alpha-like             284   2e-85    
ref|XP_008982977.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    285   2e-85    
ref|XP_006174003.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Camelus ferus
ref|XP_006922956.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Pteropus alecto
dbj|BAG11074.1|  coatomer subunit alpha                                 285   2e-85    synthetic construct
ref|NP_001026576.1|  coatomer subunit alpha                             285   2e-85    Gallus gallus [bantam]
ref|NP_001091868.1|  coatomer subunit alpha isoform 1                   285   2e-85    Homo sapiens [man]
ref|XP_004448470.1|  PREDICTED: coatomer subunit alpha isoform 2        285   2e-85    Dasypus novemcinctus
ref|XP_004002719.1|  PREDICTED: coatomer subunit alpha isoform 2        285   2e-85    Ovis aries [domestic sheep]
ref|XP_001928742.1|  PREDICTED: coatomer subunit alpha isoform 2        285   2e-85    Sus scrofa [pigs]
ref|XP_005541314.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    Macaca fascicularis [crab eating macaque]
gb|AAB70879.1|  coatomer protein                                        285   2e-85    Homo sapiens [man]
ref|XP_003500327.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Cricetulus griseus [Chinese hamsters]
ref|XP_004027749.1|  PREDICTED: coatomer subunit alpha isoform 2        285   2e-85    
ref|XP_009474826.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    Nipponia nippon
ref|XP_008582921.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_001171563.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_001928732.1|  PREDICTED: coatomer subunit alpha isoform 1        285   2e-85    
ref|XP_006174002.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_010991399.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_007974682.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_004716569.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_009080612.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    
dbj|BAC31555.1|  unnamed protein product                                285   2e-85    
ref|XP_005233225.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_006060554.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_006895529.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_005400263.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_005203500.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_004284478.1|  PREDICTED: coatomer subunit alpha isoform 1        285   2e-85    
ref|XP_004901583.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_008333163.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    
gb|EHB13664.1|  Coatomer subunit alpha                                  285   2e-85    
ref|XP_004407935.1|  PREDICTED: coatomer subunit alpha isoform 1        285   2e-85    
ref|XP_005541313.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_006168890.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|NP_034068.3|  coatomer subunit alpha                                285   2e-85    
ref|XP_006861712.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_004858771.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_004901582.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_004448469.1|  PREDICTED: coatomer subunit alpha isoform 1        285   2e-85    
ref|XP_011289413.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    
ref|XP_008839027.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
gb|EAW52724.1|  coatomer protein complex, subunit alpha, isoform ...    285   2e-85    
ref|XP_007945900.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_007129697.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_010562443.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    
ref|XP_007092432.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    
ref|XP_004858772.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_004589140.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_008494291.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_004639986.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
gb|EDL39042.1|  coatomer protein complex subunit alpha, isoform C...    285   2e-85    
ref|XP_010991398.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_003466618.1|  PREDICTED: coatomer subunit alpha isoform 2        285   2e-85    
ref|XP_003466617.1|  PREDICTED: coatomer subunit alpha isoform 1        285   2e-85    
ref|XP_005233226.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_004688439.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_008494290.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_003892963.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
gb|AAI69090.1|  Copa protein                                            285   2e-85    
gb|AAH24070.1|  Coatomer protein complex subunit alpha                  285   2e-85    
ref|XP_004613819.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_010614962.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_010614964.1|  PREDICTED: coatomer subunit alpha isoform X2       285   2e-85    
ref|XP_001914764.2|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    285   2e-85    
ref|XP_010788149.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    283   2e-85    
ref|XP_005515154.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    
ref|XP_008839026.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|NP_001128012.1|  coatomer subunit alpha                             285   2e-85    
ref|XP_003937994.1|  PREDICTED: coatomer subunit alpha                  285   2e-85    
ref|XP_001369624.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_004639985.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_004613818.1|  PREDICTED: coatomer subunit alpha isoform X1       285   2e-85    
ref|XP_006168889.1|  PREDICTED: coatomer subunit alpha isoform X1       284   2e-85    
ref|XP_008582920.1|  PREDICTED: coatomer subunit alpha isoform X1       284   2e-85    
ref|XP_007441248.1|  PREDICTED: coatomer subunit alpha                  284   2e-85    
ref|XP_010282036.1|  PREDICTED: coatomer subunit alpha                  284   2e-85    
ref|XP_009887819.1|  PREDICTED: coatomer subunit alpha isoform X1       284   2e-85    
ref|XP_004688438.1|  PREDICTED: coatomer subunit alpha isoform X1       284   2e-85    
gb|KDO30127.1|  hypothetical protein SPRG_19862                         283   3e-85    
ref|NP_001121466.1|  coatomer protein complex, subunit alpha            284   3e-85    
ref|XP_005903946.1|  PREDICTED: coatomer subunit alpha isoform X2       284   3e-85    
ref|XP_005903945.1|  PREDICTED: coatomer subunit alpha isoform X1       284   4e-85    
ref|XP_008610604.1|  coatomer protein complex, subunit alpha (xenin)    283   6e-85    
ref|XP_008862869.1|  hypothetical protein H310_01524                    283   7e-85    
ref|NP_001086488.1|  coatomer protein complex, subunit alpha            283   9e-85    
gb|KFH68427.1|  coatomer protein complex, subunit alpha (xenin)         282   1e-84    
ref|XP_003487682.1|  PREDICTED: coatomer subunit alpha-like             269   1e-84    
ref|XP_005102617.1|  PREDICTED: coatomer subunit alpha-like             282   1e-84    
emb|CCA26666.1|  predicted protein putative                             282   2e-84    
ref|XP_009039838.1|  hypothetical protein AURANDRAFT_70314              282   2e-84    
gb|EIE76003.1|  hypothetical protein RO3G_00707                         281   2e-84    
emb|CEG73732.1|  Putative Coatomer, WD associated region                281   3e-84    
gb|EIE80782.1|  coatomer protein alpha subunit                          281   3e-84    
gb|ERZ98066.1|  hypothetical protein GLOINDRAFT_334453                  281   4e-84    
gb|EKD02314.1|  hypothetical protein A1Q2_03370                         281   4e-84    
emb|CEP17781.1|  hypothetical protein                                   266   4e-84    
ref|XP_010472128.1|  PREDICTED: coatomer subunit alpha-2-like           281   4e-84    
ref|XP_011172118.1|  PREDICTED: coatomer subunit alpha                  280   6e-84    
ref|XP_967472.1|  PREDICTED: coatomer subunit alpha                     280   6e-84    
ref|XP_011503846.1|  PREDICTED: coatomer subunit alpha                  280   6e-84    
ref|XP_002731289.1|  PREDICTED: coatomer subunit alpha-like             280   7e-84    
gb|EZA50399.1|  Coatomer subunit alpha                                  280   1e-83    
ref|XP_011345251.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    280   1e-83    
ref|XP_011135745.1|  PREDICTED: coatomer subunit alpha                  280   1e-83    
gb|ABM68600.1|  AAEL013098-PA                                           273   1e-83    
ref|XP_002428302.1|  coatomer alpha subunit, putative                   279   1e-83    
ref|XP_001631811.1|  predicted protein                                  279   2e-83    
ref|XP_009039560.1|  hypothetical protein AURANDRAFT_38357              279   2e-83    
emb|CCG83768.1|  protein of unknown function                            279   2e-83    
ref|XP_011269171.1|  PREDICTED: coatomer subunit alpha                  279   2e-83    
gb|KIW43031.1|  hypothetical protein PV06_04180                         278   3e-83    
ref|XP_009821126.1|  hypothetical protein H257_00241                    278   3e-83    
ref|XP_011052978.1|  PREDICTED: coatomer subunit alpha                  278   3e-83    
gb|KIV82662.1|  hypothetical protein PV11_04756                         278   3e-83    
gb|EJT53118.1|  hypothetical protein A1Q1_00125                         278   4e-83    
gb|EXX75326.1|  Cop1p                                                   277   4e-83    
gb|KIW28228.1|  hypothetical protein PV07_07907                         278   4e-83    
gb|KFM76440.1|  Coatomer subunit alpha                                  278   4e-83    
ref|XP_007171825.1|  PREDICTED: coatomer subunit alpha isoform X1       278   5e-83    
gb|EXX75325.1|  Cop1p                                                   278   5e-83    
ref|XP_007697819.1|  hypothetical protein COCSADRAFT_158414             278   5e-83    
gb|KFB45492.1|  AGAP010251-PA-like protein                              278   5e-83    
ref|XP_001861349.1|  coatomer subunit alpha                             277   6e-83    
ref|XP_009159088.1|  coatomer protein complex, subunit alpha (xenin)    277   7e-83    
ref|XP_011298436.1|  PREDICTED: coatomer subunit alpha                  277   7e-83    
ref|XP_007294624.1|  coatomer WD associated region                      277   7e-83    
ref|XP_319442.1|  AGAP010251-PA                                         277   8e-83    
ref|XP_008482797.1|  PREDICTED: coatomer subunit alpha-like             269   8e-83    
emb|CEP14680.1|  hypothetical protein                                   277   8e-83    
ref|XP_007683623.1|  hypothetical protein COCMIDRAFT_1497               277   9e-83    
ref|XP_001219598.1|  conserved hypothetical protein                     277   9e-83    
ref|XP_007708326.1|  hypothetical protein COCCADRAFT_1756               277   9e-83    
gb|EMD95016.1|  hypothetical protein COCHEDRAFT_1222255                 277   9e-83    
ref|XP_008027562.1|  hypothetical protein SETTUDRAFT_163807             277   9e-83    
ref|XP_009097457.1|  PREDICTED: coatomer subunit alpha                  277   9e-83    
gb|KIN00886.1|  hypothetical protein OIDMADRAFT_41582                   277   1e-82    
dbj|GAN02438.1|  coatomer protein complex, subunit alpha                277   1e-82    
ref|XP_001950394.1|  PREDICTED: coatomer subunit alpha                  277   1e-82    
dbj|BAK00682.1|  predicted protein                                      277   1e-82    
ref|XP_009262181.1|  hypothetical protein FPSE_10789                    276   1e-82    
ref|XP_001929805.1|  hypothetical protein                               276   1e-82    
ref|XP_011327781.1|  coatomer subunit alpha                             276   1e-82    
ref|XP_007795611.1|  putative coatomer subunit protein                  276   1e-82    
ref|XP_003665506.1|  hypothetical protein MYCTH_108501                  276   1e-82    
ref|XP_003700869.1|  PREDICTED: coatomer subunit alpha                  276   1e-82    
gb|KIW61270.1|  hypothetical protein PV05_01414                         276   1e-82    
gb|EFX83790.1|  hypothetical protein DAPPUDRAFT_301644                  276   1e-82    
gb|EYE91947.1|  putative coatomer subunit alpha                         276   1e-82    
gb|EXL92480.1|  coatomer protein complex, subunit alpha (xenin)         276   2e-82    
gb|EWZ92610.1|  coatomer protein complex, subunit alpha (xenin)         276   2e-82    
gb|EWZ47561.1|  coatomer protein complex, subunit alpha (xenin)         276   2e-82    
gb|EWG53777.1|  coatomer protein complex, subunit alpha (xenin)         276   2e-82    
gb|EGU85391.1|  hypothetical protein FOXB_04102                         276   2e-82    
gb|EXM21197.1|  coatomer protein complex, subunit alpha (xenin)         276   2e-82    
gb|EXK97845.1|  coatomer protein complex, subunit alpha (xenin)         276   2e-82    
emb|CCT67478.1|  probable COP1-coatomer complex alpha chain of se...    276   2e-82    
gb|ENH65076.1|  Putative coatomer subunit alpha                         276   2e-82    
ref|XP_003691465.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    276   2e-82    
ref|XP_623198.1|  PREDICTED: coatomer subunit alpha isoform 1           276   2e-82    
ref|XP_006622894.1|  PREDICTED: coatomer subunit alpha-like             276   2e-82    
gb|KEQ90028.1|  Coatomer, alpha subunit                                 276   2e-82    
gb|KIL94438.1|  hypothetical protein FAVG1_03002                        276   2e-82    
ref|XP_003040742.1|  predicted protein                                  276   2e-82    
gb|KEQ58921.1|  Coatomer, alpha subunit                                 276   2e-82    
gb|KEQ71644.1|  Coatomer, alpha subunit                                 276   2e-82    
gb|EPB85739.1|  coatomer protein complex, subunit alpha (xenin)         276   2e-82    
ref|XP_957881.1|  coatomer alpha subunit                                276   2e-82    
ref|XP_009853422.1|  hypothetical protein NEUTE1DRAFT_67419             276   2e-82    
gb|KEQ99460.1|  hypothetical protein AUEXF2481DRAFT_25363               276   3e-82    
ref|XP_007928128.1|  hypothetical protein MYCFIDRAFT_215718             276   3e-82    
ref|XP_001663309.1|  AAEL013098-PA                                      276   3e-82    
ref|XP_007676795.1|  hypothetical protein BAUCODRAFT_34527              275   3e-82    
gb|KIH62764.1|  WD domain, G-beta repeat protein                        276   3e-82    
ref|XP_009221190.1|  coatomer alpha subunit                             275   3e-82    
ref|XP_003851873.1|  hypothetical protein MYCGRDRAFT_59890              275   3e-82    
gb|KIV96927.1|  hypothetical protein PV10_00740                         275   4e-82    
ref|XP_002131264.1|  PREDICTED: coatomer subunit alpha                  275   4e-82    
ref|XP_003716408.1|  coatomer alpha subunit                             275   4e-82    
ref|XP_009059178.1|  hypothetical protein LOTGIDRAFT_218145             275   4e-82    
emb|CAL00470.1|  unnamed protein product                                275   4e-82    
gb|EHA21882.1|  hypothetical protein ASPNIDRAFT_56469                   275   4e-82    
ref|XP_001397559.2|  coatomer subunit alpha                             275   4e-82    
gb|KFA65340.1|  hypothetical protein S40285_07164                       275   4e-82    
gb|KEY64740.1|  hypothetical protein S7711_05394                        275   4e-82    
dbj|GAA84870.1|  coatomer subunit alpha                                 275   4e-82    
ref|XP_006965599.1|  vesicle coatomer complex, alpha subunit            275   4e-82    
gb|EHK39883.1|  hypothetical protein TRIATDRAFT_152772                  275   5e-82    
emb|CBK24364.2|  unnamed protein product                                275   5e-82    
gb|ENN79199.1|  hypothetical protein YQE_04383                          275   6e-82    
ref|XP_008467461.1|  PREDICTED: coatomer subunit alpha-like             275   6e-82    
tpe|CBF83542.1|  TPA: Coatomer alpha subunit [Source:UniProtKB/Tr...    275   7e-82    
ref|XP_571751.1|  coatomer alpha subunit                                275   7e-82    
gb|AAC18088.1|  coatomer alpha subunit                                  274   7e-82    
ref|XP_774130.1|  hypothetical protein CNBG4300                         275   7e-82    
ref|XP_660630.1|  hypothetical protein AN3026.2                         274   7e-82    
emb|CCF40384.1|  hypothetical protein CH063_02342                       274   7e-82    
gb|ENH83728.1|  coatomer subunit                                        274   8e-82    
gb|KDN65111.1|  putative coatomer WD associated region                  274   8e-82    
ref|XP_007599108.1|  coatomer WD associated region                      274   8e-82    
ref|XP_011125167.1|  hypothetical protein AOL_s00110g175                274   8e-82    
gb|EFQ30466.1|  coatomer WD associated region                           274   9e-82    
ref|XP_007284565.1|  coatomer subunit                                   274   9e-82    
gb|KFH68419.1|  coatomer protein complex, subunit alpha (xenin)         274   9e-82    
gb|EME42492.1|  hypothetical protein DOTSEDRAFT_73359                   274   9e-82    
ref|XP_008204705.1|  PREDICTED: coatomer subunit alpha isoform X1       274   1e-81    
gb|AFR96778.1|  coatomer protein complex, subunit alpha (xenin)         274   1e-81    
gb|KIR28169.1|  coatomer protein complex, subunit alpha (xenin)         274   1e-81    
gb|EFX00899.1|  coatamer subunit protein                                274   1e-81    
gb|KIR49465.1|  coatomer protein complex, subunit alpha (xenin)         274   1e-81    
ref|XP_004998986.1|  COP1 protein                                       274   1e-81    
gb|KIR88966.1|  coatomer protein complex, subunit alpha (xenin)         274   1e-81    
gb|KIR67884.1|  coatomer protein complex, subunit alpha (xenin)         274   1e-81    
ref|XP_003195441.1|  coatomer alpha subunit                             274   1e-81    
gb|KIR99207.1|  coatomer protein complex, subunit alpha (xenin)         274   1e-81    
gb|KIR33532.1|  coatomer protein complex, subunit alpha (xenin)         274   1e-81    
gb|KGB76228.1|  coatomer alpha subunit                                  274   1e-81    
ref|XP_002562947.1|  Pc20g03970                                         273   1e-81    
gb|EPS26788.1|  hypothetical protein PDE_01727                          273   1e-81    
emb|CDM31995.1|  Putative coatomer subunit alpha                        273   1e-81    
gb|KGO74581.1|  Coatomer alpha subunit                                  273   2e-81    
gb|KID78396.1|  Coatomer, alpha subunit                                 273   2e-81    
ref|XP_796805.3|  PREDICTED: coatomer subunit alpha-like                276   2e-81    
gb|KHN76574.1|  Coatomer subunit alpha                                  274   2e-81    
gb|EKV19219.1|  hypothetical protein PDIG_03790                         273   2e-81    
dbj|GAM85563.1|  hypothetical protein ANO11243_035700                   273   2e-81    
ref|NP_477395.1|  coat protein (coatomer) alpha, isoform A              273   2e-81    
ref|XP_001955990.1|  GF24978                                            273   2e-81    
ref|XP_002093159.1|  GE20939                                            273   2e-81    
ref|XP_001971170.1|  GG14579                                            273   2e-81    
ref|XP_002034947.1|  GM14193                                            273   2e-81    
emb|CAA09492.1|  coatomer alpha subunit                                 273   2e-81    
ref|XP_001587889.1|  conserved hypothetical protein                     273   2e-81    
ref|XP_007839261.1|  coatomer subunit alpha                             273   2e-81    
ref|XP_007005682.1|  hypothetical protein TREMEDRAFT_39829              273   2e-81    



