BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS135D10

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFQ00710.1|  pyrophosphate-energized vacuolar membrane proteon...    296   5e-92   Ipomoea batatas [batate]
gb|KJB23659.1|  hypothetical protein B456_004G108700                    282   6e-87   Gossypium raimondii
ref|XP_009779977.1|  PREDICTED: pyrophosphate-energized vacuolar ...    283   7e-87   Nicotiana sylvestris
ref|XP_009598387.1|  PREDICTED: pyrophosphate-energized vacuolar ...    283   7e-87   Nicotiana tomentosiformis
emb|CAA58700.1|  inorganic pyrophosphatase                              283   8e-87   Nicotiana tabacum [American tobacco]
ref|XP_010323159.1|  PREDICTED: vacuolar-type H+-pyrophosphatase ...    283   1e-86   
gb|KJB23657.1|  hypothetical protein B456_004G108700                    282   2e-86   Gossypium raimondii
gb|KHG19866.1|  Pyrophosphate-energized vacuolar membrane proton ...    281   3e-86   Gossypium arboreum [tree cotton]
ref|XP_007013601.1|  Inorganic H pyrophosphatase family protein i...    278   2e-85   
ref|XP_011084078.1|  PREDICTED: pyrophosphate-energized vacuolar ...    280   2e-85   
ref|NP_001265905.1|  vacuolar-type H+-pyrophosphatase                   279   3e-85   
ref|XP_006359496.1|  PREDICTED: pyrophosphate-energized vacuolar ...    279   3e-85   Solanum tuberosum [potatoes]
ref|XP_007013600.1|  Inorganic H pyrophosphatase family protein i...    278   5e-85   
gb|KJB53982.1|  hypothetical protein B456_009G014500                    273   7e-85   Gossypium raimondii
gb|KHN15033.1|  Pyrophosphate-energized vacuolar membrane proton ...    276   1e-84   Glycine soja [wild soybean]
ref|XP_007155080.1|  hypothetical protein PHAVU_003G171500g             277   1e-84   Phaseolus vulgaris [French bean]
ref|XP_009595111.1|  PREDICTED: pyrophosphate-energized vacuolar ...    276   3e-84   Nicotiana tomentosiformis
ref|XP_004251737.1|  PREDICTED: pyrophosphate-energized vacuolar ...    276   3e-84   Solanum lycopersicum
ref|XP_003542656.1|  PREDICTED: pyrophosphate-energized vacuolar ...    276   4e-84   Glycine max [soybeans]
ref|XP_010097004.1|  Pyrophosphate-energized vacuolar membrane pr...    275   6e-84   Morus notabilis
ref|XP_011017877.1|  PREDICTED: pyrophosphate-energized vacuolar ...    275   6e-84   Populus euphratica
ref|XP_006350116.1|  PREDICTED: pyrophosphate-energized vacuolar ...    275   8e-84   Solanum tuberosum [potatoes]
gb|KDP30223.1|  hypothetical protein JCGZ_17005                         275   9e-84   Jatropha curcas
gb|ABF85694.1|  inorganic pyrophosphatase                               275   1e-83   Nicotiana rustica [wild tobacco]
ref|XP_003609464.1|  Vacuolar proton-inorganic pyrophosphatase          274   1e-83   
gb|KJB53981.1|  hypothetical protein B456_009G014500                    275   1e-83   Gossypium raimondii
ref|XP_009628297.1|  PREDICTED: pyrophosphate-energized vacuolar ...    275   1e-83   Nicotiana tomentosiformis
ref|XP_007204643.1|  hypothetical protein PRUPE_ppa001782mg             274   1e-83   Prunus persica
ref|XP_006381091.1|  Pyrophosphate-energized vacuolar membrane pr...    274   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_008242846.1|  PREDICTED: pyrophosphate-energized vacuolar ...    274   2e-83   
ref|XP_009796113.1|  PREDICTED: pyrophosphate-energized vacuolar ...    274   2e-83   Nicotiana sylvestris
ref|XP_006389422.1|  Pyrophosphate-energized vacuolar membrane pr...    274   2e-83   Populus trichocarpa [western balsam poplar]
gb|KJB83229.1|  hypothetical protein B456_013G236400                    274   2e-83   Gossypium raimondii
ref|XP_004508424.1|  PREDICTED: pyrophosphate-energized vacuolar ...    274   2e-83   Cicer arietinum [garbanzo]
gb|KHG04918.1|  Pyrophosphate-energized vacuolar membrane proton ...    274   2e-83   Gossypium arboreum [tree cotton]
emb|CDP10479.1|  unnamed protein product                                274   2e-83   Coffea canephora [robusta coffee]
gb|KJB83230.1|  hypothetical protein B456_013G236400                    274   3e-83   Gossypium raimondii
emb|CAA58701.1|  inorganic pyrophosphatase                              273   3e-83   Nicotiana tabacum [American tobacco]
ref|XP_003609463.1|  Vacuolar proton-inorganic pyrophosphatase          273   3e-83   Medicago truncatula
ref|XP_010250265.1|  PREDICTED: pyrophosphate-energized vacuolar ...    272   1e-82   Nelumbo nucifera [Indian lotus]
gb|AHA38114.1|  vacuolar H+-pyrophosphatase                             272   1e-82   Sesuvium portulacastrum [sea-purslane]
ref|XP_011078537.1|  PREDICTED: pyrophosphate-energized vacuolar ...    272   1e-82   Sesamum indicum [beniseed]
dbj|BAA23649.1|  proton pyrophosphatase                                 272   1e-82   Vigna radiata [mung bean]
ref|XP_006474386.1|  PREDICTED: pyrophosphate-energized vacuolar ...    270   1e-82   
sp|P21616.4|AVP_VIGRR  RecName: Full=Pyrophosphate-energized vacu...    271   2e-82   Vigna radiata var. radiata [golden gram]
gb|AAC49175.1|  pyrophosphatase                                         271   2e-82   Vigna radiata [mung bean]
ref|XP_009791988.1|  PREDICTED: pyrophosphate-energized vacuolar ...    271   2e-82   Nicotiana sylvestris
ref|XP_009363953.1|  PREDICTED: pyrophosphate-energized vacuolar ...    271   3e-82   Pyrus x bretschneideri [bai li]
ref|XP_011020230.1|  PREDICTED: pyrophosphate-energized vacuolar ...    271   3e-82   Populus euphratica
ref|XP_011073387.1|  PREDICTED: pyrophosphate-energized vacuolar ...    271   4e-82   Sesamum indicum [beniseed]
ref|XP_011081989.1|  PREDICTED: pyrophosphate-energized vacuolar ...    270   4e-82   Sesamum indicum [beniseed]
gb|KHF98453.1|  Pyrophosphate-energized vacuolar membrane proton ...    270   4e-82   Gossypium arboreum [tree cotton]
ref|XP_006453118.1|  hypothetical protein CICLE_v10007524mg             270   5e-82   Citrus clementina [clementine]
dbj|BAA33149.1|  proton-translocating inorganic pyrophosphatase         270   7e-82   Cucurbita moschata [ayote]
ref|XP_010097186.1|  Pyrophosphate-energized vacuolar membrane pr...    269   1e-81   Morus notabilis
gb|KDO73437.1|  hypothetical protein CISIN_1g004159mg                   268   2e-81   Citrus sinensis [apfelsine]
ref|XP_004173355.1|  PREDICTED: pyrophosphate-energized vacuolar ...    263   2e-81   
emb|CDO98179.1|  unnamed protein product                                268   3e-81   Coffea canephora [robusta coffee]
gb|KJB64658.1|  hypothetical protein B456_010G059800                    263   3e-81   Gossypium raimondii
ref|XP_010244912.1|  PREDICTED: pyrophosphate-energized vacuolar ...    268   4e-81   Nelumbo nucifera [Indian lotus]
gb|KDO73436.1|  hypothetical protein CISIN_1g004159mg                   268   5e-81   Citrus sinensis [apfelsine]
ref|XP_006341399.1|  PREDICTED: pyrophosphate-energized vacuolar ...    268   5e-81   Solanum tuberosum [potatoes]
gb|KJB56582.1|  hypothetical protein B456_009G126900                    266   6e-81   Gossypium raimondii
ref|XP_009593516.1|  PREDICTED: pyrophosphate-energized vacuolar ...    268   6e-81   Nicotiana tomentosiformis
gb|KJB56580.1|  hypothetical protein B456_009G126900                    267   8e-81   Gossypium raimondii
gb|ADN96173.1|  pyrophosphate-energized vacuolar membrane proton ...    267   8e-81   Gossypium hirsutum [American cotton]
ref|XP_010928300.1|  PREDICTED: pyrophosphate-energized vacuolar ...    266   2e-80   Elaeis guineensis
ref|XP_003531725.1|  PREDICTED: pyrophosphate-energized vacuolar ...    266   2e-80   Glycine max [soybeans]
ref|XP_009358552.1|  PREDICTED: pyrophosphate-energized vacuolar ...    266   2e-80   Pyrus x bretschneideri [bai li]
ref|XP_010913343.1|  PREDICTED: pyrophosphate-energized vacuolar ...    266   3e-80   Elaeis guineensis
ref|XP_007023298.1|  Inorganic H pyrophosphatase family protein i...    266   3e-80   
ref|XP_007023297.1|  Inorganic H pyrophosphatase family protein i...    265   3e-80   
gb|KJB35139.1|  hypothetical protein B456_006G102100                    265   4e-80   Gossypium raimondii
gb|EYU40132.1|  hypothetical protein MIMGU_mgv1a001763mg                265   4e-80   Erythranthe guttata [common monkey flower]
ref|XP_004241690.1|  PREDICTED: pyrophosphate-energized vacuolar ...    265   4e-80   Solanum lycopersicum
gb|KDP37047.1|  hypothetical protein JCGZ_06103                         265   7e-80   Jatropha curcas
ref|XP_003528302.1|  PREDICTED: pyrophosphate-energized vacuolar ...    265   8e-80   Glycine max [soybeans]
gb|KHG25943.1|  Pyrophosphate-energized vacuolar membrane proton ...    265   8e-80   Gossypium arboreum [tree cotton]
gb|KJB64656.1|  hypothetical protein B456_010G059800                    263   1e-79   Gossypium raimondii
ref|XP_004235902.1|  PREDICTED: pyrophosphate-energized vacuolar ...    264   1e-79   
ref|XP_006427442.1|  hypothetical protein CICLE_v10024946mg             262   1e-79   
ref|XP_008343930.1|  PREDICTED: pyrophosphate-energized vacuolar ...    264   1e-79   
emb|CAA54869.1|  inorganic pyrophosphatase                              264   1e-79   Nicotiana tabacum [American tobacco]
ref|XP_009765177.1|  PREDICTED: pyrophosphate-energized vacuolar ...    264   1e-79   Nicotiana sylvestris
ref|XP_004287260.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    264   2e-79   Fragaria vesca subsp. vesca
gb|AAM97920.1|  vacuolar proton-pumping PPase                           263   2e-79   Oxybasis rubra [pigweed]
gb|AAS66771.1|  PPase                                                   264   2e-79   Hevea brasiliensis [jebe]
ref|XP_008352108.1|  PREDICTED: pyrophosphate-energized vacuolar ...    263   2e-79   
ref|XP_004150506.1|  PREDICTED: pyrophosphate-energized vacuolar ...    263   2e-79   
gb|ABK91685.1|  vacuolar H+-pyrophosphatase                             263   2e-79   Kalidium foliatum
gb|KJB64657.1|  hypothetical protein B456_010G059800                    263   2e-79   Gossypium raimondii
gb|KJB64655.1|  hypothetical protein B456_010G059800                    263   3e-79   Gossypium raimondii
ref|XP_008443926.1|  PREDICTED: pyrophosphate-energized vacuolar ...    263   3e-79   Cucumis melo [Oriental melon]
gb|AEI17665.1|  vacuolar H+-pyrophosphatase                             263   3e-79   Salicornia europaea [chicken-claws]
ref|XP_006427443.1|  hypothetical protein CICLE_v10024946mg             262   4e-79   
ref|XP_009392139.1|  PREDICTED: pyrophosphate-energized vacuolar ...    262   5e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006427441.1|  hypothetical protein CICLE_v10024946mg             262   6e-79   Citrus clementina [clementine]
gb|ADD51840.1|  pyrophosphatase                                         262   6e-79   Cucumis sativus [cucumbers]
ref|XP_008788803.1|  PREDICTED: pyrophosphate-energized vacuolar ...    262   8e-79   Phoenix dactylifera
gb|KHN38003.1|  Pyrophosphate-energized vacuolar membrane proton ...    261   8e-79   Glycine soja [wild soybean]
gb|AGQ50316.1|  vaculoar H+ pyrophosphatase                             261   1e-78   Prosopis juliflora [algorrobo]
gb|EYU34952.1|  hypothetical protein MIMGU_mgv1a001747mg                261   1e-78   Erythranthe guttata [common monkey flower]
ref|XP_006492091.1|  PREDICTED: pyrophosphate-energized vacuolar ...    261   1e-78   Citrus sinensis [apfelsine]
ref|XP_008795832.1|  PREDICTED: pyrophosphate-energized vacuolar ...    261   2e-78   Phoenix dactylifera
ref|XP_010050115.1|  PREDICTED: pyrophosphate-energized vacuolar ...    261   2e-78   Eucalyptus grandis [rose gum]
ref|XP_009403196.1|  PREDICTED: pyrophosphate-energized vacuolar ...    260   2e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927355.1|  PREDICTED: pyrophosphate-energized vacuolar ...    260   3e-78   Elaeis guineensis
ref|XP_008801902.1|  PREDICTED: pyrophosphate-energized vacuolar ...    260   3e-78   Phoenix dactylifera
ref|XP_002530755.1|  Pyrophosphate-energized vacuolar membrane pr...    260   3e-78   Ricinus communis
ref|XP_009418179.1|  PREDICTED: pyrophosphate-energized vacuolar ...    259   5e-78   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABS01290.1|  tonoplast proton pump                                   259   6e-78   Lotus corniculatus
ref|XP_010687850.1|  PREDICTED: pyrophosphate-energized vacuolar ...    259   7e-78   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS68114.1|  inorganic pyrophosphatase                               259   7e-78   Genlisea aurea
ref|XP_010905999.1|  PREDICTED: pyrophosphate-energized vacuolar ...    259   1e-77   Elaeis guineensis
gb|AAA61610.1|  pyrophosphatase                                         258   1e-77   Beta vulgaris [beet]
ref|XP_009407207.1|  PREDICTED: pyrophosphate-energized vacuolar ...    258   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002273207.1|  PREDICTED: pyrophosphate-energized vacuolar ...    257   4e-77   Vitis vinifera
gb|ABO45933.1|  vacuolar H+-pyrophosphatase                             257   5e-77   Halostachys caspica
gb|ADQ00196.1|  vacuolar H+-PPase protein                               257   5e-77   Suaeda corniculata
gb|AGJ81362.1|  vacuolar H+ pyrophosphatase 1                           256   1e-76   Brassica napus [oilseed rape]
ref|XP_002453419.1|  hypothetical protein SORBIDRAFT_04g005710          256   1e-76   Sorghum bicolor [broomcorn]
ref|XP_008793954.1|  PREDICTED: pyrophosphate-energized vacuolar ...    255   3e-76   Phoenix dactylifera
ref|XP_009401376.1|  PREDICTED: pyrophosphate-energized vacuolar ...    254   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD98735.1|  vacuolar H+-pyrophosphatase                             254   4e-76   Oxybasis glauca [oakleaf goosefoot]
ref|XP_009117814.1|  PREDICTED: pyrophosphate-energized vacuolar ...    254   5e-76   Brassica rapa
ref|XP_010691127.1|  PREDICTED: pyrophosphate-energized vacuolar ...    254   7e-76   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY53310.1|  BnaA09g56670D                                          254   1e-75   Brassica napus [oilseed rape]
ref|XP_006852851.1|  hypothetical protein AMTR_s00033p00195690          253   1e-75   Amborella trichopoda
ref|XP_009385121.1|  PREDICTED: pyrophosphate-energized vacuolar ...    253   1e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410369.1|  PREDICTED: pyrophosphate-energized vacuolar ...    253   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX87313.1|  BnaA07g35600D                                          252   3e-75   
ref|XP_010557616.1|  PREDICTED: pyrophosphate-energized vacuolar ...    252   3e-75   Tarenaya hassleriana [spider flower]
gb|AFW66266.1|  hypothetical protein ZEAMMB73_353171                    252   4e-75   
gb|EYU24628.1|  hypothetical protein MIMGU_mgv1a001756mg                251   5e-75   Erythranthe guttata [common monkey flower]
gb|ADJ67258.1|  vaculor H+-pyrophosphatase                              251   7e-75   Sorghum bicolor [broomcorn]
ref|XP_010541940.1|  PREDICTED: pyrophosphate-energized vacuolar ...    251   8e-75   Tarenaya hassleriana [spider flower]
emb|CDY33390.1|  BnaC05g11930D                                          251   8e-75   Brassica napus [oilseed rape]
ref|NP_001288927.1|  uncharacterized protein LOC103832483               251   9e-75   Brassica rapa
ref|XP_008679906.1|  PREDICTED: pyrophosphate-energized vacuolar ...    252   1e-74   
emb|CAN65456.1|  hypothetical protein VITISV_035221                     250   1e-74   Vitis vinifera
emb|CBI25554.3|  unnamed protein product                                250   1e-74   Vitis vinifera
ref|NP_001266772.1|  uncharacterized protein LOC101027208               250   2e-74   Zea mays [maize]
ref|XP_006300952.1|  hypothetical protein CARUB_v10021340mg             250   2e-74   
gb|AFW70478.1|  vacuolar H+-translocating inorganic pyrophosphatase     250   2e-74   
ref|XP_002438225.1|  hypothetical protein SORBIDRAFT_10g009880          250   2e-74   Sorghum bicolor [broomcorn]
gb|ACT98610.2|  vacuolar proton-inorganic pyrophosphatase               250   2e-74   Diplachne fusca
gb|EYU21676.1|  hypothetical protein MIMGU_mgv1a001720mg                250   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_004951662.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   3e-74   Setaria italica
ref|XP_010417704.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   3e-74   Camelina sativa [gold-of-pleasure]
emb|CDY39975.1|  BnaC06g40530D                                          249   3e-74   Brassica napus [oilseed rape]
ref|XP_010539519.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   3e-74   Tarenaya hassleriana [spider flower]