>ref|XP_002957821.1| hypothetical protein VOLCADRAFT_77684 [Volvox carteri f. nagariensis]
 gb|EFJ41149.1| hypothetical protein VOLCADRAFT_77684 [Volvox carteri f. nagariensis]
Length=1224

 Score =   325 bits (832),  Expect = 8e-100, Method: Composition-based stats.
 Identities = 140/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIK+WNYKL RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKIWNYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCAVFHP  145


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 4/99 (4%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD ++K+W Y   +   + TL GH + +  V FH     
Sbjct  204  HDRGVNWAAFHPTLPLIVSGADDRQVKLWRYNESKAWEVDTLRGHTNNVSCVMFHARQDL  263

Query  492  IVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
            I+S S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  264  IISNSEDKSIRVWDMSKRTGVQTFRREHDRFWILAS-HP  301


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/163 (25%), Positives = 69/163 (42%), Gaps = 30/163 (18%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCAVFHPKEDLVVSASL  155

Query  384  DYKIKVWNY-------------------KLHRCLF---------TLLGHLDYIRTVQFHH  479
            D  ++VW+                    +++  LF          L GH   +    FH 
Sbjct  156  DQTVRVWDISGLRKKTVAPGGEDVLRLPQMNADLFGGGDAVVKYVLEGHDRGVNWAAFHP  215

Query  480  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFH  602
              P IVS +DD+ +++W +       +  L GH + V C  FH
Sbjct  216  TLPLIVSGADDRQVKLWRYNESKAWEVDTLRGHTNNVSCVMFH  258



>ref|XP_001693686.1| alpha-COP [Chlamydomonas reinhardtii]
 gb|EDP08940.1| alpha-COP [Chlamydomonas reinhardtii]
Length=1256

 Score =   323 bits (828),  Expect = 4e-99, Method: Composition-based stats.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPW+LASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWVLASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIK+WNYKL RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKIWNYKLRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCAMFHP  145


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 55/99 (56%), Gaps = 4/99 (4%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD ++K+W Y  ++   + TL GH + +  V FH     
Sbjct  204  HDRGVNWAAFHPTLPLIVSGADDRQVKLWRYNGNKAWEVDTLRGHTNNVSCVMFHARQDL  263

Query  492  IVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
            I+S S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  264  IISNSEDKSIRVWDMSKRTGVQTFRREHDRFWILAS-HP  301



>gb|KCW64034.1| hypothetical protein EUGRSUZ_G017081, partial [Eucalyptus grandis]
 gb|KCW64035.1| hypothetical protein EUGRSUZ_G017081, partial [Eucalyptus grandis]
Length=234

 Score =   298 bits (764),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145



>ref|XP_005851353.1| hypothetical protein CHLNCDRAFT_137537 [Chlorella variabilis]
 gb|EFN59251.1| hypothetical protein CHLNCDRAFT_137537 [Chlorella variabilis]
Length=726

 Score =   314 bits (804),  Expect = 6e-99, Method: Composition-based stats.
 Identities = 137/145 (94%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   PSQPLFVSGGDDYKIKVWNYKQRRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR CI+VLTGHNHYVMCA FHP
Sbjct  121  NWQSRNCIAVLTGHNHYVMCAQFHP  145



>gb|KDO49492.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=916

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|NP_001062612.1| Os09g0127800 [Oryza sativa Japonica Group]
 sp|Q0J3D9.1|COPA3_ORYSJ RecName: Full=Coatomer subunit alpha-3; AltName: Full=Alpha-coat 
protein 3; Short=Alpha-COP 3 [Oryza sativa Japonica Group]
 dbj|BAF24526.1| Os09g0127800 [Oryza sativa Japonica Group]
 gb|EAZ43816.1| hypothetical protein OsJ_28435 [Oryza sativa Japonica Group]
Length=1218

 Score =   318 bits (816),  Expect = 2e-97, Method: Composition-based stats.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 51/98 (52%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDI  262

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            IVS S+D++IR+W+   RT I      +      + HP
Sbjct  263  IVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHP  300



>gb|EAZ08188.1| hypothetical protein OsI_30447 [Oryza sativa Indica Group]
Length=1218

 Score =   318 bits (815),  Expect = 2e-97, Method: Composition-based stats.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 51/98 (52%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQDI  262

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            IVS S+D++IR+W+   RT I      +      + HP
Sbjct  263  IVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_005651719.1| Coatomer, alpha subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE27175.1| Coatomer, alpha subunit [Coccomyxa subellipsoidea C-169]
Length=1233

 Score =   318 bits (815),  Expect = 2e-97, Method: Composition-based stats.
 Identities = 139/145 (96%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTVQFH EYPW+VSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVQFHQEYPWVVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVM A FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMSACFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 39/163 (24%), Positives = 67/163 (41%), Gaps = 30/163 (18%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            ++ + FH + PW++++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   IRTVQFHQEYPWVVSASDDQTIRIWNWQSRTCISVLTGHNHYVMSACFHPKDDLVVSASL  155

Query  384  DYKIKVWNY-------------------KLHRCLF---------TLLGHLDYIRTVQFHH  479
            D  ++VW+                    +++  LF          L GH   +    FH 
Sbjct  156  DQTVRVWDISGLRKKTVAPGGEDMLRLPQMNSDLFGGGDAVVKYVLEGHDRGVNWAAFHP  215

Query  480  EYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFH  602
              P IVS +DD+ +++W         +  L GH + V C  FH
Sbjct  216  TLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFH  258


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 2/84 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH     
Sbjct  204  HDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDI  263

Query  492  IVSASDDQTIRIWNWQSRTCISVL  563
            IVS S+D++IR+W+   RT +   
Sbjct  264  IVSNSEDKSIRVWDMSKRTGVQTF  287



>gb|KGN61838.1| hypothetical protein Csa_2G249920 [Cucumis sativus]
Length=595

 Score =   305 bits (782),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  13   MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  72

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  73   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  132

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA+FHP
Sbjct  133  NWQSRTCISVLTGHNHYVMCAAFHP  157


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  212  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  271

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT +      +      + HP
Sbjct  272  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHP  312



>ref|XP_002321558.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
 gb|EEF05685.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
Length=1218

 Score =   317 bits (812),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_004150072.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
Length=718

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_011028654.1| PREDICTED: coatomer subunit alpha-1 [Populus euphratica]
Length=1218

 Score =   317 bits (811),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_011042646.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Populus 
euphratica]
 ref|XP_011042647.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Populus 
euphratica]
Length=1220

 Score =   317 bits (811),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_002318013.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
 gb|EEE96233.1| coatomer alpha subunit-like family protein [Populus trichocarpa]
Length=1220

 Score =   317 bits (811),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_011042648.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Populus 
euphratica]
Length=1223

 Score =   316 bits (810),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_011074632.1| PREDICTED: coatomer subunit alpha-1-like [Sesamum indicum]
Length=1218

 Score =   316 bits (810),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>gb|KDP41738.1| hypothetical protein JCGZ_26756 [Jatropha curcas]
Length=1218

 Score =   316 bits (810),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>gb|KDO49489.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=1208

 Score =   316 bits (809),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>emb|CDP07449.1| unnamed protein product [Coffea canephora]
Length=1247

 Score =   316 bits (809),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_011083895.1| PREDICTED: coatomer subunit alpha-1-like [Sesamum indicum]
Length=1199

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_006423409.1| hypothetical protein CICLE_v10027697mg [Citrus clementina]
 gb|ESR36649.1| hypothetical protein CICLE_v10027697mg [Citrus clementina]
Length=1219

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_002512969.1| coatomer alpha subunit, putative [Ricinus communis]
 gb|EEF49472.1| coatomer alpha subunit, putative [Ricinus communis]
Length=1217

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>gb|EYU32877.1| hypothetical protein MIMGU_mgv1a000353mg [Erythranthe guttata]
Length=1225

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/145 (100%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILSAHP  300



>gb|KDO49490.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
 gb|KDO49491.1| hypothetical protein CISIN_1g000933mg [Citrus sinensis]
Length=1219

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_006487332.1| PREDICTED: coatomer subunit alpha-2-like isoform X1 [Citrus sinensis]
 ref|XP_006487333.1| PREDICTED: coatomer subunit alpha-2-like isoform X2 [Citrus sinensis]
Length=1219

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_008240283.1| PREDICTED: coatomer subunit alpha-1 [Prunus mume]
Length=1218

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHP  300



>ref|XP_007017678.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOY14903.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   315 bits (808),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCI+VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCIAVLTGHNHYVMCASFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 68/146 (47%), Gaps = 20/146 (14%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD--YRMGTL----IDRFDEHDGP  329
            M   F  K + V   S   + R W + +L    +   D   R+G L     D F   D  
Sbjct  139  MCASFHPKEDLVVSASLDQTVRVWDIGALKKKTVAPADDILRLGQLSQMNTDFFGGVDAV  198

Query  330  V--------RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQ  470
            V        RGV+   FH + PL VSG DD ++K+W     +   + T+ GH++ +  V 
Sbjct  199  VKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTMRGHMNNVSCVL  258

Query  471  FHHEYPWIVSASDDQTIRIWNWQSRT  548
            FH     IVS S+D++IR+W+   RT
Sbjct  259  FHSRQDIIVSNSEDKSIRVWDATKRT  284



>gb|EYU36749.1| hypothetical protein MIMGU_mgv1a000357mg [Erythranthe guttata]
Length=1220

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA+FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCATFHP  145


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               I+S S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIISNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_007210424.1| hypothetical protein PRUPE_ppa000386mg [Prunus persica]
 gb|EMJ11623.1| hypothetical protein PRUPE_ppa000386mg [Prunus persica]
Length=1218

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHP  300



>ref|XP_004165124.1| PREDICTED: coatomer subunit alpha-1-like, partial [Cucumis sativus]
Length=855

 Score =   310 bits (794),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_002501894.1| coatomer protein complex [Micromonas sp. RCC299]
 gb|ACO63152.1| coatomer protein complex [Micromonas sp. RCC299]
Length=1236

 Score =   315 bits (807),  Expect = 3e-96, Method: Composition-based stats.
 Identities = 137/144 (95%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVSFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKL RCL+TLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLRRCLYTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSR+CISVLTGHNHYVMCASFH
Sbjct  121  NWQSRSCISVLTGHNHYVMCASFH  144


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/99 (35%), Positives = 53/99 (54%), Gaps = 4/99 (4%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +    FH     
Sbjct  208  HDRGVNWAGFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCCMFHARQDI  267

Query  492  IVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
            IVS S+D++IR+W+   RT +      H+ + + A+ HP
Sbjct  268  IVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWILAA-HP  305



>ref|XP_008448067.1| PREDICTED: coatomer subunit alpha-1 [Cucumis melo]
Length=1217

 Score =   314 bits (805),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 56/110 (51%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               I+S S+D++IR+W+   RT +           +L  H    + A+ H
Sbjct  260  QDLIISNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAAHPEMNLLAAGH  309



>ref|XP_008393301.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1218

 Score =   314 bits (805),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHP  300



>ref|XP_006341999.1| PREDICTED: coatomer subunit alpha-1-like [Solanum tuberosum]
Length=1218

 Score =   314 bits (804),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_004300535.1| PREDICTED: coatomer subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=1218

 Score =   314 bits (804),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               I+S S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIISNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHP  300



>ref|XP_004238316.1| PREDICTED: coatomer subunit alpha-1 [Solanum lycopersicum]
Length=1218

 Score =   314 bits (804),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 144/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_009346991.1| PREDICTED: coatomer subunit alpha-2-like [Pyrus x bretschneideri]
Length=1216

 Score =   314 bits (804),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHP  300



>ref|XP_006356758.1| PREDICTED: coatomer subunit alpha-1-like [Solanum tuberosum]
Length=1219

 Score =   314 bits (804),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH++RPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTQRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAS-HP  300



>ref|XP_004148533.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
 ref|XP_004156620.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
 gb|KGN43163.1| hypothetical protein Csa_7G004160 [Cucumis sativus]
Length=1217

 Score =   313 bits (803),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 56/110 (51%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               I+S S+D++IR+W+   RT +           +L  H    + A+ H
Sbjct  260  QDLIISNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAAHPEMNLLAAGH  309



>ref|XP_004243143.1| PREDICTED: coatomer subunit alpha-1-like [Solanum lycopersicum]
Length=1219

 Score =   313 bits (803),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH++RPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTQRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 55/102 (54%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAS-HP  300



>ref|XP_008460997.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
 ref|XP_008460999.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
Length=1219

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT +      +      S HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILSAHP  300



>emb|CDY61804.1| BnaC03g76410D [Brassica napus]
Length=493

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               IVS S+D++IR+W+   RT I
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGI  283



>ref|XP_008374746.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1216

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREHDRFWILSSHP  300



>ref|XP_009794496.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana sylvestris]
Length=1218

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  VQFH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVQFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_010271512.1| PREDICTED: coatomer subunit alpha-1-like [Nelumbo nucifera]
Length=1218

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKIHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      H+ + + AS HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAS-HP  300



>ref|XP_010690807.1| PREDICTED: coatomer subunit alpha-1 [Beta vulgaris subsp. vulgaris]
Length=1220

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I             + HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGIQTFRREQDRFWILAAHP  300



>ref|XP_010263850.1| PREDICTED: coatomer subunit alpha-1 [Nelumbo nucifera]
Length=1218

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA+FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCATFHP  145


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAAHP  300



>ref|XP_008461000.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis melo]
Length=1219

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_009599251.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana tomentosiformis]
Length=1218

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  VQFH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVQFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_010555274.1| PREDICTED: coatomer subunit alpha-1-like [Tarenaya hassleriana]
Length=1217

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_009790884.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana sylvestris]
Length=1219

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTCISVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFH  144


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILACHP  300



>ref|XP_006828935.1| hypothetical protein AMTR_s00001p00220200 [Amborella trichopoda]
 gb|ERM96351.1| hypothetical protein AMTR_s00001p00220200 [Amborella trichopoda]
Length=1216

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 145/145 (100%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K+QPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH + +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHTNNVSCVMFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGVQTFRREHDRFWILAAHP  300



>ref|XP_009598989.1| PREDICTED: coatomer subunit alpha-1-like [Nicotiana tomentosiformis]
Length=1219

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTCISVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFH  144


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILACHP  300



>gb|AAS58474.1| coatomer alpha subunit [Hordeum vulgare subsp. vulgare]
Length=1218

 Score =   312 bits (800),  Expect = 2e-95, Method: Composition-based stats.
 Identities = 131/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQTIR+W
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 34/98 (35%), Positives = 51/98 (52%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +   
Sbjct  203  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQDI  262

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            IVS S+D++IR+W+   RT I      +      + HP
Sbjct  263  IVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAAHP  300



>ref|XP_011398207.1| Coatomer subunit alpha-2 [Auxenochlorella protothecoides]
 gb|KFM25315.1| Coatomer subunit alpha-2 [Auxenochlorella protothecoides]
Length=1032

 Score =   310 bits (794),  Expect = 3e-95, Method: Composition-based stats.
 Identities = 132/145 (91%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEH+GPVRG+HFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHEGPVRGIHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQT+R+W
Sbjct  61   PTQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTLRLW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCI+VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCIAVLTGHNHYVMCAQFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 12/107 (11%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD +IK+W     +   + TL GH++ + +V FH +   
Sbjct  209  HDRGVNWAAFHPTLPLVVSGADDRQIKLWRMNESKAWEVDTLRGHVNNVSSVIFHAKQDL  268

Query  492  IVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
            I+S S+D+++R+W+   R  +           +L GH    + A+ H
Sbjct  269  IISDSEDKSLRVWDLSKRVGVQTFRREHDRFWILAGHPSINLLAAGH  315



>ref|XP_010526595.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
 ref|XP_010526596.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
 ref|XP_010526598.1| PREDICTED: coatomer subunit alpha-1 [Tarenaya hassleriana]
Length=1217

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            +SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDGTKRTGLQTFRREHDRFWILAVHP  300



>gb|KGN61837.1| hypothetical protein Csa_2G249910 [Cucumis sativus]
Length=1219

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_010919610.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
 ref|XP_010919611.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
 ref|XP_010919612.1| PREDICTED: coatomer subunit alpha-1 [Elaeis guineensis]
Length=1218

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 56/110 (51%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IRIW+   RT I           +LT H    + A+ H
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILTAHPEMNLLAAGH  309



>ref|XP_010109755.1| hypothetical protein L484_008431 [Morus notabilis]
 gb|EXC24660.1| hypothetical protein L484_008431 [Morus notabilis]
Length=1220

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  201  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IR+W+   RT +           +L  H    + A+ H
Sbjct  261  QDIIVSNSEDKSIRVWDVTRRTGVQTFRREHDRFWILAAHPEMNLLAAGH  310



>ref|XP_007213296.1| hypothetical protein PRUPE_ppa000388mg [Prunus persica]
 gb|EMJ14495.1| hypothetical protein PRUPE_ppa000388mg [Prunus persica]
Length=1217

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_008802787.1| PREDICTED: coatomer subunit alpha-1 [Phoenix dactylifera]
Length=1218

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 56/110 (51%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IRIW+   RT I           +LT H    + A+ H
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILTAHPEMNLLAAGH  309



>ref|XP_008225617.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-1-like 
[Prunus mume]
Length=1195

 Score =   311 bits (797),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_004293978.1| PREDICTED: coatomer subunit alpha-1-like [Fragaria vesca subsp. 
vesca]
Length=1219

 Score =   311 bits (797),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      S HP
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHP  300



>ref|XP_010933643.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
 ref|XP_010933644.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
 ref|XP_010933645.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
Length=1217

 Score =   311 bits (797),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/145 (99%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_010933642.1| PREDICTED: coatomer subunit alpha-1-like [Elaeis guineensis]
Length=1217

 Score =   311 bits (797),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDVIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_010096174.1| Coatomer subunit alpha-1 [Morus notabilis]
 gb|EXB63569.1| Coatomer subunit alpha-1 [Morus notabilis]
Length=1234

 Score =   311 bits (797),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  15   MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  74

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIR+W
Sbjct  75   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRMW  134

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  135  NWQSRTCISVLTGHNHYVMCASFHP  159


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  215  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  274

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  275  QDIIVSNSEDKSIRVWDATRRTGLQTFRREHDRFWILAAHP  315



>ref|XP_007042068.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOX97899.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   311 bits (796),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IR+W+   RT +           +L  H    + A+ H
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAAHPEMNLLAAGH  309



>gb|KJB77745.1| hypothetical protein B456_012G154500 [Gossypium raimondii]
Length=852

 Score =   306 bits (783),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + T  GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVLFHSK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  LDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_007042069.1| Coatomer, alpha subunit [Theobroma cacao]
 gb|EOX97900.1| Coatomer, alpha subunit [Theobroma cacao]
Length=1219

 Score =   311 bits (796),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IR+W+   RT +           +L  H    + A+ H
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAAHPEMNLLAAGH  309



>ref|XP_004507488.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Cicer arietinum]
 ref|XP_004507489.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Cicer arietinum]
Length=1222

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVVFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHP  300



>ref|XP_003540979.1| PREDICTED: coatomer subunit alpha-2-like isoform X1 [Glycine 
max]
 ref|XP_006592088.1| PREDICTED: coatomer subunit alpha-2-like isoform X2 [Glycine 
max]
Length=1221

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHP  300



>gb|KJB47565.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47566.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47567.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
 gb|KJB47568.1| hypothetical protein B456_008G031400 [Gossypium raimondii]
Length=1216

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               +VS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIVVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_004165122.1| PREDICTED: coatomer subunit alpha-1-like [Cucumis sativus]
Length=1219

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA+FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCAAFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGLQTFRREHDRFWILAAHP  300



>gb|KHN25415.1| Coatomer subunit alpha-2 [Glycine soja]
Length=1221

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHP  300



>ref|XP_004150060.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-1-like 
[Cucumis sativus]
Length=1183

 Score =   310 bits (794),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA+FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCAAFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRT  548
               IVS S+D++IRIW+   RT
Sbjct  260  QDIIVSNSEDKSIRIWDATKRT  281



>gb|KJB32566.1| hypothetical protein B456_005G247300 [Gossypium raimondii]
Length=1213

 Score =   310 bits (794),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_003537852.1| PREDICTED: coatomer subunit alpha-2-like [Glycine max]
Length=1221

 Score =   310 bits (794),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEDPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILATHP  300



>gb|KHG26300.1| hypothetical protein F383_08243 [Gossypium arboreum]
Length=1217

 Score =   310 bits (794),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 71/161 (44%), Gaps = 33/161 (20%)
 Frame = +3

Query  216  SFHSKRPWILASLHSGVIQLWDYRMGTL----------IDRFDE----------------  317
            SFH K   ++++     +++WD  +G+L          I RF +                
Sbjct  142  SFHPKEDLVVSASLDQTVRVWD--IGSLNKKTASPADDILRFSQMNSELFGGVDAVVKYV  199

Query  318  ---HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
               HD  V    FH + PL VSG DD ++K+W     +   + T  GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVMFHSK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  LDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHP  300



>gb|EPS65879.1| hypothetical protein M569_08896 [Genlisea aurea]
Length=1225

 Score =   310 bits (794),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHAKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDY+RTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYVRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVM ASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMSASFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = +3

Query  321  DGPVRGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEY  485
            +G  RGV+   FH + PL VSG DD  +K+W     +   + TL GH++ +  V FH + 
Sbjct  201  EGHERGVNWASFHPTLPLIVSGADDRHVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAKQ  260

Query  486  PWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
              IVS S+D++IRIW+   RT +      +      S HP
Sbjct  261  DVIVSNSEDKSIRIWDSTKRTGLQTFRREHDRFWILSAHP  300



>gb|KHN39822.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1221

 Score =   310 bits (794),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEDPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHP  300



>ref|XP_002529504.1| coatomer alpha subunit, putative [Ricinus communis]
 gb|EEF32873.1| coatomer alpha subunit, putative [Ricinus communis]
Length=1217

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV+FH
Sbjct  1    MLTKFETKSNRVKGLSFHCKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVNFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 46/84 (55%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   +  L GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDALRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               IVS S+D++IR+W+   R  I
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRMGI  283



>gb|KJB32563.1| hypothetical protein B456_005G247200 [Gossypium raimondii]
 gb|KJB32564.1| hypothetical protein B456_005G247200 [Gossypium raimondii]
Length=1213

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>gb|KHG24640.1| hypothetical protein F383_03247 [Gossypium arboreum]
Length=1218

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHP  300



>gb|KHG21379.1| hypothetical protein F383_26788 [Gossypium arboreum]
Length=1213

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>gb|KJB32565.1| hypothetical protein B456_005G247300 [Gossypium raimondii]
Length=1264

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAAHP  300



>ref|XP_007508098.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20589.1| predicted protein [Bathycoccus prasinos]
Length=1253

 Score =   310 bits (793),  Expect = 3e-94, Method: Composition-based stats.
 Identities = 135/144 (94%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGV+QLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVVQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   TNQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVQFHVEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSR CISVLTGHNHYVMCASFH
Sbjct  121  NWQSRNCISVLTGHNHYVMCASFH  144


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/98 (36%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH     
Sbjct  209  HDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDI  268

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            IVS S+D++IR+W+   R+        N      S HP
Sbjct  269  IVSNSEDKSIRVWDMSKRSGAQTFRRENDRFWILSAHP  306



>ref|XP_009362204.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362206.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362207.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
 ref|XP_009362208.1| PREDICTED: coatomer subunit alpha-1-like [Pyrus x bretschneideri]
Length=1217

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      S HP
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHP  300



>ref|XP_008346150.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1217

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      S HP
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHP  300



>emb|CAE45585.1| coatomer alpha subunit-like protein [Lotus japonicus]
Length=1221

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILATHP  300



>ref|XP_007131781.1| hypothetical protein PHAVU_011G041000g [Phaseolus vulgaris]
 gb|ESW03775.1| hypothetical protein PHAVU_011G041000g [Phaseolus vulgaris]
Length=1221

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA+FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCATFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILATHP  300



>ref|XP_003057643.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57594.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1238

 Score =   309 bits (792),  Expect = 3e-94, Method: Composition-based stats.
 Identities = 136/145 (94%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTV FH EYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVAFHPEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR CISVLTGHNHYVM A FHP
Sbjct  121  NWQSRNCISVLTGHNHYVMSAMFHP  145


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/98 (36%), Positives = 50/98 (51%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH     
Sbjct  204  HDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHARQDI  263

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            IVS S+D++IR+W+   RT +      +      S HP
Sbjct  264  IVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWILSAHP  301



>gb|KJB47562.1| hypothetical protein B456_008G031300 [Gossypium raimondii]
Length=1064

 Score =   308 bits (788),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRF+EHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFEEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_008365997.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-1-like 
[Malus domestica]
Length=828

 Score =   303 bits (777),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      S HP
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHP  300



>ref|XP_009400896.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
 ref|XP_009400897.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
 ref|XP_009400898.1| PREDICTED: coatomer subunit alpha-3 [Musa acuminata subsp. malaccensis]
Length=1216

 Score =   309 bits (791),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPW+LASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWVLASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH + +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSCVMFHAK  258

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I  +   +      S HP
Sbjct  259  MEVIVSNSEDKSIRIWDANKRTGIQTIRREHDRFWILSAHP  299


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 69/161 (43%), Gaps = 28/161 (17%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHDEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  384  DYKIKVWN--------------YKLHRCLFTLLGHLDYI---------RTVQ---FHHEY  485
            D  I+VW+               +L +    L G +D +         R V    FH   
Sbjct  156  DQTIRVWDIGALRKKVAPADDILRLSQMNTDLFGGIDAVVKYVLEGHDRGVNWASFHPTL  215

Query  486  PWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFH  602
            P IVS +DD+ +++W         +  L GH + V C  FH
Sbjct  216  PLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSCVMFH  256