emb|CDX81728.1|  BnaC08g38730D                                          253   3e-74   
ref|XP_010537929.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   4e-74   Tarenaya hassleriana [spider flower]
ref|XP_010429951.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   4e-74   Camelina sativa [gold-of-pleasure]
ref|XP_004951661.1|  PREDICTED: pyrophosphate-energized vacuolar ...    249   6e-74   
ref|NP_001288904.1|  uncharacterized protein LOC103836019               249   6e-74   Brassica rapa
emb|CDY36581.1|  BnaA06g10340D                                          249   7e-74   Brassica napus [oilseed rape]
gb|EAY84762.1|  hypothetical protein OsI_06130                          236   8e-74   Oryza sativa Indica Group [Indian rice]
ref|NP_001077542.1|  Pyrophosphate-energized vacuolar membrane pr...    246   9e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AFW77130.1|  hypothetical protein ZEAMMB73_840165                    249   9e-74   
ref|NP_001268155.1|  vacuolar pyrophosphatase                           248   1e-73   Vitis vinifera
gb|AET95912.1|  PHP1                                                    248   1e-73   Lagenaria siceraria [bottle gourd]
ref|XP_006646987.1|  PREDICTED: pyrophosphate-energized vacuolar ...    248   2e-73   Oryza brachyantha
gb|KFK43817.1|  hypothetical protein AALP_AA1G177100                    247   3e-73   Arabis alpina [alpine rockcress]
ref|XP_010472923.1|  PREDICTED: pyrophosphate-energized vacuolar ...    246   5e-73   Camelina sativa [gold-of-pleasure]
gb|ABR18024.1|  unknown                                                 246   7e-73   Picea sitchensis
gb|KFK42469.1|  hypothetical protein AALP_AA2G261100                    245   1e-72   Arabis alpina [alpine rockcress]
ref|XP_007217159.1|  hypothetical protein PRUPE_ppa001776mg             245   1e-72   Prunus persica
gb|AAL57660.1|  At1g15690/F7H2_3                                        245   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173021.1|  Pyrophosphate-energized vacuolar membrane proto...    245   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890120.1|  vacuolar-type H+-pumping pyrophosphatase 1         245   1e-72   Arabidopsis lyrata subsp. lyrata
gb|AAL84953.1|  At1g15690/F7H2_3                                        245   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148959.1|  PREDICTED: pyrophosphate-energized vacuolar ...    245   1e-72   Brassica rapa
emb|CDX96835.1|  BnaA08g23780D                                          245   2e-72   
ref|XP_009334631.1|  PREDICTED: pyrophosphate-energized vacuolar ...    244   2e-72   Pyrus x bretschneideri [bai li]
dbj|BAE98517.1|  hypothetical protein                                   244   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389797.1|  hypothetical protein EUTSA_v10018163mg             244   5e-72   Eutrema salsugineum [saltwater cress]
ref|XP_003564217.1|  PREDICTED: pyrophosphate-energized vacuolar ...    243   6e-72   Brachypodium distachyon [annual false brome]
ref|XP_006306837.1|  hypothetical protein CARUB_v10008378mg             243   6e-72   Capsella rubella
gb|AIS71988.1|  vacuolar pyrophosphatase 1                              243   7e-72   Haloxylon ammodendron
ref|XP_008228676.1|  PREDICTED: pyrophosphate-energized vacuolar ...    243   7e-72   Prunus mume [ume]
ref|XP_010476656.1|  PREDICTED: pyrophosphate-energized vacuolar ...    243   9e-72   Camelina sativa [gold-of-pleasure]
ref|XP_004965753.1|  PREDICTED: pyrophosphate-energized vacuolar ...    243   9e-72   Setaria italica
emb|CAG29370.1|  vacuolar H+-translocating inorganic pyrophosphatase    243   9e-72   Zea mays [maize]
ref|XP_004303283.1|  PREDICTED: pyrophosphate-energized vacuolar ...    243   1e-71   Fragaria vesca subsp. vesca
ref|XP_006656294.1|  PREDICTED: pyrophosphate-energized vacuolar ...    243   1e-71   Oryza brachyantha
ref|XP_010459106.1|  PREDICTED: pyrophosphate-energized vacuolar ...    243   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010497310.1|  PREDICTED: pyrophosphate-energized vacuolar ...    242   1e-71   Camelina sativa [gold-of-pleasure]
gb|AJR29310.1|  H+-pyrophosphatase                                      242   2e-71   Secale cereale
gb|AAL11506.1|AF367446_1  vacuolar H+-pyrophosphatase                   241   3e-71   Prunus persica
gb|AEI17666.1|  vacuolar H+-pyrophosphatase                             241   4e-71   Salicornia europaea [chicken-claws]
dbj|BAA32210.1|  Vacuolar proton pyrophosphatase                        241   4e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ91598.1|  predicted protein                                      241   6e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010033979.1|  PREDICTED: pyrophosphate-energized vacuolar ...    241   7e-71   Eucalyptus grandis [rose gum]
ref|XP_009336318.1|  PREDICTED: pyrophosphate-energized vacuolar ...    240   7e-71   Pyrus x bretschneideri [bai li]
ref|XP_009338516.1|  PREDICTED: pyrophosphate-energized vacuolar ...    240   8e-71   Pyrus x bretschneideri [bai li]
ref|XP_006648065.1|  PREDICTED: pyrophosphate-energized vacuolar ...    240   8e-71   Oryza brachyantha
gb|EMT29715.1|  Pyrophosphate-energized vacuolar membrane proton ...    240   1e-70   
gb|AAP55210.1|  vacuolar proton-inorganic pyrophosphatase               239   1e-70   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105380.1|  vacuolar proton pump homolog1                      239   3e-70   
ref|XP_008372806.1|  PREDICTED: pyrophosphate-energized vacuolar ...    242   3e-70   
dbj|BAB18681.1|  vacuolar proton-inorganic pyrophosphatase              239   3e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA61609.1|  pyrophosphatase                                         238   5e-70   Beta vulgaris [beet]
gb|AHZ97880.1|  vacuolar H+-pyrophosphatase                             238   1e-69   Olimarabidopsis pumila
gb|ACA63883.1|  vacuolar proton-inorganic pyrophosphatase               237   1e-69   Hordeum vulgare [barley]
sp|Q06572.2|AVP_HORVU  RecName: Full=Pyrophosphate-energized vacu...    237   1e-69   Hordeum vulgare [barley]
dbj|BAJ88084.1|  predicted protein                                      237   1e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04633.1|  predicted protein                                      236   1e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954254.1|  PREDICTED: pyrophosphate-energized vacuolar ...    236   2e-69   Setaria italica
dbj|BAD25066.1|  putative inorganic diphosphatase                       236   2e-69   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD02277.1|  vacuolar proton pyrophosphatase                        236   3e-69   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058184.1|  Os06g0644200                                       235   7e-69   
dbj|BAA31523.1|  ovp1                                                   235   8e-69   Oryza sativa [red rice]
dbj|BAA08232.1|  vacuolar H+-pyrophosphatase                            235   8e-69   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01854.1|  hypothetical protein OsI_23875                          234   1e-68   Oryza sativa Indica Group [Indian rice]
emb|CDX83972.1|  BnaC08g16730D                                          231   2e-67   
ref|XP_006416887.1|  hypothetical protein EUTSA_v10006869mg             231   3e-67   Eutrema salsugineum [saltwater cress]
gb|AAR08913.2|  pyrophosphate-energized vacuolar membrane proton ...    231   3e-67   Eutrema salsugineum [saltwater cress]
gb|EEE66103.1|  hypothetical protein OsJ_22136                          231   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454723.1|  hypothetical protein SORBIDRAFT_04g036230          230   4e-67   Sorghum bicolor [broomcorn]
gb|EMS65629.1|  Pyrophosphate-energized vacuolar membrane proton ...    229   1e-66   Triticum urartu
gb|AAP06752.1|  vacuolar proton-inorganic pyrophosphatase               228   2e-66   Hordeum brevisubulatum
ref|XP_004964695.1|  PREDICTED: pyrophosphate-energized vacuolar ...    228   3e-66   Setaria italica
gb|ABX10014.1|  vacuolar H+-pyrophosphatase                             227   7e-66   Triticum aestivum [Canadian hard winter wheat]
gb|EAZ24976.1|  hypothetical protein OsJ_08754                          224   6e-65   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048422.1|  Os02g0802500                                       224   7e-65   
emb|CAF18416.1|  proton translocating pyrophosphatase                   224   7e-65   Oryza sativa [red rice]
gb|AGT16998.1|  diphosphatase                                           224   1e-64   Saccharum hybrid cultivar R570
gb|AGT15917.1|  vacuolar H+-pyrophosphatase                             223   2e-64   Saccharum hybrid cultivar R570
gb|AGT16227.1|  vacuolar proton pyrophosphatase                         223   2e-64   Saccharum hybrid cultivar R570
dbj|BAF63470.1|  vacuolar proton-pyrophosphatase                        223   3e-64   Potamogeton distinctus
ref|XP_006841407.1|  hypothetical protein AMTR_s00003p00014700          222   4e-64   Amborella trichopoda
ref|XP_006656699.1|  PREDICTED: pyrophosphate-energized vacuolar ...    220   2e-63   
ref|NP_001146732.1|  uncharacterized protein LOC100280334               219   3e-63   Zea mays [maize]
ref|XP_010042849.1|  PREDICTED: pyrophosphate-energized vacuolar ...    209   8e-63   Eucalyptus grandis [rose gum]
ref|XP_003563306.1|  PREDICTED: pyrophosphate-energized vacuolar ...    218   1e-62   
gb|AFW85592.1|  vacuolar proton pump-like protein                       218   2e-62   
ref|XP_002437341.1|  hypothetical protein SORBIDRAFT_10g025280          217   3e-62   
ref|XP_010039554.1|  PREDICTED: pyrophosphate-energized vacuolar ...    213   1e-60   Eucalyptus grandis [rose gum]
gb|KCW45902.1|  hypothetical protein EUGRSUZ_L00271                     213   1e-60   Eucalyptus grandis [rose gum]
ref|NP_001056966.1|  Os06g0178900                                       211   4e-60   
gb|ACN40474.1|  unknown                                                 209   2e-59   Picea sitchensis
gb|ABR16052.1|  unknown                                                 209   2e-59   Picea sitchensis
ref|XP_007031139.1|  Inorganic H pyrophosphatase family protein i...    203   2e-58   
ref|XP_011023767.1|  PREDICTED: pyrophosphate-energized vacuolar ...    206   2e-58   Populus euphratica
emb|CBI39586.3|  unnamed protein product                                205   4e-58   Vitis vinifera
ref|XP_010259323.1|  PREDICTED: pyrophosphate-energized vacuolar ...    205   5e-58   Nelumbo nucifera [Indian lotus]
ref|XP_002318956.1|  inorganic pyrophosphatase family protein           205   6e-58   Populus trichocarpa [western balsam poplar]
ref|NP_001268072.1|  H+-pyrophosphatase                                 204   1e-57   Vitis vinifera
gb|KJB26321.1|  hypothetical protein B456_004G237000                    203   1e-57   Gossypium raimondii
gb|KJB26322.1|  hypothetical protein B456_004G237000                    203   1e-57   Gossypium raimondii
gb|KJB26320.1|  hypothetical protein B456_004G237000                    203   2e-57   Gossypium raimondii
gb|KHG22725.1|  Pyrophosphate-energized vacuolar membrane proton ...    203   3e-57   Gossypium arboreum [tree cotton]
ref|XP_007031138.1|  Inorganic H pyrophosphatase family protein i...    203   3e-57   
ref|XP_003555808.1|  PREDICTED: pyrophosphate-energized vacuolar ...    202   6e-57   Glycine max [soybeans]
ref|XP_006382405.1|  inorganic pyrophosphatase family protein           201   2e-56   
ref|XP_004302243.1|  PREDICTED: pyrophosphate-energized vacuolar ...    200   4e-56   Fragaria vesca subsp. vesca
ref|XP_009630145.1|  PREDICTED: pyrophosphate-energized vacuolar ...    198   1e-55   Nicotiana tomentosiformis
ref|XP_009630144.1|  PREDICTED: pyrophosphate-energized vacuolar ...    198   2e-55   Nicotiana tomentosiformis
ref|XP_008797457.1|  PREDICTED: pyrophosphate-energized vacuolar ...    198   2e-55   Phoenix dactylifera
ref|XP_004230300.1|  PREDICTED: pyrophosphate-energized vacuolar ...    197   4e-55   Solanum lycopersicum
ref|XP_002512502.1|  Pyrophosphate-energized vacuolar membrane pr...    197   5e-55   Ricinus communis
emb|CDP18241.1|  unnamed protein product                                197   6e-55   Coffea canephora [robusta coffee]
ref|XP_006344755.1|  PREDICTED: pyrophosphate-energized vacuolar ...    196   7e-55   Solanum tuberosum [potatoes]
ref|XP_006605822.1|  PREDICTED: pyrophosphate-energized vacuolar ...    196   1e-54   
gb|KDP23377.1|  hypothetical protein JCGZ_23210                         195   2e-54   Jatropha curcas
ref|XP_009763192.1|  PREDICTED: pyrophosphate-energized vacuolar ...    194   3e-54   Nicotiana sylvestris
gb|KCW60551.1|  hypothetical protein EUGRSUZ_H03285                     192   3e-54   Eucalyptus grandis [rose gum]
ref|XP_008359855.1|  PREDICTED: pyrophosphate-energized vacuolar ...    194   5e-54   Malus domestica [apple tree]
ref|XP_009373278.1|  PREDICTED: pyrophosphate-energized vacuolar ...    192   2e-53   Pyrus x bretschneideri [bai li]
gb|KCW60550.1|  hypothetical protein EUGRSUZ_H03285                     192   2e-53   Eucalyptus grandis [rose gum]
ref|XP_010024124.1|  PREDICTED: pyrophosphate-energized vacuolar ...    192   2e-53   Eucalyptus grandis [rose gum]
ref|XP_008453661.1|  PREDICTED: pyrophosphate-energized vacuolar ...    192   3e-53   Cucumis melo [Oriental melon]
ref|XP_004144756.1|  PREDICTED: pyrophosphate-energized vacuolar ...    192   3e-53   Cucumis sativus [cucumbers]
ref|XP_010093840.1|  Pyrophosphate-energized vacuolar membrane pr...    191   4e-53   Morus notabilis
ref|XP_010931754.1|  PREDICTED: pyrophosphate-energized vacuolar ...    189   3e-52   Elaeis guineensis
ref|XP_008370385.1|  PREDICTED: pyrophosphate-energized vacuolar ...    187   2e-51   
gb|ABK62847.1|  vacuolar H+-PPase                                       187   2e-51   Malus domestica [apple tree]
ref|XP_011036944.1|  PREDICTED: pyrophosphate-energized vacuolar ...    186   4e-51   Populus euphratica
ref|XP_008245918.1|  PREDICTED: pyrophosphate-energized vacuolar ...    185   9e-51   
ref|XP_007208066.1|  hypothetical protein PRUPE_ppa001833mg             184   1e-50   
gb|AAL11507.1|AF367447_1  vacuolar H+-pyrophosphatase                   184   2e-50   
gb|ABU92563.1|  vacuolar H+-pyrophosphatase                             182   6e-50   
dbj|BAK06237.1|  predicted protein                                      181   2e-49   
ref|XP_009412123.1|  PREDICTED: pyrophosphate-energized vacuolar ...    181   3e-49   
ref|XP_008363051.1|  PREDICTED: uncharacterized protein LOC103426749    179   3e-48   
ref|XP_002967265.1|  hypothetical protein SELMODRAFT_270614             177   6e-48   
ref|XP_002960455.1|  hypothetical protein SELMODRAFT_270204             177   6e-48   
ref|XP_008655899.1|  PREDICTED: pyrophosphate-energized vacuolar ...    173   1e-46   
ref|XP_008655898.1|  PREDICTED: pyrophosphate-energized vacuolar ...    173   1e-46   
gb|AFW80727.1|  hypothetical protein ZEAMMB73_205029                    173   2e-46   
emb|CDY61273.1|  BnaA06g38620D                                          170   7e-46   
ref|XP_006433525.1|  hypothetical protein CICLE_v10003214mg             162   1e-45   
dbj|BAJ93792.1|  predicted protein                                      170   2e-45   
ref|XP_004968691.1|  PREDICTED: pyrophosphate-energized vacuolar ...    169   4e-45   
ref|XP_003567657.1|  PREDICTED: pyrophosphate-energized vacuolar ...    166   4e-44   
ref|NP_001152459.1|  pyrophosphate-energized vacuolar membrane pr...    164   2e-43   
gb|AFW77254.1|  pyrophosphate-energized vacuolar membrane proton ...    164   3e-43   
gb|KDO81692.1|  hypothetical protein CISIN_1g040141mg                   162   4e-43   
gb|KHN16066.1|  Pyrophosphate-energized vacuolar membrane proton ...    162   7e-43   
gb|KCW81670.1|  hypothetical protein EUGRSUZ_C03032                     161   1e-42   
ref|XP_010051274.1|  PREDICTED: pyrophosphate-energized vacuolar ...    161   2e-42   
ref|XP_001782955.1|  predicted protein                                  159   2e-42   
ref|NP_001042938.1|  Os01g0337500                                       160   5e-42   
ref|XP_001785133.1|  predicted protein                                  154   1e-41   
ref|XP_001785132.1|  predicted protein                                  157   7e-41   
gb|KCW81665.1|  hypothetical protein EUGRSUZ_C03030                     155   9e-41   
ref|XP_010049183.1|  PREDICTED: pyrophosphate-energized vacuolar ...    156   1e-40   
gb|AAQ19328.1|  H+-pyrophosphatase                                      157   1e-40   