>ref|XP_006300379.1| hypothetical protein CARUB_v10019676mg [Capsella rubella]
 gb|EOA33277.1| hypothetical protein CARUB_v10019676mg [Capsella rubella]
Length=1218

 Score =   309 bits (791),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+SVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPNLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHP  300



>gb|KJB77746.1| hypothetical protein B456_012G154500 [Gossypium raimondii]
Length=1216

 Score =   309 bits (791),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRC+FTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCVFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 71/161 (44%), Gaps = 33/161 (20%)
 Frame = +3

Query  216  SFHSKRPWILASLHSGVIQLWDYRMGTL----------IDRFDE----------------  317
            SFH K   ++++     +++WD  +G+L          I RF +                
Sbjct  142  SFHPKEDLVVSASLDQTVRVWD--IGSLNKKTASPADDILRFSQMNSELFGGVDAVVKYV  199

Query  318  ---HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
               HD  V    FH + PL VSG DD ++K+W     +   + T  GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTFRGHMNNVSCVLFHSK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  LDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_003607006.1| Coatomer alpha subunit-like protein [Medicago truncatula]
 gb|AES89203.1| coatomer subunit alpha-like protein [Medicago truncatula]
Length=1206

 Score =   308 bits (790),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            M TKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MFTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK+HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILSTHP  300



>emb|CBI19788.3| unnamed protein product [Vitis vinifera]
Length=1062

 Score =   307 bits (786),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLFGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRT +SVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTLMSVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVFFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IR+W+   RT I           +LT H    + A+ H
Sbjct  260  QDVIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILTAHPEMNLLAAGH  309



>ref|XP_002878550.1| hypothetical protein ARALYDRAFT_900556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54809.1| hypothetical protein ARALYDRAFT_900556 [Arabidopsis lyrata subsp. 
lyrata]
Length=1197

 Score =   308 bits (790),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145



>gb|KJB47564.1| hypothetical protein B456_008G031300 [Gossypium raimondii]
Length=1218

 Score =   308 bits (790),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRF+EHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFEEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   MSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDVTKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_010066199.1| PREDICTED: coatomer subunit alpha-1 [Eucalyptus grandis]
Length=1218

 Score =   308 bits (789),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/145 (98%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 71/159 (45%), Gaps = 29/159 (18%)
 Frame = +3

Query  216  SFHSKRPWILASLHSGVIQLWD---------------YRMGTL-IDRF-----------D  314
            SFH K   ++++     +++WD                R+G +  D F           +
Sbjct  142  SFHPKEDLVVSASLDQTVRVWDISALKNKTASPGDDLLRLGQMNTDLFGGVDVVVKYVLE  201

Query  315  EHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYP  488
             HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +  
Sbjct  202  GHDRGVNWASFHPNLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAKQD  261

Query  489  WIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
             IVS S+D++IRIW+   RT I      +      S HP
Sbjct  262  IIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILSAHP  300



>ref|XP_010672358.1| PREDICTED: coatomer subunit alpha-2-like [Beta vulgaris subsp. 
vulgaris]
Length=1211

 Score =   308 bits (789),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K+QPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IR+W+   RT +           +LT H    + A+ H
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILTAHPEMNLLAAGH  309



>gb|KDD75879.1| hypothetical protein H632_c457p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=313

 Score =   288 bits (738),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWIL SLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILTSLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIR+W
Sbjct  61   PSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+CI+VLTGHNHYVMCA FHP
Sbjct  121  NWQSRSCIAVLTGHNHYVMCAQFHP  145


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 69/167 (41%), Gaps = 34/167 (20%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            ++ + FH + PWI+++     I++W+++  + I     H+  V    FH  + L  S   
Sbjct  96   IRTVQFHHESPWIVSASDDQTIRVWNWQSRSCIAVLTGHNHYVMCAQFHPREDLIASASL  155

Query  384  DYKIKVWNYK-LHR-------------------------------CLFTLLGHLDYIRTV  467
            D  ++VW+   LH+                                 + L GH   +  V
Sbjct  156  DQTVRVWDMSGLHKRSSVGGAPGAAEEGLRFPPVSADLFGGGDAVIKYVLEGHDRGVNWV  215

Query  468  QFHHEYPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFH  602
             FH   P +VS +DD+T+++W         +  L GH + V CA FH
Sbjct  216  SFHPSLPLLVSGADDRTVKLWRMNDSKAWEVDTLRGHVNNVSCALFH  262


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 49/101 (49%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V  V FH S PL VSG DD  +K+W     +   + TL GH++ +    FH  
Sbjct  205  LEGHDRGVNWVSFHPSLPLLVSGADDRTVKLWRMNDSKAWEVDTLRGHVNNVSCALFHAR  264

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               +VS S+D+++R+W+   R  +      +      + HP
Sbjct  265  QDLVVSDSEDKSLRVWDLSKRIGLQTFRREHDRFWILAAHP  305



>ref|XP_002279779.1| PREDICTED: coatomer subunit alpha-1 [Vitis vinifera]
Length=1217

 Score =   308 bits (789),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYKLHRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKLHRCLFTLFGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRT +SVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTLMSVLTGHNHYVMCASFHP  145


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVFFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IR+W+   RT I           +LT H    + A+ H
Sbjct  260  QDVIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILTAHPEMNLLAAGH  309



>ref|XP_008383465.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1021

 Score =   306 bits (784),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145



>ref|NP_176393.1| coatomer subunit alpha-1 [Arabidopsis thaliana]
 sp|Q94A40.2|COPA1_ARATH RecName: Full=Coatomer subunit alpha-1; AltName: Full=Alpha-coat 
protein 1; Short=Alpha-COP 1 [Arabidopsis thaliana]
 gb|AAC28519.1| Strong similarity to coatamer alpha subunit (HEPCOP) homolog 
gb|U24105 from Homo sapiens [Arabidopsis thaliana]
 gb|AEE33914.1| coatomer subunit alpha-1 [Arabidopsis thaliana]
Length=1216

 Score =   308 bits (788),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKNHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+SVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_002888041.1| hypothetical protein ARALYDRAFT_475134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64300.1| hypothetical protein ARALYDRAFT_475134 [Arabidopsis lyrata subsp. 
lyrata]
Length=1217

 Score =   308 bits (788),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKNHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+SVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHP  145


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_006411704.1| hypothetical protein EUTSA_v10024240mg [Eutrema salsugineum]
 gb|ESQ53157.1| hypothetical protein EUTSA_v10024240mg [Eutrema salsugineum]
Length=1216

 Score =   308 bits (788),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH+KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHTKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK H+C FTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHKCNFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +3

Query  246  ASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC  425
            A L  GV  +  Y +       + HD  V    FH + PL VSG DD ++K+W     + 
Sbjct  186  ADLFGGVDAIVKYVL-------EGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKA  238

Query  426  --LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASF  599
              + TL GH++ + +V FH +   IVS S+D++IR+W+   RT +      +      + 
Sbjct  239  WEVDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAV  298

Query  600  HP  605
            HP
Sbjct  299  HP  300



>ref|XP_009407817.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1215

 Score =   307 bits (787),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR CISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRNCISVLTGHNHYVMCASFHP  145


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (47%), Gaps = 28/158 (18%)
 Frame = +3

Query  216  SFHSKRPWILASLHSGVIQLWD--------------YRMGTL-IDRFDEHDGPV------  332
            SFH K   I+++     I++WD               R+G +  D F   D  V      
Sbjct  142  SFHPKEDLIVSASLDQTIRVWDISSLRKKVSPADDILRLGQMNADLFGGVDAVVKYVLEG  201

Query  333  --RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
              RGV+   FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +   
Sbjct  202  HDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHMNNVSSVMFHAKQDI  261

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            IVS S+D++IRIW+   RT I      +      + HP
Sbjct  262  IVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  299



>ref|XP_009388919.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388927.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388935.1| PREDICTED: coatomer subunit alpha-1-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   307 bits (787),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHMNNVSCVMFHAK  258

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  259  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  299



>ref|XP_010472129.1| PREDICTED: coatomer subunit alpha-2-like, partial [Camelina sativa]
Length=1118

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_010416888.1| PREDICTED: coatomer subunit alpha-2-like [Camelina sativa]
Length=1221

 Score =   307 bits (786),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_010429041.1| PREDICTED: coatomer subunit alpha-2-like [Camelina sativa]
Length=1224

 Score =   307 bits (786),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_010066202.1| PREDICTED: coatomer subunit alpha-2-like [Eucalyptus grandis]
 gb|KCW64037.1| hypothetical protein EUGRSUZ_G01711 [Eucalyptus grandis]
Length=1218

 Score =   306 bits (785),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLS HSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSLHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFHHE+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTCRCLFTLLGHLDYIRTVQFHHEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 4/102 (4%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHTK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL-TGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      H+ + + AS HP
Sbjct  260  QEIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAS-HP  300


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (43%), Gaps = 29/162 (18%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHEHPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  384  DYKIKVWN---------------YKLHRCLFTLLGHLDYI---------RTVQ---FHHE  482
            D  ++VW+                +L +    L G +D +         R V    FH  
Sbjct  156  DQTVRVWDISALKKKTASPGDDLLRLSQMNTDLFGGVDAVVKYVLEGHDRGVNWAAFHPT  215

Query  483  YPWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFH  602
             P IVS +DD+ +++W         +  L GH + V C  FH
Sbjct  216  LPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFH  257



>ref|XP_010429048.1| PREDICTED: coatomer subunit alpha-2 [Camelina sativa]
 ref|XP_010429049.1| PREDICTED: coatomer subunit alpha-2 [Camelina sativa]
Length=1220

 Score =   306 bits (785),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPQRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_003567287.2| PREDICTED: coatomer subunit alpha-1-like [Brachypodium distachyon]
Length=277

 Score =   285 bits (730),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKG++FH +RPWILASLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGVAFHPRRPWILASLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYV+CASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVICASFHP  145



>ref|NP_179734.1| coatomer subunit alpha-2 [Arabidopsis thaliana]
 sp|Q9SJT9.1|COPA2_ARATH RecName: Full=Coatomer subunit alpha-2; AltName: Full=Alpha-coat 
protein 2; Short=Alpha-COP 2 [Arabidopsis thaliana]
 gb|AAD23699.1| coatomer alpha subunit [Arabidopsis thaliana]
 dbj|BAF00596.1| coatomer alpha subunit [Arabidopsis thaliana]
 gb|AEC07173.1| coatomer subunit alpha-2 [Arabidopsis thaliana]
Length=1218

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_006743501.1| PREDICTED: coatomer subunit alpha-like [Leptonychotes weddellii]
Length=838

 Score =   301 bits (771),  Expect = 3e-93, Method: Composition-based stats.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145



>ref|XP_008349149.1| PREDICTED: coatomer subunit alpha-1-like [Malus domestica]
Length=1217

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQ HHEYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQXHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHSR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      S HP
Sbjct  260  QDIIVSNSEDRSIRVWDATKRTGLQTFRREHDRFWILSAHP  300



>emb|CDY53172.1| BnaA06g40510D [Brassica napus]
Length=831

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>emb|CDY41989.1| BnaA01g05610D [Brassica napus]
Length=850

 Score =   301 bits (770),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>emb|CDX90339.1| BnaA08g16450D [Brassica napus]
Length=904

 Score =   302 bits (773),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>gb|ACN31006.1| unknown [Zea mays]
Length=251

 Score =   284 bits (726),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145



>gb|KEH43347.1| coatomer subunit alpha-like protein [Medicago truncatula]
Length=1216

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILSAHP  300



>ref|XP_006293578.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 ref|XP_006293579.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 gb|EOA26476.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
 gb|EOA26477.1| hypothetical protein CARUB_v10022525mg [Capsella rubella]
Length=1220

 Score =   305 bits (782),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIR+W
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRLW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_004496148.1| PREDICTED: coatomer subunit alpha-1-like [Cicer arietinum]
Length=1218

 Score =   305 bits (782),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_010531460.1| PREDICTED: coatomer subunit alpha-1-like [Tarenaya hassleriana]
Length=1219

 Score =   305 bits (782),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRF+EH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFEEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   TSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCI+VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCIAVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 74/162 (46%), Gaps = 17/162 (10%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD--YRMGTL-IDRFDEHDGPV--  332
            M   F  K + V   S   + R W + +L    +   D   R+G +  D F   D  V  
Sbjct  139  MCASFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDIMRLGQMNSDLFGGVDAIVKY  198

Query  333  ------RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  479
                  RGV+   FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH 
Sbjct  199  VLEGHDRGVNWAAFHPTLPLIVSGADDRQVKLWRVNDTKAWEVDTLRGHMNNVSCVMFHA  258

Query  480  EYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +   IVS S+D++IR+W+   RT +      +      + HP
Sbjct  259  KQDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_006404585.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 ref|XP_006404586.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 gb|ESQ46038.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
 gb|ESQ46039.1| hypothetical protein EUTSA_v10000016mg [Eutrema salsugineum]
Length=1214

 Score =   305 bits (781),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>tpg|DAA52914.1| TPA: hypothetical protein ZEAMMB73_412502 [Zea mays]
Length=258

 Score =   283 bits (725),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145



>gb|EWM26143.1| Coatomer, WD associated region [Nannochloropsis gaditana]
Length=1272

 Score =   305 bits (781),  Expect = 1e-92, Method: Composition-based stats.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGLSFH  RPWI+ SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLSFHPVRPWIITSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K+QPL VSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFH+EYPWIVSASDDQTIR+W
Sbjct  61   KTQPLIVSGGDDYKVKVWDYKLRRCLFTLLGHLDYIRTVQFHNEYPWIVSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA+FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCAAFHP  145


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/98 (32%), Positives = 50/98 (51%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL +SG DD ++K+W     +   + TL GH + +  V FH ++  
Sbjct  208  HDRGVNWASFHPTLPLVISGADDRQVKLWRMNDTKAWEVDTLRGHTNNVSCVIFHPKFEL  267

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            IVS S+D++IR+W+   R  +      +      + HP
Sbjct  268  IVSNSEDRSIRVWDISKRLGVQTFRRESDRFWILAAHP  305



>ref|XP_007144262.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 ref|XP_007144263.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 gb|ESW16256.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
 gb|ESW16257.1| hypothetical protein PHAVU_007G141700g [Phaseolus vulgaris]
Length=1218

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH   PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPVLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_003536291.1| PREDICTED: coatomer subunit alpha-1-like [Glycine max]
Length=1218

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_003556297.1| PREDICTED: coatomer subunit alpha-2-like [Glycine max]
Length=1218

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>gb|KHN37868.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1218

 Score =   305 bits (780),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCALFHP  145


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_001771211.1| predicted protein [Physcomitrella patens]
 gb|EDQ63922.1| predicted protein [Physcomitrella patens]
Length=1223

 Score =   304 bits (779),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVQFHHESPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTCISVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFH  144


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      S HP
Sbjct  260  QDIIVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWILSAHP  300



>ref|XP_010430239.1| PREDICTED: coatomer subunit alpha-1 [Camelina sativa]
Length=1216

 Score =   304 bits (779),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETK+NRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKNNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQ LFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   NSQSLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+SVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHP  300



>emb|CDY42637.1| BnaC01g00490D [Brassica napus]
Length=1068

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/171 (24%), Positives = 73/171 (43%), Gaps = 37/171 (22%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            ++ + FH + PWI+++     I++W+++  T I     H+  V    FH  + L VS   
Sbjct  96   IRTVQFHHENPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASL  155

Query  384  DYKIKVWNY------------------KLHRCLF-------------------TLLGHLD  452
            D  ++VW+                   +++  LF                   TL GH++
Sbjct  156  DQTVRVWDIGSLKKKTVSPADDLMRFTQMNSDLFDDRQVKLWRMNETKAWEVDTLRGHMN  215

Query  453  YIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
             + +V FH +   IVS S+D++IR+W+   RT I      +      + HP
Sbjct  216  NVSSVMFHAKQDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  266



>gb|EMS45609.1| Coatomer subunit alpha-3 [Triticum urartu]
Length=1200

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLTGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_001753855.1| predicted protein [Physcomitrella patens]
 gb|EDQ81177.1| predicted protein [Physcomitrella patens]
Length=1217

 Score =   304 bits (778),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTCISVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFH  144


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +             S HP
Sbjct  260  QDIIVSNSEDKSIRVWDMSKRTGVQTFRREQDRFWILSAHP  300



>ref|XP_009397879.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/145 (97%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDY MGTLIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYSMGTLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 74/161 (46%), Gaps = 16/161 (10%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD-YRMGTL-IDRFDEHDGPV---  332
            M   F  K + V   S   + R W + SL   V+   D  R+  +  D F   D  V   
Sbjct  139  MCASFHPKEDLVVSASLDQTIRVWDIGSLRQKVVPADDILRLSQMNTDLFGGIDAVVKYV  198

Query  333  -----RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
                 RGV+   FH + PL VSG DD ++K+W     +   + TL GH + + +V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSSVMFHTK  258

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  259  MDIIVSNSEDKSIRVWDATKRTGVQTFRREHDRFWILAVHP  299



>ref|XP_009101857.1| PREDICTED: coatomer subunit alpha-2-like [Brassica rapa]
Length=1230

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAVHP  300



>gb|EMT27309.1| Coatomer subunit alpha-3 [Aegilops tauschii]
Length=1217

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLTGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>emb|CDY53168.1| BnaA06g40470D [Brassica napus]
Length=1208

 Score =   303 bits (777),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_009101859.1| PREDICTED: coatomer subunit alpha-2 [Brassica rapa]
Length=1220

 Score =   303 bits (777),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 71/162 (44%), Gaps = 17/162 (10%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWDYRM-------------GTLIDR  308
            M   F  K + V   S   + R W + SL    +   D  M               ++  
Sbjct  139  MCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDLMRFTQMNSDLFGGVDAIVKY  198

Query  309  FDE-HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  479
            F E HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH 
Sbjct  199  FLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHA  258

Query  480  EYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +   IVS S+D++IR+W+   RT I      +      + HP
Sbjct  259  KQDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_001417203.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95496.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1222

 Score =   303 bits (776),  Expect = 4e-92, Method: Composition-based stats.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVW+YKL RC+FTLLGHLDYIRTV+FH EYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWSYKLRRCMFTLLGHLDYIRTVEFHQEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSR+ I+VLTGHNHYVMCA FH
Sbjct  121  NWQSRSSIAVLTGHNHYVMCARFH  144


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 40/161 (25%), Positives = 68/161 (42%), Gaps = 28/161 (17%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            ++ + FH + PWI+++     I++W+++  + I     H+  V    FH    L VS   
Sbjct  96   IRTVEFHQEYPWIVSASDDQTIRIWNWQSRSSIAVLTGHNHYVMCARFHHKDDLVVSASL  155

Query  384  DYKIKVWNY-----------------KLHRCLF---------TLLGHLDYIRTVQFHHEY  485
            D  ++VW+                  +++  LF          L GH   +    FH   
Sbjct  156  DQTVRVWDISGLRRKAVSPADELRMPQMNNDLFGGGDTVVKYILEGHDRGVNWAAFHPTL  215

Query  486  PWIVSASDDQTIRIWNWQSRTCISV--LTGHNHYVMCASFH  602
            P IVS +DD+ +++W         V  L GH + V C +FH
Sbjct  216  PLIVSGADDRQVKLWRMNDTKAWEVDSLRGHVNNVSCVAFH  256


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/98 (33%), Positives = 48/98 (49%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD ++K+W     +   + +L GH++ +  V FH     
Sbjct  202  HDRGVNWAAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDSLRGHVNNVSCVAFHARQDV  261

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            IVS S+D++IR+W+   R         N      + HP
Sbjct  262  IVSNSEDKSIRVWDMSKRADAQTFRRENDRFWILAAHP  299



>ref|XP_009109461.1| PREDICTED: coatomer subunit alpha-2-like [Brassica rapa]
Length=1221

 Score =   303 bits (776),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWN+K HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP  300



>ref|XP_003523472.1| PREDICTED: coatomer subunit alpha-1-like isoform X1 [Glycine 
max]
 ref|XP_006578995.1| PREDICTED: coatomer subunit alpha-1-like isoform X2 [Glycine 
max]
Length=1206

 Score =   303 bits (775),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTL+DRF+EH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHKKRPWILASLHSGVIQLWDYRMGTLVDRFEEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIK+WNYKLHRCLF+LLGHLDY+RTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   DSQPLFVSGGDDYKIKLWNYKLHRCLFSLLGHLDYVRTVQFHHESPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 65/152 (43%), Gaps = 19/152 (13%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            V+ + FH + PWI+++     I++W+++  T I     H+  V    FH    L VS   
Sbjct  96   VRTVQFHHESPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHPRDDLLVSASL  155

Query  384  DYKIKVWNYKLHR-----------------CLFTLLGHLDYIRTVQFHHEYPWIVSASDD  512
            D  ++VW+    R                   + L GH   +    FH   P IVSA+DD
Sbjct  156  DQTLRVWDISPLRKKSPSSDDMPFGSPDAVVKYVLEGHDRGVNWASFHPALPLIVSAADD  215

Query  513  QTIRIWNWQSRTC--ISVLTGHNHYVMCASFH  602
            + +++W         +  L GH + V C  FH
Sbjct  216  RQLKLWRMNDTKAWEVDTLRGHMNNVSCVLFH  247


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  190  LEGHDRGVNWASFHPALPLIVSAADDRQLKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  249

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  250  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHP  290



>gb|KHN00939.1| Coatomer subunit alpha-1 [Glycine soja]
Length=1218

 Score =   303 bits (775),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/145 (96%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH KRPWILASLHSGVIQLWDYRMGTLID+FDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDKFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   HSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+CISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRSCISVLTGHNHYVMCALFHP  145


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VS  DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSAADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_006411687.1| hypothetical protein EUTSA_v10024239mg [Eutrema salsugineum]
 gb|ESQ53140.1| hypothetical protein EUTSA_v10024239mg [Eutrema salsugineum]
Length=1221

 Score =   303 bits (775),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/145 (95%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDY IKVWNYK HRCLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYTIKVWNYKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCISVLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD +IK+W     +   + TL GH++ + +V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQIKLWRMNETKAWEVDTLRGHMNNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGLQTFRREHDRFWILAVHP  300



>ref|XP_002455000.1| hypothetical protein SORBIDRAFT_03g002780 [Sorghum bicolor]
 gb|EES00120.1| hypothetical protein SORBIDRAFT_03g002780 [Sorghum bicolor]
Length=1122

 Score =   301 bits (772),  Expect = 1e-91, Method: Composition-based stats.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH +RP I +SLHSGVIQ+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPRIRSSLHSGVIQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145



>ref|XP_002466586.1| hypothetical protein SORBIDRAFT_01g010390 [Sorghum bicolor]
 gb|EER93584.1| hypothetical protein SORBIDRAFT_01g010390 [Sorghum bicolor]
Length=1217

 Score =   302 bits (774),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_004982004.1| PREDICTED: coatomer subunit alpha-3-like [Setaria italica]
Length=1219

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|NP_001051056.1| Os03g0711400 [Oryza sativa Japonica Group]
 sp|Q9AUR8.1|COPA1_ORYSJ RecName: Full=Coatomer subunit alpha-1; AltName: Full=Alpha-coat 
protein 1; Short=Alpha-COP 1 [Oryza sativa Japonica Group]
 gb|AAK18834.1|AC082645_4 putative alpha-coat protein [Oryza sativa Japonica Group]
 gb|ABF98513.1| Coatomer alpha subunit, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12970.1| Os03g0711400 [Oryza sativa Japonica Group]
 gb|EAZ28339.1| hypothetical protein OsJ_12317 [Oryza sativa Japonica Group]
 dbj|BAG94532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1218

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILSAHP  300



>ref|XP_002966115.1| hypothetical protein SELMODRAFT_85610 [Selaginella moellendorffii]
 gb|EFJ32142.1| hypothetical protein SELMODRAFT_85610 [Selaginella moellendorffii]
Length=1139

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            +SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTCISVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFH  144


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 56/110 (51%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D+TIRIW+   R+ +           +L+GH    + A+ H
Sbjct  260  QDIIVSNSEDKTIRIWDMSKRSGVHTFRREHDRFWILSGHPEMNLLAAGH  309



>ref|XP_002982185.1| hypothetical protein SELMODRAFT_154977 [Selaginella moellendorffii]
 gb|EFJ16853.1| hypothetical protein SELMODRAFT_154977 [Selaginella moellendorffii]
Length=1216

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQLWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            +SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKTRRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTCISVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFH  144


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 56/110 (51%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D+TIRIW+   R+ +           +L+GH    + A+ H
Sbjct  260  QDIIVSNSEDKTIRIWDMSKRSGVHTFRREHDRFWILSGHPEMNLLAAGH  309



>ref|XP_001766709.1| predicted protein [Physcomitrella patens]
 gb|EDQ68562.1| predicted protein [Physcomitrella patens]
Length=1215

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFHS+RPWILASLHSG+IQLWDYRMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLSFHSRRPWILASLHSGIIQLWDYRMGTLIDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            KSQPLFVSGGDDYKIKVWNYK+ RCLFTLLGHLDYIRTV+FHHE PWIVSASDDQTIRIW
Sbjct  61   KSQPLFVSGGDDYKIKVWNYKMRRCLFTLLGHLDYIRTVKFHHESPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTCISVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCISVLTGHNHYVMCASFH  144


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH++ +  V FH  
Sbjct  200  LEGHDRGVNWASFHPSLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVLFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT +      +      S HP
Sbjct  260  QDVIVSNSEDKSIRVWDMSKRTGVQTFRREHDRFWILSVHP  300



>ref|XP_008646256.1| PREDICTED: uncharacterized protein LOC100384351 isoform X1 [Zea 
mays]
 tpg|DAA50981.1| TPA: hypothetical protein ZEAMMB73_408440 [Zea mays]
Length=1218

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_008644216.1| PREDICTED: uncharacterized protein LOC100502115 isoform X1 [Zea 
mays]
 gb|AFW67844.1| hypothetical protein ZEAMMB73_579366 [Zea mays]
Length=1217

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHEYPWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHVNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_009526440.1| hypothetical protein PHYSODRAFT_545018 [Phytophthora sojae]
 gb|EGZ17382.1| hypothetical protein PHYSODRAFT_545018 [Phytophthora sojae]
Length=1229

 Score =   301 bits (771),  Expect = 2e-91, Method: Composition-based stats.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+C+S+LTGHNHYVMCA FHP
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHP  145



>emb|CDY13820.1| BnaA09g43220D [Brassica napus]
Length=486

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFET SN+V+GLSFH KRPWIL+SLH+GVIQLWDYRM TLID F+EHDGPVRGVHFH
Sbjct  1    MLTKFETSSNQVRGLSFHPKRPWILSSLHTGVIQLWDYRMATLIDTFEEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK H+CLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ISQPLFVSGGDDYKIKVWNYKTHKCLFTLLGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+SVL GHNHYVMCASFHP
Sbjct  121  NWQSRTCVSVLAGHNHYVMCASFHP  145


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD K+K+W     +   + TL GH   + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRKVKLWRTNETKAWEVDTLRGHSSNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +  IVS S+D+TIR+W+   RT I      N      + HP
Sbjct  260  HDVIVSNSEDKTIRVWDATKRTEIKTFRRENDRFWILAAHP  300



>ref|XP_005759442.1| COPA1, alpha subunit of the coatomer [Emiliania huxleyi CCMP1516]
 gb|EOD07013.1| COPA1, alpha subunit of the coatomer [Emiliania huxleyi CCMP1516]
Length=1250

 Score =   300 bits (767),  Expect = 1e-90, Method: Composition-based stats.
 Identities = 127/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FHS RPW+LASLH+GV+QLWD+RMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLAFHSSRPWVLASLHNGVVQLWDFRMGTLIDRFDEHDGPVRGVCFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            +SQPLFV+GGDDYKIKVWNYKL RCLF+LLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   QSQPLFVTGGDDYKIKVWNYKLRRCLFSLLGHLDYIRTVQFHVEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQ R+C+SVLTGHNHYVMCA FH
Sbjct  121  NWQQRSCVSVLTGHNHYVMCAQFH  144


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +    FH +   
Sbjct  231  HDRGVNWASFHSTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHINNVSCALFHPKQEL  290

Query  492  IVSASDDQTIRIWNWQSR  545
            I+S S+D++IR+W+   R
Sbjct  291  IISNSEDKSIRVWDMSKR  308



>sp|Q9AUR7.1|COPA2_ORYSJ RecName: Full=Coatomer subunit alpha-2; AltName: Full=Alpha-coat 
protein 2; Short=Alpha-COP 2 [Oryza sativa Japonica Group]
 gb|AAK18837.1|AC082645_7 putative alpha-coat protein [Oryza sativa Japonica Group]
 gb|ABF98514.1| Coatomer alpha subunit, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY91611.1| hypothetical protein OsI_13245 [Oryza sativa Indica Group]
 gb|EAZ28340.1| hypothetical protein OsJ_12318 [Oryza sativa Japonica Group]
Length=1218

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      S HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILSAHP  300



>ref|XP_010229358.1| PREDICTED: coatomer subunit alpha-3 [Brachypodium distachyon]
Length=1218

 Score =   298 bits (763),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL +SG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIISGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IR+W+   RT I           VL  H    + A+ H
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWVLAAHPEMNLLAAGH  309



>emb|CDX82024.1| BnaC08g35770D [Brassica napus]
Length=472

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFET SN+V+GLSFH KRPWIL+SLH+G IQLWDYRM TLID F+EHDGPVRGVHFH
Sbjct  1    MLTKFETSSNQVRGLSFHPKRPWILSSLHTGAIQLWDYRMATLIDTFEEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK H+CLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ISQPLFVSGGDDYKIKVWNYKTHKCLFTLLGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+SVL GHNHYVMCASFHP
Sbjct  121  NWQSRTCVSVLAGHNHYVMCASFHP  145



>ref|XP_006650487.1| PREDICTED: coatomer subunit alpha-3-like [Oryza brachyantha]
Length=1219

 Score =   298 bits (762),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH +RPWILASLHSGVIQ+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLTFHPRRPWILASLHSGVIQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT +      +      + HP
Sbjct  260  QDIIVSNSEDKSIRIWDATKRTGVQTFRREHDRFWILAAHP  300



>ref|XP_003564667.1| PREDICTED: coatomer subunit alpha-3-like [Brachypodium distachyon]
Length=1219

 Score =   297 bits (760),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH +RPWILASLHSGV+Q+WDYRMGTL+DRFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILASLHSGVVQMWDYRMGTLLDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K+QPLFVSGGDDYKIKVWNYK HRCLFTL GHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KTQPLFVSGGDDYKIKVWNYKTHRCLFTLHGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHP  300



>gb|EPS70817.1| hypothetical protein M569_03938, partial [Genlisea aurea]
Length=1229

 Score =   296 bits (759),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 141/146 (97%), Gaps = 1/146 (1%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDG-PVRGVHF  347
            MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGT ID+FDEH G PVRGVHF
Sbjct  11   MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTRIDQFDEHAGVPVRGVHF  70

Query  348  HKSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRI  527
            HKSQPLFVSGGDD+KIKVWNYKLHRCLFTLLGHLDY+RTVQFHHEYPWIVSASDDQTIRI
Sbjct  71   HKSQPLFVSGGDDFKIKVWNYKLHRCLFTLLGHLDYVRTVQFHHEYPWIVSASDDQTIRI  130

Query  528  WNWQSRTCISVLTGHNHYVMCASFHP  605
            WNWQSR CISVLTGHNHYVM ASFHP
Sbjct  131  WNWQSRACISVLTGHNHYVMSASFHP  156


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  211  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHAK  270

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D++IR+W+   RT +           +L  H    + A+ H
Sbjct  271  QDIIVSNSEDKSIRVWDSTKRTGLQNFRREHDRFWILAAHPEMNLLAAGH  320



>ref|XP_004333061.1| alphaCOP, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR11048.1| alphaCOP, putative [Acanthamoeba castellanii str. Neff]
Length=1217

 Score =   296 bits (757),  Expect = 2e-89, Method: Composition-based stats.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTK ETKSNRVKGLSFH KRPWILASLH+G+IQLWDYR+ TL+DRFDEHDGPVRG+ FH
Sbjct  1    MLTKLETKSNRVKGLSFHPKRPWILASLHNGLIQLWDYRIRTLLDRFDEHDGPVRGISFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYKL RCLFTLLGH+DYIRTVQFHHEYPWI+SASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHMDYIRTVQFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCI+VLTGHNHYVM A FHP
Sbjct  121  NWQSRTCIAVLTGHNHYVMSAYFHP  145


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 33/98 (34%), Positives = 48/98 (49%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH S PL VSG DD  +K+W     +   + TL GH + +  V FH     
Sbjct  204  HDRGVNWAAFHPSLPLIVSGADDRSVKLWRMNDTKAWEVDTLRGHYNNVSCVIFHPHQEL  263

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            I+S S+D+TIR+W+   R+ +      +      + HP
Sbjct  264  ILSNSEDKTIRVWDMSKRSAVQTFRREHDRFWIIAAHP  301



>ref|XP_002990232.1| hypothetical protein SELMODRAFT_447957 [Selaginella moellendorffii]
 gb|EFJ08647.1| hypothetical protein SELMODRAFT_447957 [Selaginella moellendorffii]
Length=1213

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLT FETKSNRVKGLSFH KRPWILASLH+GVI LWDYRMG+LIDRFDEHDGPVRGVHFH
Sbjct  1    MLTTFETKSNRVKGLSFHPKRPWILASLHTGVIHLWDYRMGSLIDRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKARRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTC+SVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFH  144


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH + +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRINDTKAWEVDTLRGHTNNVSCVLFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D+TIR+W+   R+ +           V+ GH    + A+ H
Sbjct  260  QDIIVSNSEDKTIRVWDLSKRSAVQTFRRDHDRFWVICGHPEMNLLAAGH  309



>ref|XP_002961902.1| hypothetical protein SELMODRAFT_77651 [Selaginella moellendorffii]
 gb|EFJ37162.1| hypothetical protein SELMODRAFT_77651 [Selaginella moellendorffii]
Length=1213

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLT FETKSNRVKGLSFH KRPWILASLH+GVI LWDYRMG+LIDRFDEHDGPVRG+HFH
Sbjct  1    MLTTFETKSNRVKGLSFHPKRPWILASLHTGVIHLWDYRMGSLIDRFDEHDGPVRGIHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRTVQFH EYPWIVSASDDQTIRIW
Sbjct  61   SSQPLFVSGGDDYKIKVWNYKARRCLFTLLGHLDYIRTVQFHQEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSRTC+SVLTGHNHYVMCASFH
Sbjct  121  NWQSRTCVSVLTGHNHYVMCASFH  144


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 12/110 (11%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   + TL GH + +  V FH  
Sbjct  200  LEGHDRGVNWAAFHPSLPLIVSGADDRQVKLWRINDTKAWEVDTLRGHTNNVSCVLFHAR  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
               IVS S+D+TIR+W+   R+ +           V+ GH    + A+ H
Sbjct  260  QDIIVSNSEDKTIRVWDLSKRSAVQTFRRDHDRFWVICGHPEMNLLAAGH  309



>emb|CDQ86226.1| unnamed protein product [Oncorhynchus mykiss]
Length=512

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHH+YPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHDYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (51%), Gaps = 2/87 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVL  563
               I+S S+D++IR+W+   RT +   
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGVQTF  287



>ref|XP_009400691.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400692.1| PREDICTED: coatomer subunit alpha-3-like [Musa acuminata subsp. 
malaccensis]
Length=1216

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            ML+KFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMG+LIDRF+EHDGPVRG+HFH
Sbjct  1    MLSKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGSLIDRFEEHDGPVRGLHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYK HRCLFTLLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   KLQPLFVSGGDDYKIKVWNYKTHRCLFTLLGHLDYIRTVQFHDEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCIS LTGHNH+VM ASFHP
Sbjct  121  NWQSRTCISALTGHNHFVMSASFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH + +  V FH +
Sbjct  199  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNDSKAWEVDTLRGHTNNVSCVMFHAK  258

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IRIW+   RT I      +      + HP
Sbjct  259  MEIIVSNSEDKSIRIWDATKRTGIQTFRREHDRFWILAAHP  299



>ref|XP_008672096.1| PREDICTED: uncharacterized protein LOC100192909 isoform X1 [Zea 
mays]
Length=1217

 Score =   291 bits (746),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH +RPWIL+SLHSGV+Q+WDYRMGTL++RFDEHDGPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLAFHPRRPWILSSLHSGVVQMWDYRMGTLLNRFDEHDGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ATQPLFVSGGDDYKIKVWNYKTQRCLFTLHGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC++VLTGHNHYVMCASFHP
Sbjct  121  NWQSRTCVAVLTGHNHYVMCASFHP  145


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +  V FH +
Sbjct  200  LEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   RT I      +      + HP
Sbjct  260  QDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAAHP  300



>ref|XP_008544952.1| PREDICTED: coatomer subunit alpha [Microplitis demolitor]
Length=1218

 Score =   291 bits (745),  Expect = 7e-88, Method: Composition-based stats.
 Identities = 125/145 (86%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TL+++FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLLEKFDEHDGPVRGICFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
              QPLFVSGGDDYKIKVWNYK  RC+FTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   NQQPLFVSGGDDYKIKVWNYKQRRCIFTLLGHLDYIRTTVFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR CI VLTGHNHYVMCA FHP
Sbjct  121  NWQSRACICVLTGHNHYVMCAQFHP  145


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 10/134 (7%)
 Frame = +3

Query  210  GLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDY  389
            GL  H K P        G   L+      +    + HD  V    F+ + PL VSG DD 
Sbjct  178  GLEEHLKNP--------GTTDLFGQADAVVKHVLEGHDRGVNWASFNPTLPLIVSGADDR  229

Query  390  KIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVL  563
            +IK+W     +   + T  GH + +  V FH     I+S S+D++IR+W+   R C+   
Sbjct  230  QIKMWRMTDMKAWEVDTCRGHYNNVSCVLFHPRQDLILSNSEDKSIRVWDMAKRGCLQTF  289

Query  564  TGHNHYVMCASFHP  605
               +      + HP
Sbjct  290  RREHERFWVLAAHP  303



>emb|CBN77093.1| Vesicle coat complex COPI, alpha subunit [Ectocarpus siliculosus]
Length=1258

 Score =   291 bits (745),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGLSFH  RPWIL SLH+G+IQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLSFHPIRPWILTSLHNGIIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K+QPL VSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTVQFH+EYPWI+SASDDQTIRIW
Sbjct  61   KTQPLIVSGGDDYKIKVWDYKLRRCLFTLLGHLDYIRTVQFHNEYPWIISASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTCI+VLTGHNHYVMCA+FHP
Sbjct  121  NWQSRTCIAVLTGHNHYVMCAAFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL +SG DD ++K+W     +   + T+ GH + +  V FH +
Sbjct  204  LEGHDRGVNWASFHPTLPLVISGADDRQVKLWRMNETKAWEVHTMTGHTNNVSCVIFHPK  263

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
               IVS S+D++IR+W+   R  +      N      + HP
Sbjct  264  RELIVSNSEDRSIRVWDISQRMGVQTFRRENDRFWILAAHP  304



>dbj|BAE02266.1| unnamed protein product [Macaca fascicularis]
Length=672

 Score =   283 bits (725),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 61/132 (46%), Gaps = 14/132 (11%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTG  569
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  570  HNHYVMCASFHP  605
             +      + HP
Sbjct  290  DHDRFWVLAAHP  301



>ref|NP_001166192.1| coatomer protein complex subunit alpha [Bombyx mori]
 gb|ADB66734.1| coatomer protein complex subunit alpha [Bombyx mori]
Length=1230

 Score =   290 bits (742),  Expect = 2e-87, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            ML KFETKS RVKG+SFH+KRPW+LASLH+GVIQLWDYRM TL+++FDEHDGPVRG+ FH
Sbjct  1    MLKKFETKSARVKGISFHAKRPWVLASLHNGVIQLWDYRMCTLLEKFDEHDGPVRGICFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
              QPLFVSGGDDYKIKVWNYK  RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   IQQPLFVSGGDDYKIKVWNYKQRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR CISVLTGHNHYVMCA FHP
Sbjct  121  NWQSRQCISVLTGHNHYVMCAQFHP  145


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL  S  DD ++K+W     +   + T  GH + +  V FH ++  
Sbjct  206  HDRGVNWACFHPTLPLIASAADDRQVKLWRMNDSKAWEVDTCRGHYNNVSCVLFHAKHEL  265

Query  492  IVSASDDQTIRIWNWQSRTCI-SVLTGHNHYVMCASFHP  605
            I+S S+D  IR+W+   RT + S    H  Y +  S HP
Sbjct  266  IISNSEDLYIRVWDMSKRTLLQSFRREHERYWVLTS-HP  303



>ref|XP_005710742.1| Coatomer subunit alpha, WD40 repeat-containing protein [Chondrus 
crispus]
 emb|CDF40448.1| Coatomer subunit alpha, WD40 repeat-containing protein [Chondrus 
crispus]
Length=1269

 Score =   290 bits (742),  Expect = 3e-87, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH  RPWILASLH+G IQLWDYRMGTLIDRFDEH+GPVRG+ FH
Sbjct  1    MLTKFETKSNRVKGLAFHPTRPWILASLHNGAIQLWDYRMGTLIDRFDEHEGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            +SQPLFVSGGDDYKIKVWNYKL RC+FTL+GHLDYIRTV FHHE PWIVSASDDQT+RIW
Sbjct  61   RSQPLFVSGGDDYKIKVWNYKLRRCIFTLIGHLDYIRTVYFHHESPWIVSASDDQTVRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQ+R+C++VLTGH+HY M A F P
Sbjct  121  NWQNRSCLAVLTGHSHYCMSAMFSP  145


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 15/109 (14%)
 Frame = +3

Query  321  DGPVRGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEY  485
            +G  RGV+   FH + PL VSG DD ++K+W     +   L T  GHL+ +    FH   
Sbjct  206  EGHTRGVNWASFHPTLPLIVSGADDRQVKLWRMSDTKAWELDTFRGHLNNVSCAMFHPRK  265

Query  486  PWIVSASDDQTIRIWNWQSRTCIS----------VLTGHNHYVMCASFH  602
              +++ S+D+TIR+W+   RTC+           +LT H    + A+ H
Sbjct  266  ELVITDSEDKTIRVWDLNRRTCLHTFRRDADRFWILTAHPTINLIAAGH  314



>ref|XP_002896974.1| coatomer protein complex, putative [Phytophthora infestans T30-4]
 gb|EEY66455.1| coatomer protein complex, putative [Phytophthora infestans T30-4]
Length=1243

 Score =   289 bits (740),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+C+S+LTGHNHYVMCA FHP
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +  I+S S+D++IR+W+   R  +      N      + HP
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHP  307



>gb|ETL92039.1| hypothetical protein L917_09539 [Phytophthora parasitica]
 gb|ETO74204.1| hypothetical protein F444_10006 [Phytophthora parasitica P1976]
Length=1243

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+C+S+LTGHNHYVMCA FHP
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +  I+S S+D++IR+W+   R  +      N      + HP
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHP  307



>gb|ETI45564.1| hypothetical protein F443_09913 [Phytophthora parasitica P1569]
 gb|ETL38915.1| hypothetical protein L916_09614 [Phytophthora parasitica]
Length=1243

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+C+S+LTGHNHYVMCA FHP
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +  I+S S+D++IR+W+   R  +      N      + HP
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHP  307



>gb|ETM45336.1| hypothetical protein L914_09580 [Phytophthora parasitica]
Length=1243

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+C+S+LTGHNHYVMCA FHP
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +  I+S S+D++IR+W+   R  +      N      + HP
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHP  307



>ref|XP_008892963.1| hypothetical protein PPTG_01415 [Phytophthora parasitica INRA-310]
 gb|ETN21137.1| hypothetical protein PPTG_01415 [Phytophthora parasitica INRA-310]
Length=1243

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+C+S+LTGHNHYVMCA FHP
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHP  145


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            Y  I+S S+D++IR+W+   R  +      N      + HP
Sbjct  267  YELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHP  307