ref|XP_002455587.1|  hypothetical protein SORBIDRAFT_03g013530          157   1e-40   
ref|XP_010049182.1|  PREDICTED: pyrophosphate-energized vacuolar ...    156   2e-40   
gb|KHN23153.1|  Pyrophosphate-energized vacuolar membrane proton ...    155   2e-40   
ref|XP_010051280.1|  PREDICTED: pyrophosphate-energized vacuolar ...    155   3e-40   
gb|KCW44138.1|  hypothetical protein EUGRSUZ_L02451                     154   9e-40   
ref|XP_010051273.1|  PREDICTED: pyrophosphate-energized vacuolar ...    152   5e-39   
ref|XP_010051278.1|  PREDICTED: pyrophosphate-energized vacuolar ...    149   2e-38   
dbj|BAA36841.1|  vacuolar H+-pyrophosphatase                            151   2e-38   
ref|XP_002517682.1|  Pyrophosphate-energized vacuolar membrane pr...    151   3e-38   
ref|XP_010029917.1|  PREDICTED: pyrophosphate-energized vacuolar ...    149   4e-38   
gb|KDO47416.1|  hypothetical protein CISIN_1g0042302mg                  148   5e-38   
gb|KDO47420.1|  hypothetical protein CISIN_1g0042302mg                  146   5e-38   
gb|KDO47419.1|  hypothetical protein CISIN_1g0042302mg                  148   6e-38   
gb|KDO47418.1|  hypothetical protein CISIN_1g0042302mg                  148   6e-38   
ref|XP_010029915.1|  PREDICTED: pyrophosphate-energized vacuolar ...    149   8e-38   
ref|XP_008389636.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    148   8e-38   
ref|XP_010029916.1|  PREDICTED: pyrophosphate-energized vacuolar ...    149   8e-38   
gb|KDO47417.1|  hypothetical protein CISIN_1g0042302mg                  148   9e-38   
gb|EPS59584.1|  pyrophosphate-energized vacuolar membrane proton ...    145   5e-37   
ref|XP_010051272.1|  PREDICTED: pyrophosphate-energized vacuolar ...    146   7e-37   
gb|KCW81671.1|  hypothetical protein EUGRSUZ_C03033                     145   2e-36   
ref|XP_004978280.1|  PREDICTED: pyrophosphate-energized vacuolar ...    144   4e-36   
gb|EAY96623.1|  hypothetical protein OsI_18536                          141   5e-35   
ref|XP_004951660.1|  PREDICTED: pyrophosphate-energized vacuolar ...    140   1e-34   
gb|AHL67376.1|  Chalk5                                                  139   2e-34   
ref|XP_003568884.1|  PREDICTED: pyrophosphate-energized vacuolar ...    139   2e-34   
ref|XP_002440641.1|  hypothetical protein SORBIDRAFT_09g004450          138   6e-34   
ref|NP_001054701.1|  Os05g0156900                                       137   9e-34   
gb|AES91661.2|  vacuolar H+-translocating inorganic pyrophosphatase     135   2e-33   
gb|EMT15308.1|  Pyrophosphate-energized vacuolar membrane proton ...    134   2e-32   
tpg|DAA63101.1|  TPA: hypothetical protein ZEAMMB73_533095              135   3e-32   
ref|XP_011398805.1|  Pyrophosphate-energized vacuolar membrane pr...    134   7e-32   
gb|EMS53286.1|  Pyrophosphate-energized vacuolar membrane proton ...    131   1e-31   
ref|XP_010068026.1|  PREDICTED: pyrophosphate-energized vacuolar ...    125   8e-31   
ref|XP_005647206.1|  vacuolar-type H-pyrophosphatase                    128   2e-30   
gb|EMT22832.1|  Pyrophosphate-energized vacuolar membrane proton ...    127   4e-30   
ref|XP_005845116.1|  hypothetical protein CHLNCDRAFT_32356              127   5e-30   
gb|KDD76475.1|  Inorganic H+ pyrophosphatase                            127   6e-30   
gb|ACF19425.1|  vacuolar proton pyrophosphatase                         121   1e-29   
ref|XP_008676297.1|  PREDICTED: pyrophosphate-energized vacuolar ...    116   3e-29   
gb|KHN01313.1|  Pyrophosphate-energized vacuolar membrane proton ...    124   3e-29   
ref|XP_002535533.1|  hypothetical protein RCOM_1930180                  115   6e-29   
gb|KDO47421.1|  hypothetical protein CISIN_1g0042301mg                  112   3e-28   
gb|KCW81676.1|  hypothetical protein EUGRSUZ_C030381                    120   4e-28   
gb|EAY73863.1|  hypothetical protein OsI_01741                          120   9e-28   
dbj|BAJ14099.1|  vacuolar proton pyrophosphatase                        110   1e-27   
gb|AFF27508.1|  vacuolar proton-inorganic pyrophosphatase               114   1e-27   
ref|XP_010908157.1|  PREDICTED: pyrophosphate-energized vacuolar ...    112   2e-27   
gb|AFF27509.1|  vacuolar proton-inorganic pyrophosphatase               114   2e-27   
gb|AFF27510.1|  vacuolar proton-inorganic pyrophosphatase               114   2e-27   
gb|KJB23660.1|  hypothetical protein B456_004G108700                    119   2e-27   
ref|XP_010051276.1|  PREDICTED: pyrophosphate-energized vacuolar ...    114   1e-25   
ref|XP_010065284.1|  PREDICTED: pyrophosphate-energized vacuolar ...    114   1e-25   
ref|XP_010065283.1|  PREDICTED: pyrophosphate-energized vacuolar ...    114   2e-25   
gb|KHG11819.1|  Pyrophosphate-energized vacuolar membrane proton ...    113   2e-25   
ref|XP_010068021.1|  PREDICTED: pyrophosphate-energized vacuolar ...    109   2e-24   
tpg|DAA54709.1|  TPA: hypothetical protein ZEAMMB73_571741              111   2e-24   
dbj|BAD37432.1|  inorganic diphosphatase, H+-translocating, vacuo...    101   1e-23   
ref|XP_002954858.1|  hypothetical protein VOLCADRAFT_76494              107   5e-23   
gb|KCW81679.1|  hypothetical protein EUGRSUZ_C03042                     106   7e-23   
ref|XP_008658530.1|  PREDICTED: uncharacterized protein LOC100280...    105   2e-22   
ref|XP_010096802.1|  Pyrophosphate-energized vacuolar membrane pr...    102   2e-21   
ref|XP_009763189.1|  PREDICTED: pyrophosphate-energized vacuolar ...    100   8e-21   
gb|KCW81662.1|  hypothetical protein EUGRSUZ_C03027                   98.6    3e-20   
gb|KIY92128.1|  inorganic pyrophosphatase                             92.4    4e-20   
emb|CAC44451.1|  proton-translocating inorganic pyrophosphatase       97.1    1e-19   
ref|XP_001694682.1|  inorganic pyrophosphatase                        97.1    2e-19   
ref|XP_006645853.1|  PREDICTED: pyrophosphate-energized vacuolar ...  94.7    1e-18   
gb|AFN42824.1|  vacuolar-type H pump pyrophosphatase-like protein     89.0    2e-18   
gb|AFN42825.1|  vacuolar-type H pump pyrophosphatase-like protein     89.4    2e-17   
gb|ADK36629.1|  vacuolar H+-pyrophosphatase                           90.5    2e-17   
ref|XP_010041545.1|  PREDICTED: pyrophosphate-energized vacuolar ...  89.0    3e-17   
ref|XP_813460.1|  vacuolar-type proton translocating pyrophosphat...  89.4    8e-17   
gb|AAF80381.1|AF159881_1  vacuolar-type proton translocating pyro...  89.0    9e-17   
ref|XP_814868.1|  vacuolar-type proton translocating pyrophosphat...  89.0    1e-16   
gb|EKF38149.1|  vacuolar-type proton translocating pyrophosphatase 1  88.6    1e-16   
gb|ESS66489.1|  vacuolar-type proton translocating pyrophosphatase 1  88.6    1e-16   
gb|EKG05980.1|  vacuolar-type proton translocating pyrophosphatase 1  88.6    1e-16   
gb|KIY93030.1|  hypothetical protein MNEG_14934                       82.4    2e-16   
emb|CCD14799.1|  unnamed protein product                              84.7    9e-16   
ref|NP_001168714.1|  uncharacterized protein LOC100382506             79.7    1e-15   
gb|AGN32987.1|  vacuolar-type proton translocating pyrophosphatase 1  85.9    1e-15   
ref|XP_010701502.1|  vacuolar-type proton translocating pyrophosp...  85.9    1e-15   
emb|CCD17117.1|  unnamed protein product                              85.1    1e-15   
ref|XP_001567142.1|  putative vacuolar-type proton translocating ...  85.1    2e-15   
emb|CCD15524.1|  unnamed protein product                              84.7    2e-15   
emb|CCW69815.1|  unnamed protein product                              83.6    5e-15   
emb|CCC50119.1|  putative vacuolar-type proton translocating pyro...  83.6    6e-15   
ref|XP_844588.1|  vacuolar-type proton translocating pyrophosphat...  82.4    1e-14   
gb|AAK95376.1|  vacuolar-type proton translocating pyrophosphatase 1  82.4    1e-14   
emb|CBH10748.1|  vacuolar-type proton translocating pyrophosphata...  82.4    1e-14   
emb|CBH13886.1|  vacuolar-type proton translocating pyrophosphata...  82.4    1e-14   
ref|XP_847623.1|  vacuolar-type proton translocating pyrophosphat...  82.4    1e-14   
gb|EPY37495.1|  vacuolar-type proton translocating pyrophosphatase 1  81.6    3e-14   
gb|EPY25094.1|  vacuolar-type proton translocating pyrophosphatase 1  81.6    3e-14   
ref|XP_001685107.1|  putative vacuolar-type proton translocating ...  80.9    4e-14   
gb|EPY20019.1|  inorganic pyrophosphatase                             80.5    6e-14   
gb|EPY24500.1|  vacuolar-type proton translocating pyrophosphatase 1  80.5    6e-14   
ref|XP_004030525.1|  inorganic pyrophosphatase, putative              80.5    7e-14   
ref|XP_003877640.1|  putative vacuolar-type proton translocating ...  79.3    1e-13   
ref|XP_002185784.1|  predicted protein                                78.6    2e-13   
ref|XP_003863215.1|  vacuolar-type proton translocating pyrophosp...  78.2    3e-13   
ref|XP_001467417.1|  putative vacuolar-type proton translocating ...  78.2    3e-13   
gb|EJK49356.1|  hypothetical protein THAOC_31776                      75.1    3e-12   
gb|AFW86962.1|  hypothetical protein ZEAMMB73_079608                  74.7    5e-12   
gb|AIZ95255.1|  putative pyrophosphatase                              70.5    8e-12   
ref|XP_009313559.1|  vacuolar-type proton translocating pyrophosp...  72.8    2e-11   
gb|EWM21806.1|  h+-translocating pyrophosphatase family               71.6    5e-11   
gb|EPY23623.1|  inorganic pyrophosphatase                             70.9    9e-11   
emb|CDW90876.1|  pyrophosphate-energized vacuolar membrane proton...  70.1    1e-10   
emb|CBK23132.2|  unnamed protein product                              69.3    3e-10   
emb|CBK21196.2|  unnamed protein product                              69.3    3e-10   
ref|WP_010508682.1|  potassium transporter                            68.9    3e-10   
ref|WP_018051858.1|  potassium transporter                            68.2    6e-10   
emb|CBI35335.3|  unnamed protein product                              68.2    7e-10   
gb|EAZ11737.1|  hypothetical protein OsJ_01602                        68.2    7e-10   
ref|XP_001020551.1|  inorganic pyrophosphatase                        67.4    9e-10   
ref|XP_736713.1|  hypothetical protein                                65.5    1e-09   
ref|XP_002260303.1|  V-type H(+)-translocating pyrophosphatase        66.6    2e-09   
ref|XP_006369847.1|  hypothetical protein POPTR_0001s33820g           65.5    2e-09   
gb|EJY85113.1|  Inorganic pyrophosphatase                             66.6    2e-09   
gb|AAD17216.1|  proton-pumping vacuolar pyrophosphatase               62.4    2e-09   
emb|CAD90116.1|  vacuolar pyrophosphatase                             60.5    3e-09   
ref|XP_001447467.1|  hypothetical protein                             65.9    3e-09   
emb|CDR15480.1|  V-type H(+)-translocating pyrophosphatase, putative  65.5    4e-09   
ref|XP_001428883.1|  hypothetical protein                             65.1    5e-09   
gb|EUD71439.1|  V-type H(+)-translocating pyrophosphatase             65.1    6e-09   
emb|CDO67032.1|  V-type H(+)-translocating pyrophosphatase, putative  64.3    1e-08   
ref|XP_002502540.1|  H+-translocating pyrophosphatase family          64.3    1e-08   
ref|XP_001615819.1|  V-type H(+)-translocating pyrophosphatase        63.9    1e-08   
ref|WP_016543771.1|  V-type H(+)-translocating pyrophosphatase        63.5    2e-08   
ref|XP_002777611.1|  H+-translocating inorganic pyrophosphatase T...  63.5    2e-08   
ref|XP_002782816.1|  conserved hypothetical protein                   62.4    2e-08   
gb|AAD17215.1|  proton-pumping vacuolar pyrophosphatase               63.5    2e-08   
gb|ETW15152.1|  V-type H(+)-translocating pyrophosphatase             63.2    2e-08   
ref|XP_001348715.1|  V-type H(+)-translocating pyrophosphatase, p...  63.2    2e-08   
gb|ETW54232.1|  V-type H(+)-translocating pyrophosphatase             63.2    2e-08   
ref|XP_001011583.1|  Inorganic H+ pyrophosphatase                     63.2    3e-08   
ref|WP_020770960.1|  V-type H(+)-translocating pyrophosphatase        63.2    3e-08   
ref|XP_002773348.1|  conserved hypothetical protein                   61.2    3e-08   
ref|XP_008622117.1|  V-type H(+)-translocating pyrophosphatase        62.8    3e-08   
ref|XP_727598.1|  V-type H(+)-translocating pyrophosphatase           62.8    3e-08   
gb|ETB63162.1|  V-type H( )-translocating pyrophosphatase             62.8    3e-08   
ref|WP_008589377.1|  potassium transporter                            62.8    4e-08   
gb|EUT79092.1|  V-type H(+)-translocating pyrophosphatase             62.4    5e-08   
ref|XP_005789368.1|  H+-translocating pyrophosphatase                 62.0    6e-08   
ref|XP_002782815.1|  H+-translocating inorganic pyrophosphatase T...  62.0    6e-08   
ref|XP_002784996.1|  H+-translocating inorganic pyrophosphatase T...  61.6    8e-08   
gb|ACC59104.1|  At1G15690-like protein                                58.2    8e-08   
ref|WP_001089684.1|  hypothetical protein                             57.8    9e-08   
ref|XP_676243.1|  V-type H(+)-translocating pyrophosphatase           61.2    1e-07   
gb|ETO10415.1|  inorganic pyrophosphatase                             60.8    1e-07   
ref|XP_004031183.1|  inorganic h+ pyrophosphatase, putative           60.5    2e-07   
gb|KHO53496.1|  hypothetical protein QT04_C0004G0029                  60.5    2e-07   
ref|WP_016549231.1|  V-type H(+)-translocating pyrophosphatase        60.1    2e-07   
ref|WP_010570365.1|  potassium transporter                            60.1    2e-07   
ref|WP_010411520.1|  potassium transporter                            59.7    3e-07   
ref|WP_003006999.1|  V-type H(+)-translocating pyrophosphatase        59.7    3e-07   
ref|WP_032914011.1|  potassium transporter                            59.3    4e-07   
gb|EKO34787.1|  V-type H(+)-translocating pyrophosphatase             59.3    4e-07   
ref|WP_016756764.1|  potassium transporter                            59.3    4e-07   
gb|EMP80355.1|  V-type H(+)-translocating pyrophosphatase             59.3    4e-07   
ref|WP_043991582.1|  potassium transporter                            59.3    4e-07   
ref|WP_004466135.1|  V-type H(+)-translocating pyrophosphatase        59.3    4e-07   
gb|ADI18265.1|  inorganic pyrophosphatase                             58.9    5e-07   
ref|XP_007515731.1|  vacuolar proton-inorganic pyrophosphatase        58.9    6e-07   
ref|XP_005824384.1|  hypothetical protein GUITHDRAFT_145095           58.9    6e-07   
gb|EAZ42870.1|  hypothetical protein OsJ_27463                        55.8    6e-07   
ref|WP_020983541.1|  V-type H(+)-translocating pyrophosphatase        58.9    6e-07   
ref|XP_002768831.1|  H+-translocating inorganic pyrophosphatase T...  58.9    7e-07   
ref|XP_003056902.1|  H+-translocating pyrophosphatase family          58.5    7e-07   
ref|WP_017809980.1|  potassium transporter                            58.5    8e-07   
ref|WP_001089698.1|  K(+)-stimulated pyrophosphate-energized sodi...  58.5    8e-07   
ref|WP_001968143.1|  V-type H(+)-translocating pyrophosphatase        58.5    9e-07   
ref|XP_002779293.1|  H+-translocating inorganic pyrophosphatase T...  58.5    9e-07   
ref|WP_025177737.1|  potassium transporter                            57.8    1e-06   
ref|WP_001089694.1|  potassium transporter                            57.8    1e-06   
ref|XP_008883880.1|  V-type H(+)-translocating pyrophosphatase VP1    57.8    1e-06   
ref|WP_001089689.1|  K(+)-stimulated pyrophosphate-energized sodi...  57.8    1e-06   
ref|WP_001089688.1|  K(+)-stimulated pyrophosphate-energized sodi...  57.8    1e-06   
ref|WP_017855597.1|  potassium transporter                            57.8    1e-06   
ref|WP_001089693.1|  K(+)-stimulated pyrophosphate-energized sodi...  57.8    1e-06   
ref|WP_001089695.1|  K(+)-stimulated pyrophosphate-energized sodi...  57.8    1e-06   
ref|WP_001089697.1|  K(+)-stimulated pyrophosphate-energized sodi...  57.8    1e-06   
ref|WP_001089696.1|  K(+)-stimulated pyrophosphate-energized sodi...  57.8    1e-06   
ref|WP_001089690.1|  K(+)-stimulated pyrophosphate-energized sodi...  57.8    1e-06   
gb|EMN79697.1|  V-type H(+)-translocating pyrophosphatase             57.8    1e-06   
ref|WP_025183110.1|  potassium transporter                            57.8    1e-06   
gb|EKO95603.1|  V-type H(+)-translocating pyrophosphatase             57.8    1e-06   
gb|EMJ47695.1|  V-type H(+)-translocating pyrophosphatase             57.8    1e-06   
gb|EKR54608.1|  V-type H(+)-translocating pyrophosphatase             57.8    1e-06   



>gb|AFQ00710.1| pyrophosphate-energized vacuolar membrane proteon pump 1 [Ipomoea 
batatas]
Length=767

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 155/167 (93%), Gaps = 1/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  290
            M A+TILPDLGT++LIP CAIVGIAFALVQW+LVSKVKLSPEKS    +D KNGFAESLI
Sbjct  1    MVAATILPDLGTQVLIPACAIVGIAFALVQWVLVSKVKLSPEKSGPGPADGKNGFAESLI  60

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST
Sbjct  61   EEEEGINDHSVVHKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  120

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              QPCTYD TK CKPALATAVFSTISFLLGA+TSVVSGFLGMKIATY
Sbjct  121  KDQPCTYDSTKTCKPALATAVFSTISFLLGAITSVVSGFLGMKIATY  167



>gb|KJB23659.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
Length=707

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 155/171 (91%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  278
            MGAS+ILPDLGTEILIPVCA++GIAF+LVQWILVS+VKLSP + +     + +  KNG+A
Sbjct  1    MGASSILPDLGTEILIPVCAVIGIAFSLVQWILVSRVKLSPGRDSGAPGNNGAAGKNGYA  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGS+E
Sbjct  61   DYLIEEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSIE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFS  SQPCTYD +++CKPALATA FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  121  GFSMKSQPCTYDLSRMCKPALATAAFSTLSFLLGAVTSVVSGFLGMKIATY  171



>ref|XP_009779977.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=766

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 153/167 (92%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-ESLI  290
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS +KS+  +D KNG+A ESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSADKSSGAADDKNGYAAESLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVVQKCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVQKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             +QPCTYD TK CKPALATAVFST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  120  KNQPCTYDSTKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIATY  166



>ref|XP_009598387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=766

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-ESLI  290
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS EKS+  +D KNG+A ESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSTEKSSGGADDKNGYAAESLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVVQKCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVQKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             +QPCTYD  K CKPALATAVFST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  120  KNQPCTYDSAKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIATY  166



>emb|CAA58700.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=766

 Score =   283 bits (724),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 153/167 (92%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-ESLI  290
            MGA  IL DLGTEILIPVCA+VGIAF+L QW LVSKV LS +KS+  +D KNG+A ESLI
Sbjct  1    MGAP-ILSDLGTEILIPVCAVVGIAFSLFQWFLVSKVTLSADKSSGAADDKNGYAAESLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVVQKCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVQKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             +QPCTYD TK CKPALATAVFST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  120  KNQPCTYDSTKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIATY  166



>ref|XP_010323159.1| PREDICTED: vacuolar-type H+-pyrophosphatase isoform X1 [Solanum 
lycopersicum]
Length=765

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  126  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEG  305
            TIL DLG EILIPVCA+VGIAF+L QW LVSKV +  +KS S  D KNG+AESLIEEEEG
Sbjct  4    TILTDLGMEILIPVCAVVGIAFSLFQWYLVSKVTVGTDKSHSSGDDKNGYAESLIEEEEG  63

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
            INDHNVVQKCAEIQ+AISEGATSFLFT YQYVG+FMVAFAILIFVFLGSVEGFST +QPC
Sbjct  64   INDHNVVQKCAEIQNAISEGATSFLFTMYQYVGVFMVAFAILIFVFLGSVEGFSTKNQPC  123

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TYD TK CKPALATAVFST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  124  TYDSTKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIATY  165



>gb|KJB23657.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
 gb|KJB23658.1| hypothetical protein B456_004G108700 [Gossypium raimondii]
Length=771

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 155/171 (91%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  278
            MGAS+ILPDLGTEILIPVCA++GIAF+LVQWILVS+VKLSP + +     + +  KNG+A
Sbjct  1    MGASSILPDLGTEILIPVCAVIGIAFSLVQWILVSRVKLSPGRDSGAPGNNGAAGKNGYA  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGS+E
Sbjct  61   DYLIEEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSIE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFS  SQPCTYD +++CKPALATA FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  121  GFSMKSQPCTYDLSRMCKPALATAAFSTLSFLLGAVTSVVSGFLGMKIATY  171



>gb|KHG19866.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=771

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 154/171 (90%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  278
            MGAS+ILPDLGTEILIPVCA++GIAF+LVQWILVS+VKLSP + +     S +  KNG+A
Sbjct  1    MGASSILPDLGTEILIPVCAVIGIAFSLVQWILVSRVKLSPGRDSGASGNSGAAGKNGYA  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVE
Sbjct  61   DYLIEEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFS  SQPCTYD +++CKPALATA  ST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  121  GFSMKSQPCTYDLSRMCKPALATAALSTLSFLLGAVTSVVSGFLGMKIATY  171



>ref|XP_007013601.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY31220.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=734

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 154/171 (90%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  278
            MGAS IL DLG EILIPVCA+VGIAF+LVQW+LVSKVKLSP + +     + + AKNG+A
Sbjct  1    MGAS-ILTDLGAEILIPVCAVVGIAFSLVQWVLVSKVKLSPGRDSGSPGNNGAGAKNGYA  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQPC YD++K+CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  GFSTKSQPCMYDQSKMCKPALATAAFSTISFLLGAVTSVVSGFLGMKIATY  170



>ref|XP_011084078.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
 ref|XP_011084079.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=823

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 155/166 (93%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M  +T+LPDLGT+ILIP+CA+VGIAFALVQW+LVSKVKLS +KS+S +D KNGF E+LIE
Sbjct  59   MAETTLLPDLGTQILIPICALVGIAFALVQWLLVSKVKLSTDKSSS-ADGKNGFTEALIE  117

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EE+G++DH+VV+KCA+IQSAISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  118  EEDGVSDHSVVRKCADIQSAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTK  177

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             Q CTYD TK+CKPALATA FSTISFLLGA+TSVVSGFLGMKIATY
Sbjct  178  PQACTYDSTKMCKPALATAAFSTISFLLGAITSVVSGFLGMKIATY  223



>ref|NP_001265905.1| vacuolar-type H+-pyrophosphatase [Solanum lycopersicum]
 dbj|BAM65603.1| vacuolar H+-pyrophosphatase [Solanum lycopersicum]
Length=765

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +3

Query  126  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEG  305
            TIL DLG EILIPVCA+VGIAF+L QW LVSKV +  +KS S  D KNG+AESLIEEEEG
Sbjct  4    TILTDLGMEILIPVCAVVGIAFSLFQWYLVSKVTVGTDKSHSSGDDKNGYAESLIEEEEG  63

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
            INDHNVVQKCAEIQ+AISEGATSFLFT YQYVG+FMVAFA LIF FLGSVEGFST +QPC
Sbjct  64   INDHNVVQKCAEIQNAISEGATSFLFTMYQYVGVFMVAFATLIFAFLGSVEGFSTKNQPC  123

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TYD TK CKPALATAVFST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  124  TYDSTKTCKPALATAVFSTVSFLLGAVTSVVSGFLGMKIATY  165



>ref|XP_006359496.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum tuberosum]
Length=765

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = +3

Query  126  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEG  305
            TIL DLG EILIP+CA++GIAF+L QW LVSKV +  +K  S  D KNG+AESLIEEEEG
Sbjct  4    TILTDLGMEILIPICAVIGIAFSLFQWHLVSKVTVGTDKPHSSGDDKNGYAESLIEEEEG  63

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
            INDHNVVQKCAEIQ+AISEGATSFLFT YQYVG+FMVAFAILIFVFLGSVEGFST  QPC
Sbjct  64   INDHNVVQKCAEIQNAISEGATSFLFTMYQYVGVFMVAFAILIFVFLGSVEGFSTKDQPC  123

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TYD TK CKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  124  TYDSTKTCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  165



>ref|XP_007013600.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY31219.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=770

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 154/171 (90%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  278
            MGAS IL DLG EILIPVCA+VGIAF+LVQW+LVSKVKLSP + +     + + AKNG+A
Sbjct  1    MGAS-ILTDLGAEILIPVCAVVGIAFSLVQWVLVSKVKLSPGRDSGSPGNNGAGAKNGYA  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQPC YD++K+CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  GFSTKSQPCMYDQSKMCKPALATAAFSTISFLLGAVTSVVSGFLGMKIATY  170



>gb|KJB53982.1| hypothetical protein B456_009G014500 [Gossypium raimondii]
Length=575

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 152/171 (89%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  278
            MGAS IL DLGTEILIPVCA++GIAF+L+QW+LVSKVKLSP +       + +  KN  A
Sbjct  1    MGAS-ILSDLGTEILIPVCAVIGIAFSLLQWVLVSKVKLSPGRDPGSPRNNGAGGKNDCA  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQPCTYD++K+CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  GFSTKSQPCTYDQSKICKPALATAAFSTISFLLGAVTSVVSGFLGMKIATY  170



>gb|KHN15033.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=732

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 151/168 (90%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  287
            MGA  ILPDLGTEILIPVCAI+GIAFAL QW+LVSKVKLS  + AS +    KNG+ + L
Sbjct  1    MGA-VILPDLGTEILIPVCAIIGIAFALFQWVLVSKVKLSAARDASSNAGGGKNGYNDYL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFS
Sbjct  60   IEEEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFS  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T  QPCTYD+TK+CKPALATAVFSTISFLLG VTS++SGFLGMKIATY
Sbjct  120  TSYQPCTYDQTKMCKPALATAVFSTISFLLGGVTSLISGFLGMKIATY  167



>ref|XP_007155080.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris]
 gb|ESW27074.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris]
Length=766

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  290
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS + A KNG+ + LI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAGKNGYNDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFA+LIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVAKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAVLIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              QPCTYD+TKLCKPALATA+FSTISFLLG VTS++SGFLGMKIATY
Sbjct  120  SHQPCTYDKTKLCKPALATAIFSTISFLLGGVTSLISGFLGMKIATY  166



>ref|XP_009595111.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nicotiana tomentosiformis]
Length=767

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNG-FAESL  287
            MGA TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +K S+S  D KNG +AE+L
Sbjct  1    MGA-TILPDLGTEILIPVCALIGIGFALVQWVIVSKVIVSTDKLSSSSGDGKNGSYAEAL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFS
Sbjct  60   IEEEEGINDHSVVNKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFS  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQ CTYD +K+CKPALATAVFSTISFLLG VTSVVSGFLGMKIATY
Sbjct  120  TKSQACTYDSSKMCKPALATAVFSTISFLLGGVTSVVSGFLGMKIATY  167



>ref|XP_004251737.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=769

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 153/168 (91%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD----SDAKNGFAESL  287
             +TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +  +S     +D KNG+AESL
Sbjct  2    GTTILPDLGTEILIPVCAVIGIGFALVQWVIVSKVTVSTDGKSSSPGAGADGKNGYAESL  61

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEGINDH+VV+KCAEIQ+AI+EGATSFLFTEYQYVG+FMVAFA+LIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHSVVRKCAEIQNAIAEGATSFLFTEYQYVGVFMVAFALLIFLFLGSVEGFS  121

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQ CTYD +K+CKPALATAVFSTISFLLGA+TSV+SGFLGMKIATY
Sbjct  122  TKSQECTYDSSKMCKPALATAVFSTISFLLGAITSVISGFLGMKIATY  169



>ref|XP_003542656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Glycine max]
 gb|KHN47114.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=765

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 151/167 (90%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  290
            MGA  ILPDLGTEILIPVCAI+GI FAL QW+LVSKVKLS  + AS + A KNG+ + LI
Sbjct  1    MGA-VILPDLGTEILIPVCAIIGIGFALFQWVLVSKVKLSAARDASPNAAGKNGYNDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              QPCTYD+TK+CKPALATAVFSTISFLLG VTS++SGFLGMKIATY
Sbjct  120  SYQPCTYDQTKMCKPALATAVFSTISFLLGGVTSLISGFLGMKIATY  166