>gb|ETK85490.1| hypothetical protein L915_09709 [Phytophthora parasitica]
 gb|ETP43418.1| hypothetical protein F442_09816 [Phytophthora parasitica P10297]
Length=1243

 Score =   289 bits (739),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+C+S+LTGHNHYVMCA FHP
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +  I+S S+D++IR+W+   R  +      N      + HP
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHP  307



>gb|ETP15371.1| hypothetical protein F441_09860 [Phytophthora parasitica CJ01A1]
Length=1243

 Score =   289 bits (739),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKGL+FH  RPWIL SLH+GVIQLWDYRMGTL+DRFDEHDGPVRGV FH
Sbjct  1    MLTKFESKSNRVKGLAFHVSRPWILTSLHNGVIQLWDYRMGTLLDRFDEHDGPVRGVDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYK+KVW+YKL RCLFTLLGHLDYIRTVQFHHEYPWI+S SDDQTIRIW
Sbjct  61   RTQPLFVSGGDDYKLKVWDYKLRRCLFTLLGHLDYIRTVQFHHEYPWILSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+C+S+LTGHNHYVMCA FHP
Sbjct  121  NWQSRSCVSILTGHNHYVMCAQFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + T+ GH + I  V FH  
Sbjct  207  LEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTMRGHTNNISCVLFHPR  266

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +  I+S S+D++IR+W+   R  +      N      + HP
Sbjct  267  HELIISNSEDRSIRVWDISKRMGLQTFRRENDRFWMLAAHP  307



>ref|XP_005768226.1| COPA1, alpha subunit of the coatomer, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD15797.1| COPA1, alpha subunit of the coatomer, partial [Emiliania huxleyi 
CCMP1516]
Length=803

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FHS RPW+LASLH+GV+QLWD+RMGTLIDRFDEHDGPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLAFHSSRPWVLASLHNGVVQLWDFRMGTLIDRFDEHDGPVRGVCFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            +SQPLFV+GGDDYKIKVWNYKL RCLF+LLGHLDYIRTVQFH E+PWIVSASDDQTIRIW
Sbjct  61   QSQPLFVTGGDDYKIKVWNYKLRRCLFSLLGHLDYIRTVQFHVEHPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQ R+C+SVLTGHNHYVMCA FH
Sbjct  121  NWQQRSCVSVLTGHNHYVMCAQFH  144


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (55%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   + TL GH++ +    FH +
Sbjct  228  LEGHDRGVNWASFHSTLPLIVSGADDRQVKLWRMNETKAWEVDTLRGHINNVSCALFHPK  287

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   R  +
Sbjct  288  QELIISNSEDKSIRVWDMSKRQGV  311



>emb|CDS11681.1| hypothetical protein LRAMOSA03944 [Absidia idahoensis var. thermophila]
Length=1233

 Score =   288 bits (737),  Expect = 1e-86, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKG++FH KRPWILASLH+G IQLWDYRMGTL++RFDEHDGPVRG+ FH
Sbjct  3    MLTKFESKSNRVKGIAFHPKRPWILASLHNGSIQLWDYRMGTLLERFDEHDGPVRGIAFH  62

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWN+K  RCLFTL GHLDY+RTV FHHEYPWI+SASDDQTIRIW
Sbjct  63   PTQPLFVSGGDDYKIKVWNHKTRRCLFTLSGHLDYVRTVYFHHEYPWIISASDDQTIRIW  122

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+CI++LTGHNHYVM A FHP
Sbjct  123  NWQSRSCIAILTGHNHYVMSAQFHP  147


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VS GDD ++K+W     +   + +  GH + + +  FH     
Sbjct  209  HDHGVNWASFHPNLPLIVSAGDDRQVKLWRMNETKAWEVDSCRGHFNNVSSAIFHPRQEL  268

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            I+SA +D+T+R+W+   RT I+     +      + HP
Sbjct  269  ILSAGEDKTLRVWDMTKRTAIATFRRDHDRFWALTCHP  306



>emb|CDH50700.1| coatomer alpha subunit [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1233

 Score =   288 bits (736),  Expect = 1e-86, Method: Composition-based stats.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKG++FH KRPWILASLH+G IQLWDYRMGTL++RFDEHDGPVRG+ FH
Sbjct  3    MLTKFESKSNRVKGIAFHPKRPWILASLHNGSIQLWDYRMGTLLERFDEHDGPVRGIAFH  62

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWN+K  RCLFTL GHLDY+RTV FHHEYPWI+SASDDQTIRIW
Sbjct  63   PTQPLFVSGGDDYKIKVWNHKTRRCLFTLSGHLDYVRTVYFHHEYPWIISASDDQTIRIW  122

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR+CI++LTGHNHYVM A FHP
Sbjct  123  NWQSRSCIAILTGHNHYVMSAQFHP  147


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/98 (31%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VS GDD ++K+W     +   + +  GH + + +  FH     
Sbjct  209  HDHGVNWASFHPNLPLIVSAGDDRQVKLWRMNETKAWEVDSCRGHFNNVSSAIFHPRQEL  268

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            I+SA +D+T+R+W+   RT I+     +      + HP
Sbjct  269  ILSAGEDKTLRVWDMTKRTAIATFRRDHDRFWALTCHP  306



>ref|XP_009117406.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-2 [Brassica 
rapa]
Length=1062

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFET SN+V+GLSFH KRPWIL+SLH+GVIQLWDYRM TLID F+EH+GPVRGVHFH
Sbjct  1    MLTKFETSSNQVRGLSFHPKRPWILSSLHTGVIQLWDYRMTTLIDTFEEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYK H+CLFTLLGHLDYIRTVQFHHE PWIVSASDDQTIRIW
Sbjct  61   ISQPLFVSGGDDYKIKVWNYKTHKCLFTLLGHLDYIRTVQFHHECPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+SVL GHNHYVMCASFHP
Sbjct  121  NWQSRTCVSVLAGHNHYVMCASFHP  145


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 52/101 (51%), Gaps = 2/101 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD K+K+W     +   + TL GH   + +V FH +
Sbjct  200  LEGHDRGVNWAAFHPTLPLIVSGADDRKVKLWRTNETKAWEVDTLRGHSSNVSSVMFHAK  259

Query  483  YPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +  IVS S+D+TIR+W+   RT I      N      + HP
Sbjct  260  HDVIVSNSEDKTIRVWDATKRTEIKTFRRENDRFWILAAHP  300



>ref|XP_002878551.1| hypothetical protein ARALYDRAFT_900557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54810.1| hypothetical protein ARALYDRAFT_900557 [Arabidopsis lyrata subsp. 
lyrata]
Length=1151

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKF+TKSNRVKGLSFH KRPWILASLHSGVIQLWDYR+GTLID+FD H GPVRGVHFH
Sbjct  1    MLTKFKTKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRVGTLIDKFDGHQGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDD KIKVWNYK H CLFTLLGHLDYIRTVQFHHEYPWI+SASDDQTIRIW
Sbjct  61   TSQPLFVSGGDDCKIKVWNYKTHWCLFTLLGHLDYIRTVQFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+SVL  HNHYVMCASFHP
Sbjct  121  NWQSRTCVSVLAAHNHYVMCASFHP  145


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 73/162 (45%), Gaps = 17/162 (10%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSF-HSKRPWILASLHSGVIQLWD--YRMGTL-IDRFDEHDGPV--  332
            M   F  K + V   S   + R W + +L    +   D   R+  +  D FD  D  V  
Sbjct  139  MCASFHPKDDLVVSASLDQTVRVWEIGALKKKTVSPSDDIMRLAEINSDLFDSVDVTVKY  198

Query  333  ------RGV---HFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHH  479
                  RGV    FH + PL VSG DD ++K+W     +   + TL GH++ + +V FH 
Sbjct  199  VLEGHERGVIWAAFHPNLPLIVSGSDDRQVKLWRMNETKAWEVDTLRGHMNNVSSVMFHA  258

Query  480  EYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            +   IVS S+D +IR+W+   RT I      +      + HP
Sbjct  259  KQDIIVSNSEDNSIRVWDATKRTEIQTFRREHDRFWSLAVHP  300



>ref|XP_010888093.1| PREDICTED: coatomer subunit alpha [Esox lucius]
Length=1222

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_005704483.1| coatomer (COPI) alpha subunit [Galdieria sulphuraria]
 gb|EME27963.1| coatomer (COPI) alpha subunit [Galdieria sulphuraria]
Length=1312

 Score =   287 bits (735),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGLSFH  RPWILASLH+GVIQLWDYRMGTL+DRF+EH+GPVRGVHFH
Sbjct  1    MLTKFETKSNRVKGLSFHPARPWILASLHNGVIQLWDYRMGTLLDRFEEHEGPVRGVHFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRTV FHHE PWIVSASDDQTIRIW
Sbjct  61   PSQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTVFFHHESPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQ+R+CI+VLTGHNHYVM A FHP
Sbjct  121  NWQNRSCIAVLTGHNHYVMSAMFHP  145


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 51/96 (53%), Gaps = 5/96 (5%)
 Frame = +3

Query  333  RGVH---FHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIV  497
            RGV+   FH + PL VSGGDD ++K+   +  R   + T  GHL+ +  V FH     IV
Sbjct  203  RGVNWASFHPTIPLVVSGGDDRQVKLTYLENGRTREIQTFYGHLNNVSCVMFHPSTNLIV  262

Query  498  SASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            S S+D+TIR+W+    TC+      N      + HP
Sbjct  263  SNSEDRTIRVWDPIRHTCLQTYRRENDRFWILAVHP  298



>emb|CDQ67339.1| unnamed protein product [Oncorhynchus mykiss]
Length=1223

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  + +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCI  554
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGV  284



>ref|NP_001001941.2| coatomer subunit alpha [Danio rerio]
 gb|AAT68072.1| cotamer alpha [Danio rerio]
Length=1224

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|NP_001133825.1| Coatomer subunit alpha [Salmo salar]
 gb|ACI33965.1| Coatomer subunit alpha [Salmo salar]
Length=1307

 Score =   287 bits (734),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  + +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCI  554
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_007234429.1| PREDICTED: coatomer subunit alpha-like [Astyanax mexicanus]
Length=1224

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>gb|AAI62474.1| Copa protein [Danio rerio]
Length=1224

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>gb|AAQ63170.1| coatomer protein complex subunit alpha [Danio rerio]
Length=1226

 Score =   286 bits (733),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH     
Sbjct  205  HDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPRQEL  264

Query  492  IVSASDDQTIRIWNWQSRTCI  554
            I+S S+D++IR+W+   RT +
Sbjct  265  ILSNSEDKSIRVWDMSKRTGV  285



>ref|XP_008432228.1| PREDICTED: coatomer subunit alpha [Poecilia reticulata]
Length=1222

 Score =   286 bits (732),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCI  554
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_008293242.1| PREDICTED: coatomer subunit alpha [Stegastes partitus]
Length=1222

 Score =   286 bits (732),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_005796611.1| PREDICTED: coatomer subunit alpha-like isoform X2 [Xiphophorus 
maculatus]
Length=1222

 Score =   286 bits (732),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCI  554
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_007552064.1| PREDICTED: coatomer subunit alpha [Poecilia formosa]
Length=1222

 Score =   286 bits (732),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCI  554
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_010750764.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha [Larimichthys 
crocea]
Length=1222

 Score =   286 bits (732),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 66/159 (42%), Gaps = 34/159 (21%)
 Frame = +3

Query  219  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  398
            FH + PWIL++     I++W+++  T +     H+  V    FH S+ L VS   D  ++
Sbjct  101  FHHEYPWILSASDDQTIRIWNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVR  160

Query  399  VWNYK------------------------LHRCLFTLLGHLDYIRTVQFHHEYPWIVSAS  506
            VW+                            R L    GH   +    FH   P IVS +
Sbjct  161  VWDISGLRKKNLSPGAVETEVRGISGVDLFARSLRQQFGHDRGVNWAAFHPSMPLIVSGA  220

Query  507  DDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHP  605
            DD+ ++IW       W+  TC     GH + V CA FHP
Sbjct  221  DDRQVKIWRMNESKAWELDTC----RGHYNNVSCAVFHP  255


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH     
Sbjct  200  HDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPRQEL  259

Query  492  IVSASDDQTIRIWNWQSRTCI  554
            I+S S+D++IR+W+   RT +
Sbjct  260  ILSNSEDKSIRVWDMSKRTGV  280



>ref|XP_003447511.1| PREDICTED: coatomer subunit alpha-like [Oreochromis niloticus]
Length=1222

 Score =   286 bits (732),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  + +D F   D  V        RGV+   FH S PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPSMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCI  554
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAIFHPRQELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_004078629.1| PREDICTED: coatomer subunit alpha [Oryzias latipes]
Length=1219

 Score =   286 bits (732),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  + +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGISGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCI  554
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGV  284



>gb|EPB81110.1| coatomer protein complex, subunit alpha (xenin) [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=1236

 Score =   286 bits (732),  Expect = 6e-86, Method: Composition-based stats.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KSNRVKG++FH KRPWILASLH+G IQLWDYRMGTL++RF+EHDGPVRG+ FH
Sbjct  3    MLTKFESKSNRVKGVAFHPKRPWILASLHNGCIQLWDYRMGTLLERFEEHDGPVRGISFH  62

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             +QPLFVSGGDDYKIKVWNYK  RCLFTL GHLDY+RTV FH+E PWI+SASDDQTIRIW
Sbjct  63   PTQPLFVSGGDDYKIKVWNYKTRRCLFTLNGHLDYVRTVFFHNELPWIISASDDQTIRIW  122

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSR CI++LTGHNHYVMCA FHP
Sbjct  123  NWQSRACIAILTGHNHYVMCAQFHP  147


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 10/102 (10%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWN------YKLHRCLFTLLGHLDYIRTVQFHH  479
            HD  V    FH + PL +S GDD ++K+W       +++  C     GH + + +  FH 
Sbjct  208  HDHGVNWASFHPTLPLIISAGDDRQVKLWRMNDTKAWEVDSCR----GHYNNVSSAIFHP  263

Query  480  EYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
                I+S S+D+TIR+W+   RT ++     +      + HP
Sbjct  264  RQDLILSDSEDKTIRVWDLTKRTAVATFRRDHDRFWVLTSHP  305



>emb|CEF97511.1| Coatomer, alpha subunit, C-terminal [Ostreococcus tauri]
Length=1222

 Score =   286 bits (731),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKSNRVKGL+FH KRPWILASLHSGVIQLWDYRMGTLIDRFDEH+GPVRGV FH
Sbjct  1    MLTKFETKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHEGPVRGVGFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIKVW+YKL RCLFTLLGHLDYIRTV+FH EYPWIVSASDDQTIRIW
Sbjct  61   ASQPLFVSGGDDYKIKVWSYKLRRCLFTLLGHLDYIRTVEFHAEYPWIVSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSR+ I VLTGHNHYVMCA FH
Sbjct  121  NWQSRSSIGVLTGHNHYVMCARFH  144