>ref|XP_010097004.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
 gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
Length=764

 Score =   275 bits (704),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  299
             S ILPDLGTEILIP CA+VGI F+LVQW LVS+VKLSP   A + + KNG+ + LIEEE
Sbjct  2    GSAILPDLGTEILIPACAVVGIVFSLVQWFLVSQVKLSPAGEAQN-NGKNGYTDYLIEEE  60

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EG+NDHNVV KCAEIQ AIS+GATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST SQ
Sbjct  61   EGLNDHNVVLKCAEIQRAISDGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTKSQ  120

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTYD TKLCKPALA A+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  121  PCTYDATKLCKPALANAIFSTVSFLLGAVTSVVSGFLGMKIATY  164



>ref|XP_011017877.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Populus euphratica]
Length=768

 Score =   275 bits (704),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD---AKNGFAESLI  290
             S +LPDLGTEILIPVCAI+GI F+L QW+LVSKVKL+P  +AS++     KNG  + LI
Sbjct  2    GSPVLPDLGTEILIPVCAIIGIGFSLFQWLLVSKVKLTPGSAASNNSRGSGKNGHGDYLI  61

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+NDHN+V KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST
Sbjct  62   EEEEGLNDHNIVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  121

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTYD  KLCKPALATA FSTISF+LGAVTSVVSGFLGMKIATY
Sbjct  122  KSQPCTYDPLKLCKPALATAGFSTISFMLGAVTSVVSGFLGMKIATY  168



>ref|XP_006350116.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum tuberosum]
Length=769

 Score =   275 bits (703),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAESL  287
             +TIL DLGTEILIPVCA++GI FALVQW++VSKV +S +  +S S    D KNG+AESL
Sbjct  2    GTTILSDLGTEILIPVCALIGIGFALVQWVIVSKVTVSTDGKSSSSGAGTDGKNGYAESL  61

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEGINDH+VV KCAEIQ+AI+EGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHSVVHKCAEIQNAIAEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFS  121

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQ CTYD +K+CKPALATAVFSTISFLLGAVTSV+SGFLGMKIATY
Sbjct  122  TKSQACTYDSSKMCKPALATAVFSTISFLLGAVTSVISGFLGMKIATY  169



>gb|KDP30223.1| hypothetical protein JCGZ_17005 [Jatropha curcas]
Length=770

 Score =   275 bits (703),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 147/167 (88%), Gaps = 5/167 (3%)
 Frame = +3

Query  126  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-----KNGFAESLI  290
            TILPDLGTEILIP+CAI+GI F+L+QW+LVSKVKL P   +   DA     KNG+++ LI
Sbjct  4    TILPDLGTEILIPICAIIGIGFSLIQWLLVSKVKLVPGGGSGGRDAAAGNKKNGYSDYLI  63

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+NDHN V KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST
Sbjct  64   EEEEGLNDHNTVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFST  123

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTY+  KLCKPALATA FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  124  KSQPCTYNPLKLCKPALATAAFSTVSFLLGAVTSVVSGFLGMKIATY  170



>gb|ABF85694.1| inorganic pyrophosphatase [Nicotiana rustica]
Length=765

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  299
             S +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIEEE
Sbjct  2    GSALLPDLGAEIVIPVCAVIGIVFSLVQWYLVSTVKLTPESSSPSNNGKNGYGDYLIEEE  61

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EGIND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST SQ
Sbjct  62   EGINDQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTKSQ  121

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTY++ KLCKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  122  PCTYNKEKLCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  165



>ref|XP_003609464.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula]
Length=715

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 153/167 (92%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  290
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  + SA+++  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGRDSATEAPGKNGYNDSLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVV KCAEIQ+AISEG+TSFLFT Y+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVLKCAEIQNAISEGSTSFLFTMYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              QPCTYDETK+CKPALATA+FSTI+F+LG +TSV+SGFLGMKIATY
Sbjct  120  SHQPCTYDETKMCKPALATALFSTIAFILGGITSVISGFLGMKIATY  166



>gb|KJB53981.1| hypothetical protein B456_009G014500 [Gossypium raimondii]
Length=770

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 152/171 (89%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  278
            MGAS IL DLGTEILIPVCA++GIAF+L+QW+LVSKVKLSP +       + +  KN  A
Sbjct  1    MGAS-ILSDLGTEILIPVCAVIGIAFSLLQWVLVSKVKLSPGRDPGSPRNNGAGGKNDCA  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQPCTYD++K+CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  GFSTKSQPCTYDQSKICKPALATAAFSTISFLLGAVTSVVSGFLGMKIATY  170



>ref|XP_009628297.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=765

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW +VS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYIVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGIND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  60   EEEGINDQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY++ KLCKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  120  SQPCTYNKEKLCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  165



>ref|XP_007204643.1| hypothetical protein PRUPE_ppa001782mg [Prunus persica]
 gb|EMJ05842.1| hypothetical protein PRUPE_ppa001782mg [Prunus persica]
Length=765

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 154/167 (92%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  290
            MGA T+LPDLGTEILIP+CA++GIAF++VQW+ VS+VKLSP + A S++  KNG+ + LI
Sbjct  1    MGA-TLLPDLGTEILIPLCAVIGIAFSVVQWMFVSQVKLSPGRDANSNAPGKNGYNDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG FMVAFA+LIFVFLGSVEGFST
Sbjct  60   EEEEGGNDHNVVLKCAEIQNAISEGATSFLFTEYKYVGGFMVAFAVLIFVFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             S+PCTYD+TK+CKPALATA+FSTISFLLGA+TSVVSGFLGMKIATY
Sbjct  120  SSRPCTYDQTKICKPALATAIFSTISFLLGAITSVVSGFLGMKIATY  166



>ref|XP_006381091.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
 gb|ERP58888.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
Length=768

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 149/166 (90%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIE  293
            S ILPDLGTEILIPVCAI+GI F+L+QW+LVSKVKL P  +AS++     KNG+ + LIE
Sbjct  3    SVILPDLGTEILIPVCAIIGIGFSLLQWLLVSKVKLVPSPAASNNSGAAGKNGYGDYLIE  62

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST 
Sbjct  63   EEEGLNDHNVVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTK  122

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD  K+CKPALATA FST++F+LGAVTSVVSGFLGMKIATY
Sbjct  123  SQPCTYDLLKMCKPALATAGFSTVAFVLGAVTSVVSGFLGMKIATY  168



>ref|XP_008242846.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Prunus mume]
Length=765

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 154/167 (92%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  290
            MGA T+LPDLGTEILIP+CA++GIAF++VQW+ VS+VKLSP + A S++  KNG+ + LI
Sbjct  1    MGA-TLLPDLGTEILIPLCAVIGIAFSVVQWMFVSQVKLSPGRDANSNAPGKNGYNDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG FMVAFA+LIFVFLGSVEGFST
Sbjct  60   EEEEGGNDHNVVLKCAEIQNAISEGATSFLFTEYKYVGGFMVAFAVLIFVFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             S+PCTYD+TK+CKPALATA+FSTISFLLGA+TSVVSGFLGMKIATY
Sbjct  120  SSRPCTYDQTKICKPALATAIFSTISFLLGAITSVVSGFLGMKIATY  166



>ref|XP_009796113.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=765

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYLVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGIN+ NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  60   EEEGINEQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFIFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY++ KLCKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  120  SQPCTYNKEKLCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  165



>ref|XP_006389422.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
 gb|ABK95131.1| unknown [Populus trichocarpa]
 gb|ERP48336.1| Pyrophosphate-energized vacuolar membrane proton pump family 
protein [Populus trichocarpa]
Length=768

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLI  290
             S ILPDLGTEILIPVCAI+GI F+L QW+LVSKVKL+P  +AS++     KNG  + LI
Sbjct  2    GSPILPDLGTEILIPVCAIIGIGFSLFQWLLVSKVKLTPGSAASNNSGGAGKNGHGDYLI  61

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+NDHN+V KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST
Sbjct  62   EEEEGLNDHNIVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  121

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTYD  KLCKPALATA FSTI+F+LGAVTSVVSGFLGMKIATY
Sbjct  122  KSQPCTYDPLKLCKPALATAGFSTIAFVLGAVTSVVSGFLGMKIATY  168



>gb|KJB83229.1| hypothetical protein B456_013G236400 [Gossypium raimondii]
Length=767

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  287
            MGAS IL D G EILIPVCA++GIAF+LVQW+LVSKVKLSP + +  + S AKNG+++ L
Sbjct  1    MGAS-ILSDFGAEILIPVCAVIGIAFSLVQWVLVSKVKLSPGRESVNNGSGAKNGYSDYL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+NDH+VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGF+
Sbjct  60   IEEEEGLNDHSVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFT  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            + SQPCTYD++K+CKPALATA FSTISFLLGA+TSVVSGFLGMKIATY
Sbjct  120  SKSQPCTYDKSKICKPALATAAFSTISFLLGAITSVVSGFLGMKIATY  167



>ref|XP_004508424.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Cicer arietinum]
Length=765

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 150/167 (90%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  290
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  +  + D+  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGREVTADASGKNGYNDSLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFT Y YVGIFMVAFA+LIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVLKCAEIQNAISEGATSFLFTMYYYVGIFMVAFAVLIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              QPCTYDETKLCKPALATA+FSTISF+LG +TSV+SGFLGMKIATY
Sbjct  120  KEQPCTYDETKLCKPALATALFSTISFVLGGITSVISGFLGMKIATY  166



>gb|KHG04918.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=770

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 152/171 (89%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-----SDSDAKNGFA  278
            MGAS IL DLGTEILIPVCA++GIAF+L+QW+LVSKVKLSP +       + +  KN  A
Sbjct  1    MGAS-ILSDLGTEILIPVCAVIGIAFSLLQWVLVSKVKLSPGRDPGSPRNNGAGGKNDCA  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQPCTYD++++CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  GFSTKSQPCTYDQSRICKPALATAAFSTISFLLGAVTSVVSGFLGMKIATY  170



>emb|CDP10479.1| unnamed protein product [Coffea canephora]
Length=765

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 151/166 (91%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ ILPDL TEILIPVCA++GI FALVQW+LVSKVKLS +K  + +D KNGF E+LIE
Sbjct  1    MGAA-ILPDLATEILIPVCAVIGIIFALVQWLLVSKVKLSHDKFDAGADGKNGFTEALIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGIN  ++VQKCA+IQ+AISEGATSFLFTEYQYVG+FMVAFAILIFVFLGSVEGFST 
Sbjct  60   EEEGINGDSIVQKCADIQNAISEGATSFLFTEYQYVGVFMVAFAILIFVFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQ CTYD +KLCKPAL TAVFST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  120  SQACTYDSSKLCKPALGTAVFSTVSFLLGAITSVLSGFLGMKIATY  165



>gb|KJB83230.1| hypothetical protein B456_013G236400 [Gossypium raimondii]
Length=795

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  287
            MGAS IL D G EILIPVCA++GIAF+LVQW+LVSKVKLSP + +  + S AKNG+++ L
Sbjct  1    MGAS-ILSDFGAEILIPVCAVIGIAFSLVQWVLVSKVKLSPGRESVNNGSGAKNGYSDYL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+NDH+VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGF+
Sbjct  60   IEEEEGLNDHSVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFT  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            + SQPCTYD++K+CKPALATA FSTISFLLGA+TSVVSGFLGMKIATY
Sbjct  120  SKSQPCTYDKSKICKPALATAAFSTISFLLGAITSVVSGFLGMKIATY  167



>emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=765

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ +LPDLG EI+IPVCA++GI F+LVQW LVS VKL+PE S+  ++ KNG+ + LIE
Sbjct  1    MGAA-LLPDLGAEIVIPVCAVIGIVFSLVQWYLVSNVKLTPESSSPSNNGKNGYGDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGIN+ NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  60   EEEGINEQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY++ KLCKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  120  SQPCTYNKEKLCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  165



>ref|XP_003609463.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula]
 gb|ACI22377.1| vacuolar-type H-pyrophosphatase [Medicago truncatula]
 gb|AES91660.1| vacuolar H+-translocating inorganic pyrophosphatase [Medicago 
truncatula]
Length=765

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 153/167 (92%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  290
            MGA  ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKL+  + SA+++  KNG+ +SLI
Sbjct  1    MGA-VILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLTAGRDSATEAPGKNGYNDSLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVV KCAEIQ+AISEG+TSFLFT Y+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVLKCAEIQNAISEGSTSFLFTMYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              QPCTYDETK+CKPALATA+FSTI+F+LG +TSV+SGFLGMKIATY
Sbjct  120  SHQPCTYDETKMCKPALATALFSTIAFILGGITSVISGFLGMKIATY  166



>ref|XP_010250265.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nelumbo nucifera]
Length=765

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 149/166 (90%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ IL DL TEILIPVCA+VGIAFALVQW LVS+VKLSPE+  S +++KNG+ + LIE
Sbjct  1    MGAA-ILSDLATEILIPVCAVVGIAFALVQWSLVSRVKLSPERQTSSNNSKNGYNDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNV  KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVATKCADIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY   K CKPALA A+FST+SF+LGAVTSV+SGFLGMKIAT+
Sbjct  120  SQPCTYSPDKTCKPALANAIFSTVSFILGAVTSVISGFLGMKIATF  165



>gb|AHA38114.1| vacuolar H+-pyrophosphatase [Sesuvium portulacastrum]
Length=765

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 152/166 (92%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+T+LPDL TEILIP CA+VGIAF+L+QW LVS+VKLS + S+ +++   G A+SLIE
Sbjct  1    MGAATLLPDLATEILIPACAVVGIAFSLIQWFLVSQVKLSHD-SSRNNNKNGGMADSLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSV+GFST 
Sbjct  60   EEEGINDHSVVTKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVKGFSTS  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQ CTYD+TK CKPALATA+FST+SFLLGAVTS+VSGFLGMKIATY
Sbjct  120  SQECTYDKTKRCKPALATAIFSTVSFLLGAVTSIVSGFLGMKIATY  165



>ref|XP_011078537.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=764

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MG +T+LPD GTEILIPVCA++GIAFALVQW+LV+KV+LS  K  +    ++G+ E+LIE
Sbjct  1    MGDATLLPDRGTEILIPVCAVIGIAFALVQWLLVAKVRLSNGKDYAG--GRSGYTEALIE  58

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG++DH+VV+KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST 
Sbjct  59   EEEGVSDHSVVRKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTK  118

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD T++CKPALATA FST+SFLLGA TSVVSGFLGMKIAT+
Sbjct  119  SQPCTYDSTRMCKPALATAAFSTLSFLLGAFTSVVSGFLGMKIATF  164



>dbj|BAA23649.1| proton pyrophosphatase [Vigna radiata]
Length=766

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  290
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVVKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              Q C+YD+TK CKPALATA+FST+SFLLG VTS+VSGFLGMKIATY
Sbjct  120  SPQACSYDKTKTCKPALATAIFSTVSFLLGGVTSLVSGFLGMKIATY  166



>ref|XP_006474386.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X2 [Citrus sinensis]
Length=705

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 148/171 (87%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  278
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVIKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFIFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQ CTYD  K+CKPALATA FST+SFLLG +TSVVSGFLGMKIATY
Sbjct  120  GFSTKSQACTYDPFKMCKPALATAAFSTVSFLLGGITSVVSGFLGMKIATY  170



>sp|P21616.4|AVP_VIGRR RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; 
Short=H(+)-PPase; AltName: Full=Vacuolar H(+)-pyrophosphatase 
[Vigna radiata var. radiata]
 pdb|4A01|A Chain A, Crystal Structure Of The H-Translocating Pyrophosphatase
 pdb|4A01|B Chain B, Crystal Structure Of The H-Translocating Pyrophosphatase
Length=766

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  290
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVVKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              Q C+YD+TK CKPALATA+FST+SFLLG VTS+VSGFLGMKIATY
Sbjct  120  SPQACSYDKTKTCKPALATAIFSTVSFLLGGVTSLVSGFLGMKIATY  166



>gb|AAC49175.1| pyrophosphatase [Vigna radiata]
Length=765

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 152/167 (91%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSAS-DSDAKNGFAESLI  290
            MGA+ ILPDLGTEILIPVCA++GIAFAL QW+LVSKVKLS  + AS ++ AKNG+ + LI
Sbjct  1    MGAA-ILPDLGTEILIPVCAVIGIAFALFQWLLVSKVKLSAVRDASPNAAAKNGYNDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHNVVVKCAEIQNAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              Q C+YD+TK CKPALATA+FST+SFLLG VTS+VSGFLGMKIATY
Sbjct  120  SPQACSYDKTKTCKPALATAIFSTVSFLLGGVTSLVSGFLGMKIATY  166



>ref|XP_009791988.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Nicotiana sylvestris]
Length=767

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNG-FAESL  287
            MGA TILPDLGTEILIPVCA++GI FALVQW++VSKV +S +K S++  D K+G +AE+L
Sbjct  1    MGA-TILPDLGTEILIPVCALIGIGFALVQWVIVSKVTVSTDKLSSASGDGKHGSYAEAL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEGI+DH+VV KCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFS
Sbjct  60   IEEEEGISDHSVVNKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFS  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQ CTYD +K+CKPALATAVFSTISFLLG VTSVVSGFLGMKIATY
Sbjct  120  TKSQACTYDSSKMCKPALATAVFSTISFLLGGVTSVVSGFLGMKIATY  167



>ref|XP_009363953.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=764

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/166 (81%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA TILPDLG EILIP+CA+VGIAF+LVQW+ VS+VKLSP      +  KNG  E LIE
Sbjct  1    MGA-TILPDLGAEILIPLCAVVGIAFSLVQWMYVSQVKLSPGGGRDSNSGKNGHNEYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGGNDHNVVLKCAEIQNAISEGATSFLFTEYRYVGAFMVAFAILIFLFLGSVEGFSTS  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            S+ CTYD+TK+CKPALATA+FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  SRACTYDQTKMCKPALATAIFSTISFLLGAVTSVVSGFLGMKIATY  165



>ref|XP_011020230.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Populus euphratica]
Length=768

 Score =   271 bits (692),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 147/166 (89%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIE  293
            S ILPDLGTEILIP CAI+GI F+L+QW+LVSKVKL P  +AS++     KNG+ + LIE
Sbjct  3    SVILPDLGTEILIPACAIIGIGFSLLQWLLVSKVKLVPSSAASNNSGAAGKNGYGDYLIE  62

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHN V KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST 
Sbjct  63   EEEGLNDHNTVLKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTK  122

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY+  K+CKPALATA FST+SF+LGAVTSVVSGFLGMKIATY
Sbjct  123  SQPCTYEPLKMCKPALATAGFSTVSFVLGAVTSVVSGFLGMKIATY  168



>ref|XP_011073387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Sesamum indicum]
Length=765

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 149/163 (91%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIEEEE  302
            +LPDLGTEI+IP+CA++GI F+LVQW LVSKVKLSPE+  +   ++ KNG++E LIEEE+
Sbjct  3    LLPDLGTEIVIPLCAVIGIVFSLVQWFLVSKVKLSPERGGASAANNGKNGYSEYLIEEED  62

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            G+ND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST SQ 
Sbjct  63   GLNDQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKSQS  122

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CTYD+ KLCKPALATA+FST+SFLLGAVTSV+SGFLGMKIATY
Sbjct  123  CTYDKEKLCKPALATAIFSTVSFLLGAVTSVISGFLGMKIATY  165



>ref|XP_011081989.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Sesamum indicum]
Length=764

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 148/163 (91%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESLIEEEE  302
            +LPDLGTEI+IPVCA++GI F+LVQW LVS+VKLSPE+    +  + KNG+++ LIEEE+
Sbjct  3    LLPDLGTEIVIPVCAVIGIVFSLVQWFLVSRVKLSPERGGESAAKNGKNGYSDYLIEEED  62

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            GINDH VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST SQP
Sbjct  63   GINDHGVVVKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKSQP  122

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CT+++ KLCKPALATA+FST+SFLLGA TSVVSGFLGMKIATY
Sbjct  123  CTFNKEKLCKPALATAIFSTVSFLLGAFTSVVSGFLGMKIATY  165



>gb|KHF98453.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
arboreum]
Length=767

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  287
            MGAS IL D G EILIPVCA++GIAF+LVQW+LVSKVKLSP + +  + S AKNG+++ L
Sbjct  1    MGAS-ILSDFGAEILIPVCAVIGIAFSLVQWVLVSKVKLSPGRESVNNGSGAKNGYSDYL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+NDH+VV KCAEIQSAISEGATSFLFTEYQY GIFMVAFAILIF+FLGSVE FS
Sbjct  60   IEEEEGLNDHSVVLKCAEIQSAISEGATSFLFTEYQYAGIFMVAFAILIFLFLGSVERFS  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            + SQPCTYD++K+CKPALATA FSTISFLLGA+TSVVSGFLGMKIATY
Sbjct  120  SKSQPCTYDKSKICKPALATAAFSTISFLLGAITSVVSGFLGMKIATY  167



>ref|XP_006453118.1| hypothetical protein CICLE_v10007524mg [Citrus clementina]
 ref|XP_006474385.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X1 [Citrus sinensis]
 gb|ESR66358.1| hypothetical protein CICLE_v10007524mg [Citrus clementina]
Length=771

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 148/171 (87%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  278
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVIKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFIFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQ CTYD  K+CKPALATA FST+SFLLG +TSVVSGFLGMKIATY
Sbjct  120  GFSTKSQACTYDPFKMCKPALATAAFSTVSFLLGGITSVVSGFLGMKIATY  170



>dbj|BAA33149.1| proton-translocating inorganic pyrophosphatase [Cucurbita moschata]
Length=768

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 148/165 (90%), Gaps = 3/165 (2%)
 Frame = +3

Query  126  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIEE  296
            TILPDLGTEI IPVCA++GI F+LVQW  VS+VKLSP + A+ +++   KNG+++ LIEE
Sbjct  4    TILPDLGTEIFIPVCAVIGIVFSLVQWYYVSQVKLSPGRDAAHNNSAGSKNGYSDYLIEE  63

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+NDHNVV KCAEIQSAISEGATSFLFTEY+YVGIFMV FA+LIFVFLGSVE FST  
Sbjct  64   EEGVNDHNVVIKCAEIQSAISEGATSFLFTEYKYVGIFMVLFAVLIFVFLGSVESFSTKP  123

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            QPCTYD+T+ CKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  124  QPCTYDKTRTCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  168



>ref|XP_010097186.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
 gb|EXB67253.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus 
notabilis]
Length=765

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  299
             S +L DL TEI+IPVCA+VGI F+LVQW LVS+VKL+PE++   +  KNG+++ LIEEE
Sbjct  2    GSPLLSDLATEIVIPVCAVVGIVFSLVQWFLVSRVKLTPERNPPSTGNKNGYSDYLIEEE  61

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EG+NDHNVV KCAEIQSAISEGATSFL TEYQYVGIFM+AFAILIF+FLGSVEGFST S+
Sbjct  62   EGLNDHNVVVKCAEIQSAISEGATSFLLTEYQYVGIFMIAFAILIFLFLGSVEGFSTKSR  121

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTYDE K CKPALATAVFST+SFLLGA+TSV+SG+LGMKIATY
Sbjct  122  PCTYDELKTCKPALATAVFSTLSFLLGAITSVLSGYLGMKIATY  165



>gb|KDO73437.1| hypothetical protein CISIN_1g004159mg [Citrus sinensis]
Length=705

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  278
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVIKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQ CTYD  K+CKPALATA FST+SFLLG +TSVVSGFLGMKIAT+
Sbjct  120  GFSTKSQACTYDPFKMCKPALATAAFSTVSFLLGGITSVVSGFLGMKIATF  170



>ref|XP_004173355.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like, 
partial [Cucumis sativus]
Length=543

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  284
            MGA TILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA LIFVFLGSVEGF
Sbjct  60   LIEEEEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAALIFVFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST  QPC+YD+TK CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  STKPQPCSYDKTKTCKPALATATFSTISFLLGAVTSVVSGFLGMKIATY  168



>emb|CDO98179.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            +LPDLGTEI+IPVCA++GI F+L+QW+LVS+VKLSPE+  +++++KNGF + LIEEEEGI
Sbjct  3    LLPDLGTEIVIPVCAVIGIIFSLIQWVLVSRVKLSPERKEANNNSKNGFNDCLIEEEEGI  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            N+ NVV +CA IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST SQPCT
Sbjct  63   NEQNVVLECANIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTKSQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y++ K CKPALATA FST+SFLLGA TSV+SGFLGMKIAT+
Sbjct  123  YNKEKFCKPALATAAFSTVSFLLGAFTSVISGFLGMKIATF  163



>gb|KJB64658.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=542

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-EKSASDSDAKNGFAESLIEE  296
             S+ILPDLG EILIPVCA++GI F+L QW+LVS VKLSP     + +  KNG+++ LIEE
Sbjct  2    GSSILPDLGAEILIPVCAVIGIVFSLAQWLLVSNVKLSPGSPGNNGAGGKNGYSDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST S
Sbjct  62   EEGLNDHNVVIKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKS  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            QPCTYD++K+CKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  122  QPCTYDKSKMCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  166



>ref|XP_010244912.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nelumbo nucifera]
Length=765

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 149/166 (90%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ IL DL TEILIPVCA++GI F+LVQW+LVS+VKLSPE+  S +++KNG+ + LIE
Sbjct  1    MGAA-ILSDLATEILIPVCAVIGIVFSLVQWLLVSRVKLSPERQTSSNNSKNGYNDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHN+V KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNIVTKCADIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY+    CKPALA A+FST+SF+LGA TSVVSGFLGMKIAT+
Sbjct  120  SQPCTYNPDITCKPALANAIFSTVSFILGAFTSVVSGFLGMKIATF  165



>gb|KDO73436.1| hypothetical protein CISIN_1g004159mg [Citrus sinensis]
Length=771

 Score =   268 bits (684),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 6/171 (4%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-----AKNGFA  278
            MGA+ ILPDLG EILIPVCA++GIAFALVQW+LVS +KLSP + AS +       KNG  
Sbjct  1    MGAA-ILPDLGAEILIPVCAVIGIAFALVQWVLVSNIKLSPARDASGNSPGAGGGKNGCT  59

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVE
Sbjct  60   DYLIEEEEGLNDHNVVIKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVE  119

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQ CTYD  K+CKPALATA FST+SFLLG +TSVVSGFLGMKIAT+
Sbjct  120  GFSTKSQACTYDPFKMCKPALATAAFSTVSFLLGGITSVVSGFLGMKIATF  170



>ref|XP_006341399.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Solanum tuberosum]
Length=767

 Score =   268 bits (684),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 148/166 (89%), Gaps = 2/166 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIE  293
             S +LPDLGTEI+IPVCA+VGI F+L QW LVS+VK+S E+ A+   ++ KNG+ + LIE
Sbjct  2    GSALLPDLGTEIVIPVCAVVGIVFSLFQWYLVSRVKVSSERGATSPSNNNKNGYGDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGIND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  62   EEEGINDQNVVAKCAEIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             QPCTY++ K+CKPALATA+FSTISFLLGAVTSV+SGFLGMKIATY
Sbjct  122  GQPCTYNKEKMCKPALATAIFSTISFLLGAVTSVISGFLGMKIATY  167



>gb|KJB56582.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
 gb|KJB56583.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
Length=716

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 151/166 (91%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA  +L +  TEI++PVCA++GIAF+LVQW+LVS+VKL+PE+ AS +  KNG+++ LIE
Sbjct  2    MGA-VLLSEFATEIVVPVCAVIGIAFSLVQWLLVSRVKLNPERHASGNSNKNGYSDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND +VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFS+ 
Sbjct  61   EEEGLNDPSVVTKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSSK  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD+ K CKPALATA+FSTISFLLGA+TSV+SGFLGMKIATY
Sbjct  121  SQPCTYDKEKTCKPALATAIFSTISFLLGAITSVLSGFLGMKIATY  166



>ref|XP_009593516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana tomentosiformis]
Length=769

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  287
             S +LPDLGT+I+IPVCA++GI F+LVQW LVS+VK+S E+ A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSLVQWYLVSRVKVSSERGATSPSSNKNNKNGYGDCL  61

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEGINDHNVV KCA+IQ+AISEGATSFLFTEYQYVGIFM+ FAILIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHNVVAKCADIQNAISEGATSFLFTEYQYVGIFMIVFAILIFLFLGSVEGFS  121

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTY++ K CKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  122  TSSQPCTYNKEKRCKPALATAIFSTLSFLLGAITSVISGFLGMKIATY  169



>gb|KJB56580.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
 gb|KJB56581.1| hypothetical protein B456_009G126900 [Gossypium raimondii]
Length=766

 Score =   267 bits (682),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 151/166 (91%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA  +L +  TEI++PVCA++GIAF+LVQW+LVS+VKL+PE+ AS +  KNG+++ LIE
Sbjct  2    MGA-VLLSEFATEIVVPVCAVIGIAFSLVQWLLVSRVKLNPERHASGNSNKNGYSDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND +VV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFS+ 
Sbjct  61   EEEGLNDPSVVTKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSSK  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD+ K CKPALATA+FSTISFLLGA+TSV+SGFLGMKIATY
Sbjct  121  SQPCTYDKEKTCKPALATAIFSTISFLLGAITSVLSGFLGMKIATY  166



>gb|ADN96173.1| pyrophosphate-energized vacuolar membrane proton pump [Gossypium 
hirsutum]
Length=766

 Score =   267 bits (682),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 155/167 (93%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  290
            MGA+ +L +L TEI++PVCA++GIAF+LVQW++VS+VKL+ E+ AS +++ KNG+ + LI
Sbjct  1    MGAA-MLSELATEIVVPVCAVIGIAFSLVQWVMVSRVKLTSERHASSANSSKNGYGDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST
Sbjct  60   EEEEGINDHSVVTKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTYD+ K+CKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  120  KSQPCTYDKEKMCKPALATAIFSTVSFLLGAITSVLSGFLGMKIATY  166



>ref|XP_010928300.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Elaeis guineensis]
Length=765

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ IL DL TEILIPV A+VGI F+LVQW+LVSKVK+SPE+    S  KNG+ + LIE
Sbjct  1    MGAA-ILSDLLTEILIPVAAVVGIVFSLVQWMLVSKVKVSPERQPPASGNKNGYTDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVVVKCADIQSAISEGATSFLFTEYQYVGLFMVAFAILIFLFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY + K CKPALA A+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  120  SQPCTYSKDKTCKPALANAIFSTVSFLLGAITSVVSGFLGMKIATY  165



>ref|XP_003531725.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Glycine max]
Length=768

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 154/169 (91%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAES  284
            MGA+ +L +L TEI++PVCA++GI F+LVQW LVS+VKL+P+++ + S   + KNG+ + 
Sbjct  1    MGAA-LLSELATEIVVPVCAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNNKNGYGDF  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGF
Sbjct  60   LIEEEEGINDHSVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST SQPCTYD++KLCKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  120  STKSQPCTYDKSKLCKPALATALFSTVSFLLGAITSVLSGFLGMKIATY  168



>ref|XP_009358552.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Pyrus x bretschneideri]
Length=767

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  284
            MGA TILPDLG EILIP+CA++GIAF+LVQW+ VS+VKLSP     S S   AKNG+ + 
Sbjct  1    MGA-TILPDLGAEILIPLCAVIGIAFSLVQWMYVSQVKLSPGGGRDSNSGGAAKNGYNDY  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG NDHNVV +CAEIQ+AISEGATSFLFTEY+YVG FMVAFAILIF+FLGSVEGF
Sbjct  60   LIEEEEGGNDHNVVLRCAEIQTAISEGATSFLFTEYKYVGAFMVAFAILIFLFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST  + CTYD+TK+CKPALATA+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  120  STSGRACTYDQTKICKPALATAIFSTVSFLLGAITSVVSGFLGMKIATY  168



>ref|XP_010913343.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=765

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  299
             + IL DL TEILIPV A+VGI FAL+QW+LVSKVKLSPE+    S  KNG+ + LIEEE
Sbjct  2    GTAILSDLLTEILIPVAAVVGIVFALIQWMLVSKVKLSPEQHPPASGNKNGYTDYLIEEE  61

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EG+NDHN+V KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST SQ
Sbjct  62   EGLNDHNIVVKCADIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTKSQ  121

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTY + K CKPALA A+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  122  PCTYSKDKTCKPALANAIFSTVSFLLGAITSVVSGFLGMKIATY  165



>ref|XP_007023298.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY25920.1| Inorganic H pyrophosphatase family protein isoform 2 [Theobroma 
cacao]
Length=769

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 151/164 (92%), Gaps = 3/164 (2%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAESLIEEE  299
            +L ++ TEI++PVCA++GIAF+LVQW+LVS+VKL+ E+ AS    S++KNG+++ LIEEE
Sbjct  5    VLSEMATEIVVPVCAVIGIAFSLVQWVLVSRVKLTSERHASGGSGSNSKNGYSDYLIEEE  64

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST SQ
Sbjct  65   EGINDHSVVTKCADIQTAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTKSQ  124