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/161 (25%), Positives = 69/161 (43%), Gaps = 28/161 (17%)
 Frame = +3

Query  204  VKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGD  383
            ++ + FH++ PWI+++     I++W+++  + I     H+  V    FH    L VS   
Sbjct  96   IRTVEFHAEYPWIVSASDDQTIRIWNWQSRSSIGVLTGHNHYVMCARFHHKDDLVVSASL  155

Query  384  DYKIKVWNYKLHR-------------------------CL-FTLLGHLDYIRTVQFHHEY  485
            D  ++VW+    R                         C+ + L GH   +  V FH   
Sbjct  156  DQTVRVWDISGLRRKAVSPQDELRMPQMNNDLFGGGDTCVKYILEGHDRGVNWVAFHPTL  215

Query  486  PWIVSASDDQTIRIWNWQSRTC--ISVLTGHNHYVMCASFH  602
            P IVS +DD+ +++W         +  L GH + V C +FH
Sbjct  216  PLIVSGADDRQVKLWRMNDTKAWEVDSLRGHVNNVSCVAFH  256


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V  V FH + PL VSG DD ++K+W     +   + +L GH++ +  V FH  
Sbjct  199  LEGHDRGVNWVAFHPTLPLIVSGADDRQVKLWRMNDTKAWEVDSLRGHVNNVSCVAFHAR  258

Query  483  YPWIVSASDDQTIRIWNWQSRT  548
               IVS S+D++IR+W+   R 
Sbjct  259  QDVIVSNSEDKSIRVWDMSKRA  280



>ref|XP_005796610.1| PREDICTED: coatomer subunit alpha-like isoform X1 [Xiphophorus 
maculatus]
Length=1232

 Score =   286 bits (732),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (50%), Gaps = 14/115 (12%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGASDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCI  554
            K+W     +   L T  GH + +    FH     I+S S+D++IR+W+   RT +
Sbjct  230  KIWRMNESKAWELDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_003978283.1| PREDICTED: coatomer subunit alpha-like [Takifugu rubripes]
Length=1222

 Score =   286 bits (731),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH S PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPSMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAVFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_004555248.1| PREDICTED: coatomer subunit alpha-like [Maylandia zebra]
Length=1222

 Score =   286 bits (731),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAIFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_001743343.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ92057.1| predicted protein [Monosiga brevicollis MX1]
Length=1218

 Score =   286 bits (731),  Expect = 7e-86, Method: Composition-based stats.
 Identities = 120/145 (83%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFE+KS RVKG++FH KRPW+LASLH+GV+QL+DYRMGTLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFESKSARVKGVAFHPKRPWVLASLHNGVVQLYDYRMGTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
             SQPLFVSGGDDYKIK+WNYK  RCLFTLLGHLDYIRT  FH E PWI+SASDDQTIRIW
Sbjct  61   PSQPLFVSGGDDYKIKLWNYKTRRCLFTLLGHLDYIRTTFFHKENPWIISASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQ R+CI VLTGHNHYVMCA+FHP
Sbjct  121  NWQGRSCICVLTGHNHYVMCANFHP  145


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 28/98 (29%), Positives = 45/98 (46%), Gaps = 2/98 (2%)
 Frame = +3

Query  318  HDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPW  491
            HD  V    FH + PL VS  DD  +K+W     +   + T  GH + +    FH     
Sbjct  204  HDRGVNWAAFHPTMPLIVSAADDRTVKLWRMNDSKAWEVDTCRGHFNNVSCAIFHPRQEV  263

Query  492  IVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
            I+S ++D++IR+W+ Q R  +      +      + HP
Sbjct  264  ILSNAEDRSIRVWDMQRRAAVQTFRREHDRFWVIAAHP  301



>ref|XP_006792415.1| PREDICTED: coatomer subunit alpha-like [Neolamprologus brichardi]
Length=1222

 Score =   286 bits (731),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAIFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_005729030.1| PREDICTED: coatomer subunit alpha-like isoform X2 [Pundamilia 
nyererei]
Length=1217

 Score =   286 bits (731),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAIFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_005729029.1| PREDICTED: coatomer subunit alpha-like isoform X1 [Pundamilia 
nyererei]
Length=1225

 Score =   285 bits (730),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAIFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_005918171.1| PREDICTED: coatomer subunit alpha-like [Haplochromis burtoni]
Length=1223

 Score =   285 bits (730),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPW+LASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWVLASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIRIW
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +3

Query  309  FDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFTLLGHLDYIRTVQFHHE  482
             + HD  V    FH + PL VSG DD ++K+W     +   L T  GH + +    FH  
Sbjct  201  LEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAWELDTCRGHYNNVSCAIFHPR  260

Query  483  YPWIVSASDDQTIRIWNWQSRTCI  554
               I+S S+D++IR+W+   RT +
Sbjct  261  QELILSNSEDKSIRVWDMSKRTGV  284



>ref|XP_005368658.1| PREDICTED: coatomer subunit alpha [Microtus ochrogaster]
Length=1180

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145



>ref|XP_004210494.1| PREDICTED: coatomer subunit alpha-like, partial [Hydra vulgaris]
Length=559

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGL+FHSKRPW+LASLH+GVIQLWDYRM TL+DRFDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLAFHSKRPWVLASLHNGVIQLWDYRMCTLLDRFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            ++QPLFVSGGDDYKIKVWNYK  +C+FTLLGHLDYIRT  FHHEYPWIVS SDDQTIRIW
Sbjct  61   ENQPLFVSGGDDYKIKVWNYKQKKCIFTLLGHLDYIRTTFFHHEYPWIVSCSDDQTIRIW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFH  602
            NWQSR CI+VLTGHNHYVMCA FH
Sbjct  121  NWQSRNCINVLTGHNHYVMCAQFH  144


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 56/117 (48%), Gaps = 2/117 (2%)
 Frame = +3

Query  261  GVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIKVWNYKLHRC--LFT  434
            G I L+ +    +    + HD  V  V FH + PL VS  DD ++K+W     +   + T
Sbjct  188  GQIDLFGHADAVVKHVLEGHDRGVNWVTFHPTMPLIVSAADDRQVKLWRMNESKAWEVDT  247

Query  435  LLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCISVLTGHNHYVMCASFHP  605
              GH + + +V FH     I+S S+D++IR+W+   RT +      N      + HP
Sbjct  248  CRGHYNNVSSVIFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRENDRYWILAAHP  304


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 67/166 (40%), Gaps = 41/166 (25%)
 Frame = +3

Query  219  FHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFHKSQPLFVSGGDDYKIK  398
            FH + PWI++      I++W+++    I+    H+  V    FHK++   VS   D  ++
Sbjct  101  FHHEYPWIVSCSDDQTIRIWNWQSRNCINVLTGHNHYVMCAQFHKTEDYIVSASLDQTVR  160

Query  399  VWNYKLHRCLFT-------------------LLGHLDYIRT------------VQFHHEY  485
            VW+    R  F                    L GH D +              V FH   
Sbjct  161  VWDISGLRKKFASPGTKDRDDTSVKNPGQIDLFGHADAVVKHVLEGHDRGVNWVTFHPTM  220

Query  486  PWIVSASDDQTIRIWN------WQSRTCISVLTGHNHYVMCASFHP  605
            P IVSA+DD+ +++W       W+  TC     GH + V    FHP
Sbjct  221  PLIVSAADDRQVKLWRMNESKAWEVDTC----RGHYNNVSSVIFHP  262



>ref|XP_008152468.1| PREDICTED: coatomer subunit alpha isoform X2 [Eptesicus fuscus]
Length=1223

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_006001922.1| PREDICTED: coatomer subunit alpha isoform X1 [Latimeria chalumnae]
Length=1232

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+S+SDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSSSDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 66/141 (47%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VLT H +  + A+ H
Sbjct  290  DHDRFWVLTAHTNLNLFAAGH  310



>ref|XP_006096969.1| PREDICTED: coatomer subunit alpha isoform X1 [Myotis lucifugus]
Length=1232

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_006096970.1| PREDICTED: coatomer subunit alpha isoform X2 [Myotis lucifugus]
Length=1223

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_008152467.1| PREDICTED: coatomer subunit alpha isoform X1 [Eptesicus fuscus]
Length=1232

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_004775909.1| PREDICTED: coatomer subunit alpha isoform X1 [Mustela putorius 
furo]
 ref|XP_004819830.1| PREDICTED: coatomer subunit alpha isoform X1 [Mustela putorius 
furo]
Length=1233

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_006267538.1| PREDICTED: coatomer subunit alpha [Alligator mississippiensis]
Length=1224

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_004589141.1| PREDICTED: coatomer subunit alpha isoform X2 [Ochotona princeps]
Length=1224

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_004671175.1| PREDICTED: coatomer subunit alpha isoform X2 [Jaculus jaculus]
Length=1224

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_006999128.1| PREDICTED: LOW QUALITY PROTEIN: coatomer protein complex, subunit 
alpha [Peromyscus maniculatus bairdii]
Length=1133

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_005400264.1| PREDICTED: coatomer subunit alpha isoform X2 [Chinchilla lanigera]
Length=1224

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_005981769.1| PREDICTED: coatomer subunit alpha isoform X2 [Pantholops hodgsonii]
Length=1224

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_004775910.1| PREDICTED: coatomer subunit alpha isoform X2 [Mustela putorius 
furo]
 ref|XP_004819831.1| PREDICTED: coatomer subunit alpha isoform X2 [Mustela putorius 
furo]
Length=1224

 Score =   285 bits (729),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_008056902.1| PREDICTED: coatomer subunit alpha [Tarsius syrichta]
Length=1224

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|NP_004362.2| coatomer subunit alpha isoform 2 [Homo sapiens]
 sp|P53621.2|COPA_HUMAN RecName: Full=Coatomer subunit alpha; AltName: Full=Alpha-coat 
protein; Short=Alpha-COP; AltName: Full=HEP-COP; Short=HEPCOP; 
Contains: RecName: Full=Xenin; AltName: Full=Xenopsin-related 
peptide; Contains: RecName: Full=Proxenin [Homo sapiens]
 gb|EAW52723.1| coatomer protein complex, subunit alpha, isoform CRA_a [Homo 
sapiens]
Length=1224

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_001171574.1| PREDICTED: coatomer subunit alpha isoform X2 [Pan troglodytes]
 ref|XP_003811927.1| PREDICTED: coatomer subunit alpha [Pan paniscus]
Length=1224

 Score =   285 bits (728),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_004442852.1| PREDICTED: coatomer subunit alpha isoform 2 [Ceratotherium simum 
simum]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>sp|Q27954.1|COPA_BOVIN RecName: Full=Coatomer subunit alpha; AltName: Full=Alpha-coat 
protein; Short=Alpha-COP; AltName: Full=HEP-COP; Short=HEPCOP; 
Contains: RecName: Full=Xenin; AltName: Full=Xenopsin-related 
peptide; Contains: RecName: Full=Proxenin [Bos taurus]
 emb|CAA65543.1| alpha-cop protein [Bos primigenius]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_004442851.1| PREDICTED: coatomer subunit alpha isoform 1 [Ceratotherium simum 
simum]
Length=1233

 Score =   285 bits (729),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_003415233.1| PREDICTED: coatomer subunit alpha [Loxodonta africana]
Length=1222

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_010359050.1| PREDICTED: coatomer subunit alpha [Rhinopithecus roxellana]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_007945901.1| PREDICTED: coatomer subunit alpha isoform X2 [Orycteropus afer 
afer]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_002715282.1| PREDICTED: coatomer subunit alpha [Oryctolagus cuniculus]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|NP_001099115.1| coatomer subunit alpha [Bos taurus]
 ref|XP_010845189.1| PREDICTED: coatomer subunit alpha [Bison bison bison]
 gb|AAI53252.1| COPA protein [Bos taurus]
 tpg|DAA31942.1| TPA: coatomer subunit alpha [Bos taurus]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_007129696.1| PREDICTED: coatomer subunit alpha isoform X1 [Physeter catodon]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_006001923.1| PREDICTED: coatomer subunit alpha isoform X2 [Latimeria chalumnae]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWILASLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+S+SDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSSSDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 66/141 (47%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVET-DVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VLT H +  + A+ H
Sbjct  290  DHDRFWVLTAHTNLNLFAAGH  310



>ref|XP_002928486.1| PREDICTED: coatomer subunit alpha [Ailuropoda melanoleuca]
 ref|XP_011234602.1| PREDICTED: coatomer subunit alpha [Ailuropoda melanoleuca]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_005981768.1| PREDICTED: coatomer subunit alpha isoform X1 [Pantholops hodgsonii]
Length=1233

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_008698915.1| PREDICTED: coatomer subunit alpha isoform X1 [Ursus maritimus]
 ref|XP_008698916.1| PREDICTED: coatomer subunit alpha isoform X1 [Ursus maritimus]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_006060555.1| PREDICTED: coatomer subunit alpha isoform X2 [Bubalus bubalis]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_009240111.1| PREDICTED: coatomer subunit alpha isoform X1 [Pongo abelii]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_008518689.1| PREDICTED: coatomer subunit alpha isoform X2 [Equus przewalskii]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



>ref|XP_007974683.1| PREDICTED: coatomer subunit alpha isoform X2 [Chlorocebus sabaeus]
Length=1224

 Score =   285 bits (728),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  171  MLTKFETKSNRVKGLSFHSKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH  350
            MLTKFETKS RVKGLSFH KRPWIL SLH+GVIQLWDYRM TLID+FDEHDGPVRG+ FH
Sbjct  1    MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH  60

Query  351  KSQPLFVSGGDDYKIKVWNYKLHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW  530
            K QPLFVSGGDDYKIKVWNYKL RCLFTLLGHLDYIRT  FHHEYPWI+SASDDQTIR+W
Sbjct  61   KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW  120

Query  531  NWQSRTCISVLTGHNHYVMCASFHP  605
            NWQSRTC+ VLTGHNHYVMCA FHP
Sbjct  121  NWQSRTCVCVLTGHNHYVMCAQFHP  145


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = +3

Query  249  SLHSGVIQLWDYRMGTLIDRFDEHDGPV--------RGVH---FHKSQPLFVSGGDDYKI  395
            +L  G ++  D R  T +D F   D  V        RGV+   FH + PL VSG DD ++
Sbjct  171  NLSPGAVE-SDVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQV  229

Query  396  KVWNYKLHRC--LFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIWNWQSRTCIS----  557
            K+W     +   + T  GH + +    FH     I+S S+D++IR+W+   RT +     
Sbjct  230  KIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRR  289

Query  558  ------VLTGHNHYVMCASFH  602
                  VL  H +  + A+ H
Sbjct  290  DHDRFWVLAAHPNLNLFAAGH  310



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370