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTYD+ K CKPALATA+FST+SFLLGAVTSV+SGFLGMKIATY
Sbjct  125  PCTYDKEKACKPALATAIFSTVSFLLGAVTSVLSGFLGMKIATY  168



>ref|XP_007023297.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25919.1| Inorganic H pyrophosphatase family protein isoform 1 [Theobroma 
cacao]
Length=768

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 151/164 (92%), Gaps = 3/164 (2%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAESLIEEE  299
            +L ++ TEI++PVCA++GIAF+LVQW+LVS+VKL+ E+ AS    S++KNG+++ LIEEE
Sbjct  5    VLSEMATEIVVPVCAVIGIAFSLVQWVLVSRVKLTSERHASGGSGSNSKNGYSDYLIEEE  64

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST SQ
Sbjct  65   EGINDHSVVTKCADIQTAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTKSQ  124

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTYD+ K CKPALATA+FST+SFLLGAVTSV+SGFLGMKIATY
Sbjct  125  PCTYDKEKACKPALATAIFSTVSFLLGAVTSVLSGFLGMKIATY  168



>gb|KJB35139.1| hypothetical protein B456_006G102100 [Gossypium raimondii]
Length=766

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 154/167 (92%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  290
            MGA+ +L +L TEI++PVCA++GIAF+LVQW++VS+VKL+ E+ AS +++ KNG+ + LI
Sbjct  1    MGAA-MLSELATEIVVPVCAVIGIAFSLVQWVMVSRVKLTSERHASSANSSKNGYGDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFS 
Sbjct  60   EEEEGINDHSVVTKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSM  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTYD+ K+CKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  120  KSQPCTYDKEKMCKPALATAIFSTVSFLLGAITSVLSGFLGMKIATY  166



>gb|EYU40132.1| hypothetical protein MIMGU_mgv1a001763mg [Erythranthe guttata]
Length=762

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 149/166 (90%), Gaps = 4/166 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M  ST+L DLGT+I+IPVCA+VGIAFAL+QW  V+KVK+S EKS    DAKNGF+E LIE
Sbjct  1    MAESTLLTDLGTQIIIPVCALVGIAFALLQWYFVAKVKVSSEKS----DAKNGFSEPLIE  56

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EE+G++DH VV+KCAEIQ+AISEG+TSFL+TEY+YVGIFMVAFA++IFVFLGSVEGFST 
Sbjct  57   EEDGVSDHAVVRKCAEIQAAISEGSTSFLYTEYKYVGIFMVAFAVVIFVFLGSVEGFSTK  116

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             Q CTYD TKLCKPALATA FSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  117  PQTCTYDATKLCKPALATAAFSTISFILGAVTSVISGFLGMKIATY  162



>ref|XP_004241690.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=767

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 147/166 (89%), Gaps = 2/166 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESLIE  293
             S +L + GTEI+IP+CA++GI F+LVQW LVS VKLSPE+   +  ++  NGF ESL+E
Sbjct  2    GSALLSEFGTEIVIPICAVIGIVFSLVQWYLVSLVKLSPEQGGCSPRNNKNNGFNESLVE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGIND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIFVFLGSVEGFST 
Sbjct  62   EEEGINDQNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFVFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY++ K+CKPALATA+FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  122  SQPCTYNKEKMCKPALATAIFSTISFLLGAVTSVVSGFLGMKIATY  167



>gb|KDP37047.1| hypothetical protein JCGZ_06103 [Jatropha curcas]
Length=765

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  299
             S +L +LGTEIL+PVCA+VGI F+L+QW LVS+V L+ E+ A     KNG+ + LIEEE
Sbjct  2    GSALLSELGTEILVPVCAVVGIVFSLIQWYLVSRVTLTSERHAPGGANKNGYNDYLIEEE  61

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EG+NDH+VV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIFVFLGSVEGFST S+
Sbjct  62   EGLNDHSVVTKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFVFLGSVEGFSTKSR  121

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTYD  K CKPALATAVFST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  122  PCTYDSQKTCKPALATAVFSTVSFLLGAITSVLSGFLGMKIATY  165



>ref|XP_003528302.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Glycine max]
Length=768

 Score =   265 bits (676),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 153/169 (91%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAES  284
            MGA+ +L +L TEI++P CA++GI F+LVQW LVS+VKL+P+++ + S   + KNG+ + 
Sbjct  1    MGAA-LLSELATEIVVPACAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNNKNGYGDF  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGF
Sbjct  60   LIEEEEGINDHSVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST SQPCTYD++KLCKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  120  STKSQPCTYDKSKLCKPALATALFSTVSFLLGAITSVLSGFLGMKIATY  168



>gb|KHG25943.1| Pyrophosphate-energized vacuolar membrane proton pump 1 -like 
protein [Gossypium arboreum]
Length=766

 Score =   265 bits (676),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 154/167 (92%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  290
            MGA+ +L ++ TEI++PVCA++GIAF+LVQW++VS+VKL+ E+ AS +++ KNG+ + LI
Sbjct  1    MGAA-MLSEMATEIVVPVCAVIGIAFSLVQWVMVSRVKLTSERHASSANSSKNGYGDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEGINDH+VV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFS 
Sbjct  60   EEEEGINDHSVVTKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSM  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTYD+ K+CKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  120  KSQPCTYDKEKMCKPALATAIFSTVSFLLGAITSVLSGFLGMKIATY  166



>gb|KJB64656.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=702

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-EKSASDSDAKNGFAESLIEE  296
             S+ILPDLG EILIPVCA++GI F+L QW+LVS VKLSP     + +  KNG+++ LIEE
Sbjct  2    GSSILPDLGAEILIPVCAVIGIVFSLAQWLLVSNVKLSPGSPGNNGAGGKNGYSDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST S
Sbjct  62   EEGLNDHNVVIKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKS  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            QPCTYD++K+CKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  122  QPCTYDKSKMCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  166



>ref|XP_004235902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Solanum lycopersicum]
Length=767

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 149/166 (90%), Gaps = 2/166 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK--SASDSDAKNGFAESLIE  293
             S +LPDLGTEI+IPVCA+VGI F+L QW +VS+VK+S E+  ++  ++ KNG+ + LIE
Sbjct  2    GSALLPDLGTEIVIPVCAVVGIVFSLYQWYVVSRVKVSSERGDTSPSNNNKNGYGDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND NVV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFST 
Sbjct  62   EEEGVNDQNVVAKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY++ K+CKPALATA+FSTISFLLGA+TSV+SGFLGMKIATY
Sbjct  122  SQPCTYNKEKMCKPALATAIFSTISFLLGAITSVISGFLGMKIATY  167



>ref|XP_006427442.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40682.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=683

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  296
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEGIND +VV KCA+IQSAISEGATSFLFTEYQYVG+FM+AFAILIFVFLGSVEGFST  
Sbjct  62   EEGINDQSVVAKCADIQSAISEGATSFLFTEYQYVGVFMIAFAILIFVFLGSVEGFSTKG  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Q CTYD+ K+CKPALATA FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  122  QACTYDQQKMCKPALATAAFSTVSFLLGAITSVLSGFLGMKIATY  166



>ref|XP_008343930.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Malus domestica]
Length=764

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA TILPDL  EILIP+CA++GIAF+L QW+ VS+VKLSP      +  KNG  E LIE
Sbjct  1    MGA-TILPDLWAEILIPLCAVIGIAFSLXQWMYVSQVKLSPGGGRDSNSGKNGHNEYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGGNDHNVVLKCAEIQNAISEGATSFLFTEYRYVGAFMVAFAILIFLFLGSVEGFSTS  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            S+ CTYD+TK CKPALATA+FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  SRACTYDQTKTCKPALATAIFSTISFLLGAVTSVVSGFLGMKIATY  165



>emb|CAA54869.1| inorganic pyrophosphatase [Nicotiana tabacum]
Length=764

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  287
             S +LPDLGT+I+IPVCA++GI F+  QW LVS+VK+S E  A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSSFQWYLVSRVKVSSEHGATSPSSNKNNKNGYGDCL  61

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEGINDHNVV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHNVVAKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFS  121

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTY++ K CKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  122  TSSQPCTYNKEKRCKPALATAIFSTVSFLLGAITSVISGFLGMKIATY  169



>ref|XP_009765177.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nicotiana sylvestris]
Length=769

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESL  287
             S +LPDLGT+I+IPVCA++GI F+  QW LVS+VK+S E  A    S+ + KNG+ + L
Sbjct  2    GSALLPDLGTQIVIPVCAVIGIVFSSFQWYLVSRVKVSSEHGATSPSSNKNNKNGYGDCL  61

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEGINDHNVV KCA+IQ+AISEGATSFLFTEYQYVGIFM+AFAILIF+FLGSVEGFS
Sbjct  62   IEEEEGINDHNVVAKCADIQNAISEGATSFLFTEYQYVGIFMIAFAILIFLFLGSVEGFS  121

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTY++ K CKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  122  TSSQPCTYNKEKRCKPALATAIFSTVSFLLGAITSVISGFLGMKIATY  169



>ref|XP_004287260.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar 
membrane proton pump-like [Fragaria vesca subsp. vesca]
Length=765

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 148/167 (89%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLI  290
            MGAS ILPDLG EILIP CA+VGI F+L+QW+ VS+V+LSP + S S+S  KNG+ + LI
Sbjct  1    MGAS-ILPDLGAEILIPFCAVVGIVFSLLQWVYVSRVQLSPARDSNSNSTGKNGYNDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+ND+NVVQKCAEIQ+AISEGATSFL+TEY+YVG FMVAFAILIFVFLGSVEGFST
Sbjct  60   EEEEGVNDNNVVQKCAEIQNAISEGATSFLYTEYKYVGAFMVAFAILIFVFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
                C  DETK+CKPALATA+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  120  SGHKCANDETKMCKPALATALFSTVSFLLGAITSVVSGFLGMKIATY  166



>gb|AAM97920.1| vacuolar proton-pumping PPase [Oxybasis rubra]
 gb|AAM97921.1| vacuolar proton-pumping PPase [Oxybasis rubra]
Length=764

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            +LPDLGTEILIPVCA++GI F+L+QW +VS+VKLSP+   S+++ KNGF+E+LIEEEEGI
Sbjct  5    LLPDLGTEILIPVCAVIGIVFSLIQWYVVSQVKLSPDSGRSNNN-KNGFSENLIEEEEGI  63

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            ND +VV KCAEIQ+AISEG+TSFL+T YQYVGIFM+AFA+LIFVFLGSVEGFST SQ CT
Sbjct  64   NDQSVVAKCAEIQNAISEGSTSFLYTMYQYVGIFMIAFAVLIFVFLGSVEGFSTKSQECT  123

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            YD++K CKPALATA+FST+SFLLGAVTS+ SGFLGMKIATY
Sbjct  124  YDKSKTCKPALATAIFSTVSFLLGAVTSLASGFLGMKIATY  164



>gb|AAS66771.1| PPase [Hevea brasiliensis]
Length=769

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA----KNGFAESL  287
             + +L +LGTEIL+PVCA+VGI F+L+QW LVS+VKL+PE+ A  S      KNG+ + L
Sbjct  2    GTAVLSELGTEILVPVCAVVGIVFSLIQWYLVSRVKLTPERQAPGSSPAGANKNGYNDCL  61

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+NDH+VV KCAEI++AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFS
Sbjct  62   IEEEEGLNDHSVVAKCAEIRTAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFS  121

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTYD+ K CKPALATA+FST+SFLLGA TSVVSGFLGMKIATY
Sbjct  122  TKSQPCTYDKQKTCKPALATAIFSTVSFLLGAFTSVVSGFLGMKIATY  169



>ref|XP_008352108.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Malus domestica]
Length=767

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  284
            MGA TILPDLG EILIP+CA++GIAF+L QW+ VS+VKLSP     S S    KNG+ + 
Sbjct  1    MGA-TILPDLGAEILIPLCAVIGIAFSLXQWMYVSQVKLSPGGGRDSNSGGADKNGYNDY  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG NDHNVV +CAEIQ+AISEGATSFLFTEY+YVG FMVAFAILIF+FLGSVEGF
Sbjct  60   LIEEEEGGNDHNVVLRCAEIQTAISEGATSFLFTEYKYVGAFMVAFAILIFLFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST S+ CTYD+TK+CKPALATA+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  120  STSSRACTYDQTKICKPALATAIFSTVSFLLGAITSVVSGFLGMKIATY  168



>ref|XP_004150506.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Cucumis sativus]
 gb|KGN65098.1| hypothetical protein Csa_1G212840 [Cucumis sativus]
Length=768

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  284
            MGA TILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA LIFVFLGSVEGF
Sbjct  60   LIEEEEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAALIFVFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST  QPC+YD+TK CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  STKPQPCSYDKTKTCKPALATATFSTISFLLGAVTSVVSGFLGMKIATY  168



>gb|ABK91685.1| vacuolar H+-pyrophosphatase [Kalidium foliatum]
Length=764

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+ S   +++KNG AESLIEE+EG+
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPD-SGLGNNSKNGIAESLIEEKEGL  63

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDH+VV KCAEIQ+AISEGATSFL+TEYQYVGIFMVAFA+LIF+FLGSVEGFST SQ CT
Sbjct  64   NDHSVVAKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAVLIFLFLGSVEGFSTSSQECT  123

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            YD+T+ CKPALATA+FST+SFLLGAVTS+ SGFLGMKIATY
Sbjct  124  YDKTRRCKPALATAIFSTVSFLLGAVTSLASGFLGMKIATY  164



>gb|KJB64657.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=733

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-EKSASDSDAKNGFAESLIEE  296
             S+ILPDLG EILIPVCA++GI F+L QW+LVS VKLSP     + +  KNG+++ LIEE
Sbjct  2    GSSILPDLGAEILIPVCAVIGIVFSLAQWLLVSNVKLSPGSPGNNGAGGKNGYSDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST S
Sbjct  62   EEGLNDHNVVIKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKS  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            QPCTYD++K+CKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  122  QPCTYDKSKMCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  166



>gb|KJB64655.1| hypothetical protein B456_010G059800 [Gossypium raimondii]
Length=766

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-EKSASDSDAKNGFAESLIEE  296
             S+ILPDLG EILIPVCA++GI F+L QW+LVS VKLSP     + +  KNG+++ LIEE
Sbjct  2    GSSILPDLGAEILIPVCAVIGIVFSLAQWLLVSNVKLSPGSPGNNGAGGKNGYSDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST S
Sbjct  62   EEGLNDHNVVIKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTKS  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            QPCTYD++K+CKPALATA+FST+SFLLGAVTSVVSGFLGMKIATY
Sbjct  122  QPCTYDKSKMCKPALATAIFSTVSFLLGAVTSVVSGFLGMKIATY  166



>ref|XP_008443926.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Cucumis melo]
Length=768

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  284
            MGA TILPDLG +I IP+CAI+GI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGA-TILPDLGAQIFIPLCAIIGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA LIFVFLGSVEGF
Sbjct  60   LIEEEEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAALIFVFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST  QPC+YD+TK CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  STKPQPCSYDKTKTCKPALATATFSTISFLLGAVTSVVSGFLGMKIATY  168



>gb|AEI17665.1| vacuolar H+-pyrophosphatase [Salicornia europaea]
Length=764

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 148/161 (92%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   ++ ++KNG AESLIEEEEG+
Sbjct  5    LLPDLGTEIIVPACAVIGILFSLIQWYIVSQVKLSPDSGLAN-NSKNGIAESLIEEEEGL  63

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDH+VV KCAEIQ+AISEGATSFL+TEYQYVGIFMVAFA+LIF+FLGSVEGFST +Q CT
Sbjct  64   NDHSVVAKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAVLIFLFLGSVEGFSTSTQECT  123

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            YD+T+ CKPALATA+FST+SFLLGAVTS+ SGFLGMKIATY
Sbjct  124  YDKTRRCKPALATAIFSTVSFLLGAVTSLASGFLGMKIATY  164



>ref|XP_006427443.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40683.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=746

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  296
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEGIND +VV KCA+IQSAISEGATSFLFTEYQYVG+FM+AFAILIFVFLGSVEGFST  
Sbjct  62   EEGINDQSVVAKCADIQSAISEGATSFLFTEYQYVGVFMIAFAILIFVFLGSVEGFSTKG  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Q CTYD+ K+CKPALATA FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  122  QACTYDQQKMCKPALATAAFSTVSFLLGAITSVLSGFLGMKIATY  166



>ref|XP_009392139.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 148/167 (89%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLI  290
            MGA TILPDL T+ILIP  A+VGIAFALVQW+LVSKVKLSPE+ +S + + KNG+++ LI
Sbjct  1    MGA-TILPDLLTQILIPATAVVGIAFALVQWLLVSKVKLSPERESSGAGNNKNGYSDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+N+HNVV KCAEIQSAISEGATSFL TEYQYVG+FM  FAILIF+FLGSVEGFST
Sbjct  60   EEEEGLNNHNVVVKCAEIQSAISEGATSFLVTEYQYVGVFMAVFAILIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTY + K+CKP LA A+FST+SFLLGA TSVVSGFLGMKIATY
Sbjct  120  KSQPCTYSKDKICKPVLANAIFSTLSFLLGAFTSVVSGFLGMKIATY  166



>ref|XP_006427441.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
 gb|ESR40681.1| hypothetical protein CICLE_v10024946mg [Citrus clementina]
Length=766

 Score =   262 bits (670),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFAESLIEE  296
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+ ++S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPTSSNSDKKNGFNDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEGIND +VV KCA+IQSAISEGATSFLFTEYQYVG+FM+AFAILIFVFLGSVEGFST  
Sbjct  62   EEGINDQSVVAKCADIQSAISEGATSFLFTEYQYVGVFMIAFAILIFVFLGSVEGFSTKG  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Q CTYD+ K+CKPALATA FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  122  QACTYDQQKMCKPALATAAFSTVSFLLGAITSVLSGFLGMKIATY  166



>gb|ADD51840.1| pyrophosphatase [Cucumis sativus]
Length=768

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 148/169 (88%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  284
            MGA+ ILPDLG +I IP+CAIVGI F+LVQW  VS+VKLS  + +++   S AKNG+++ 
Sbjct  1    MGAA-ILPDLGAQIFIPLCAIVGILFSLVQWYYVSQVKLSSARDSANNNSSSAKNGYSDY  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA LIFVFLGSVEGF
Sbjct  60   LIEEEEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAALIFVFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST  QPC+YD+TK CKPALATA FSTISFLLGAVTSVVSGFLGMKIATY
Sbjct  120  STKPQPCSYDKTKTCKPALATATFSTISFLLGAVTSVVSGFLGMKIATY  168



>ref|XP_008788803.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Phoenix dactylifera]
Length=765

 Score =   262 bits (669),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ IL DL TEILIPV A+VGI F+L QW+LVSKVKLSPE+       KN + + LIE
Sbjct  1    MGAA-ILSDLLTEILIPVAAVVGIVFSLFQWMLVSKVKLSPERQTPARGNKNDYTDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCA+IQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVVVKCADIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY + K CKPALA A+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  120  SQPCTYSKDKTCKPALANAIFSTVSFLLGAITSVVSGFLGMKIATY  165



>gb|KHN38003.1| Pyrophosphate-energized vacuolar membrane proton pump [Glycine 
soja]
Length=764

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 150/166 (90%), Gaps = 2/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ +L +L TEI++PVCA++GI F+LVQW LVS+VKL+P+++ + S  +N     LIE
Sbjct  1    MGAA-LLSELATEIVVPVCAVIGIVFSLVQWFLVSRVKLTPDRNGTTSSPRNN-KNGLIE  58

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGINDH+VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFAILIF+FLGSVEGFST 
Sbjct  59   EEEGINDHSVVVKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAILIFLFLGSVEGFSTK  118

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD++KLCKPALATA+FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  119  SQPCTYDKSKLCKPALATALFSTVSFLLGAITSVLSGFLGMKIATY  164



>gb|AGQ50316.1| vaculoar H+ pyrophosphatase [Prosopis juliflora]
Length=764

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEE  299
             S +LPDLGTEILIPVCA++GI FAL QWILVS+VKLS   S S  ++KNG+ + LIEEE
Sbjct  2    GSALLPDLGTEILIPVCAVIGIGFALFQWILVSRVKLS-ASSDSSPNSKNGYNDYLIEEE  60

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EGINDH+VV KCAEIQ AISEGATSFLFTEY+YVGIFMVAFAILIF+FLGSVEGFST  Q
Sbjct  61   EGINDHSVVIKCAEIQGAISEGATSFLFTEYKYVGIFMVAFAILIFLFLGSVEGFSTSQQ  120

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTYD+TK+CKPALATA+FST SF+LGA+TSV+SGFLGMKIATY
Sbjct  121  PCTYDKTKMCKPALATAIFSTASFVLGAITSVISGFLGMKIATY  164



>gb|EYU34952.1| hypothetical protein MIMGU_mgv1a001747mg [Erythranthe guttata]
Length=765

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 150/166 (90%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M  +T+L DLGT+I+IP+CA+VGI FALVQW+LV+KVK+S  KS S +D  NGF E+LIE
Sbjct  1    MAEATLLSDLGTQIIIPICALVGIVFALVQWMLVAKVKISTGKSNS-ADGNNGFTEALIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGI++H+V++KCA+IQ+AISEG+TSFLFT YQYVGIFMVAFA+LIF+FLGSV+GFST 
Sbjct  60   EEEGISEHSVIRKCADIQAAISEGSTSFLFTMYQYVGIFMVAFALLIFLFLGSVKGFSTS  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             QPC YD TK+CKPALATAVFST++FLLGAVTSV+SGFLGMKIATY
Sbjct  120  HQPCAYDSTKMCKPALATAVFSTVAFLLGAVTSVISGFLGMKIATY  165



>ref|XP_006492091.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Citrus sinensis]
Length=766

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS-ASDSDAKNGFAESLIEE  296
             ST+L +L TEIL+PVCA+VGI F+LVQW +VS+V+L+ E+  +S+SD KNGF + LIEE
Sbjct  2    GSTLLSELATEILVPVCAVVGIIFSLVQWFIVSRVRLTHERPPSSNSDKKNGFNDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEGIND +VV KCA+IQSAISEGATSFLFTEYQYVG+FM+AFAILIFVFLGSVEGFST  
Sbjct  62   EEGINDQSVVAKCADIQSAISEGATSFLFTEYQYVGVFMIAFAILIFVFLGSVEGFSTKG  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Q CTYD+ K+CKPALATA FST+SFLLGA+TSV+SGFLGMKIATY
Sbjct  122  QACTYDQQKMCKPALATAAFSTVSFLLGAITSVLSGFLGMKIATY  166



>ref|XP_008795832.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=765

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ IL DL T ILIPV A+VGI FALVQW  VSKVKLSPE+    S  KNG+++ LIE
Sbjct  1    MGAA-ILSDLLTVILIPVAAVVGIVFALVQWTFVSKVKLSPEQQPPASGNKNGYSDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCA+IQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVVVKCADIQTAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTY + K CKPALA A+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  120  SQPCTYSKDKTCKPALANAIFSTVSFLLGAITSLVSGFLGMKIATY  165



>ref|XP_010050115.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Eucalyptus grandis]
 gb|KCW82997.1| hypothetical protein EUGRSUZ_C04383 [Eucalyptus grandis]
Length=768

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 3/167 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAESLI  290
            A+TIL DLG EILIPVCA+VGI F+LVQW+LVSKVKL+P  +A+    ++ KNG+ + LI
Sbjct  2    ATTILSDLGAEILIPVCAVVGIVFSLVQWLLVSKVKLTPADAAAAPAANNGKNGYTDYLI  61

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            +EEE INDH+VV KCAEIQ+AISEGATSFLFTEYQYVG+FMVAFA+LIF+FLGSVEGFS 
Sbjct  62   DEEENINDHSVVLKCAEIQTAISEGATSFLFTEYQYVGVFMVAFAVLIFLFLGSVEGFSM  121

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTYD TKLCKPALATAVFST++FLLG +TSVVSGFLGMKIATY
Sbjct  122  KSQPCTYDATKLCKPALATAVFSTVAFLLGGITSVVSGFLGMKIATY  168



>ref|XP_009403196.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=763

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 145/166 (87%), Gaps = 3/166 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M A+ IL  L TEILIP  A+VGIAFALVQW+LVSKVKLSPE SAS   +K+G ++ LIE
Sbjct  1    MAAAAILSGLLTEILIPAAAVVGIAFALVQWLLVSKVKLSPEDSAS---SKDGVSDYLIE  57

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  58   EEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTK  117

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            +QPCTY + K CKPALA A FSTISFLLGA TS+VSGFLGMKIATY
Sbjct  118  AQPCTYSKDKYCKPALANAGFSTISFLLGATTSLVSGFLGMKIATY  163



>ref|XP_010927355.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Elaeis guineensis]
Length=767

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 144/163 (88%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESLIEEEE  302
            IL DL TEILIPV A+VGI FAL+QW++VS+VKLSPE+    + S  KN +++ LIEEEE
Sbjct  5    ILADLLTEILIPVAAVVGIGFALMQWLMVSRVKLSPERQGPLAGSKNKNDYSDYLIEEEE  64

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            G+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAIL+F+FLGSVEGFST SQP
Sbjct  65   GLNDHNVVLKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILVFLFLGSVEGFSTKSQP  124

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CTY + K CKPALA AVFST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  125  CTYSKDKYCKPALANAVFSTVSFLLGAITSLVSGFLGMKIATY  167



>ref|XP_008801902.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=767

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 148/168 (88%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  287
            MGA+ IL DL TEILIPV A+VGI F+L+QW LVS+VKLSPE+    + S+ KN +++ L
Sbjct  1    MGAA-ILTDLLTEILIPVAAVVGIGFSLIQWGLVSRVKLSPERQGLPAGSNDKNDYSDYL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFMVAFAIL+F+FLGSVEGFS
Sbjct  60   IEEEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILVFLFLGSVEGFS  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTY + K CKPALA A+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  120  TKSQPCTYSKDKYCKPALANAIFSTVSFLLGAITSLVSGFLGMKIATY  167



>ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
 gb|EEF31615.1| Pyrophosphate-energized vacuolar membrane proton pump, putative 
[Ricinus communis]
Length=767

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 146/163 (90%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNG--FAESLIEEEE  302
            ILPDLGTEILIP+CAI+GI F+L+QW+LVSKVKL P   A +++  N   +++ LIEEEE
Sbjct  5    ILPDLGTEILIPICAIIGIGFSLIQWLLVSKVKLVPSGGAGNNNNNNKNGYSDYLIEEEE  64

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            G+NDHNVV KCA+IQ+AISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST SQP
Sbjct  65   GVNDHNVVLKCADIQNAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTKSQP  124

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CTYD+ K+CKPALATA FST+SFLLGA TSVVSGFLGMKIATY
Sbjct  125  CTYDQFKMCKPALATAAFSTVSFLLGAFTSVVSGFLGMKIATY  167



>ref|XP_009418179.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 144/165 (87%), Gaps = 1/165 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE-KSASDSDAKNGFAESLIEE  296
            A   L DL TE+LIPV A+VGI FALVQW+LVSKVKLSPE +S+   + KNG+++ LIEE
Sbjct  2    AVAFLSDLLTEVLIPVAAVVGIVFALVQWLLVSKVKLSPEGESSGTGNGKNGYSDYLIEE  61

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVGIFM  FA+LIF+FLGSVEGFST +
Sbjct  62   EEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGIFMAVFAVLIFLFLGSVEGFSTKN  121

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            QPCTY++ K CKPALA A+FST+SFLLGA TSVVSGFLGMKIATY
Sbjct  122  QPCTYNKDKTCKPALANAIFSTLSFLLGAFTSVVSGFLGMKIATY  166



>gb|ABS01290.1| tonoplast proton pump [Lotus corniculatus]
Length=767

 Score =   259 bits (663),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 146/169 (86%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---EKSASDSDAKNGFAES  284
            MGA  +LPDLGTEILIPVCA++GI FAL QW LVSKVK++    + ++ D+  KNG+ + 
Sbjct  1    MGA-VLLPDLGTEILIPVCAVIGIVFALFQWFLVSKVKITAATRDAASPDAAGKNGYNDY  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEGIND NVV KCAEIQ AISEGATSFLFTEY+YVGIFMV FAI+IF+FLGSVEGF
Sbjct  60   LIEEEEGINDQNVVLKCAEIQQAISEGATSFLFTEYKYVGIFMVFFAIVIFLFLGSVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST  QPC YDETK+CKPALATA+FSTISF+LG +TSVVSGFLGMKIATY
Sbjct  120  STSHQPCKYDETKICKPALATALFSTISFVLGGITSVVSGFLGMKIATY  168



>ref|XP_010687850.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   259 bits (662),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ +LPDL TEI+IPVCA++GIAF+L QW +VS+VKLSP+ S  +++ KNGF++SLIE
Sbjct  1    MGAA-LLPDLITEIIIPVCAVIGIAFSLFQWYIVSQVKLSPD-STRNNNNKNGFSDSLIE  58

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  59   EEEGLNDQSVVAKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTS  118

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQ CTYD+T+ CKPALATA+FST++FLLGA+TS+ SGF GMKIATY
Sbjct  119  SQECTYDKTRRCKPALATAIFSTVAFLLGAITSLGSGFFGMKIATY  164



>gb|EPS68114.1| inorganic pyrophosphatase, partial [Genlisea aurea]
Length=765

 Score =   259 bits (662),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD--SDAKNGFAESLIEEEE  302
            +LPDLG EILIP+CA++GI F+L QW LVSKVKL+P +  S   ++ +NG+ + LIEEEE
Sbjct  5    LLPDLGAEILIPLCAVIGIVFSLAQWFLVSKVKLTPGRGGSSAANNGRNGYRDHLIEEEE  64

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            G+ND +VV KCAEIQSAISEGATSFLFTEYQYVGIFMV FA LIF+FLGSV+GFST SQP
Sbjct  65   GLNDQSVVVKCAEIQSAISEGATSFLFTEYQYVGIFMVIFAALIFLFLGSVQGFSTKSQP  124

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CTYD+ K CKPALATAVFST SFLLGA+TSVVSGFLGMKIATY
Sbjct  125  CTYDQEKFCKPALATAVFSTASFLLGAITSVVSGFLGMKIATY  167



>ref|XP_010905999.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Elaeis guineensis]
Length=767

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  287
            MGA+ IL DL TEILIPV A+VGI FAL+QW LVS+VKLSPEK    + S+ KN +++ L
Sbjct  1    MGAA-ILTDLLTEILIPVAAVVGIGFALIQWGLVSRVKLSPEKQGPPAGSNNKNDYSDYL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+NDHN+V KCA+IQ AISEGATSFLFTEYQYVGIFMVAFAIL+F+FLGSVEGFS
Sbjct  60   IEEEEGLNDHNIVVKCADIQRAISEGATSFLFTEYQYVGIFMVAFAILVFLFLGSVEGFS  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTY + K CKPALA A+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  120  TKSQPCTYSKDKYCKPALANAIFSTVSFLLGAITSLVSGFLGMKIATY  167



>gb|AAA61610.1| pyrophosphatase [Beta vulgaris]
Length=765

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 151/166 (91%), Gaps = 2/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ +LPDL TEI+IPVCA++GIAF+L+QW +V +VKLSP+ S  +++ KNGF++SLIE
Sbjct  1    MGAA-LLPDLITEIIIPVCAVIGIAFSLLQWYIVLRVKLSPD-STRNNNNKNGFSDSLIE  58

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  59   EEEGLNDQSVVAKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTS  118

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQ CTYD+T+ CKPALATA+FST++FLLGA+TS+ SGF GMKIATY
Sbjct  119  SQECTYDKTRRCKPALATAIFSTVAFLLGAITSLGSGFFGMKIATY  164



>ref|XP_009407207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=766

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS-ASDSDAKNGFAESLI  290
            MGA+ +L D  TE+LIPV A+VGIAFALVQW+LVS VKLSPE+     S+ KNG+++ LI
Sbjct  1    MGAA-MLTDQVTEVLIPVAAVVGIAFALVQWLLVSTVKLSPERQPGGGSNDKNGYSDYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FM  FA+LIF+FLGSVEGFST
Sbjct  60   EEEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGVFMAVFAVLIFLFLGSVEGFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTY + K CKPALA A+FST SFLLGAVTSVVSGFLGMKIATY
Sbjct  120  KSQPCTYSKDKYCKPALANALFSTASFLLGAVTSVVSGFLGMKIATY  166



>ref|XP_002273207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Vitis vinifera]
 emb|CBI36393.3| unnamed protein product [Vitis vinifera]
Length=767

 Score =   257 bits (657),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNG--FAESLIE  293
             STIL DL TEI++PVCA++GI F+L+QW LVS++K+SP++ +S S+   G  + + LIE
Sbjct  2    GSTILSDLATEIVVPVCAVIGIVFSLIQWFLVSRIKVSPDRHSSSSNNGKGAGYGDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSV GFST 
Sbjct  62   EEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVNGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQ CTY+  ++CKPALATA+FST+SF+LGAVTSV+SGFLGMKIATY
Sbjct  122  SQVCTYNPQEMCKPALATAIFSTVSFMLGAVTSVISGFLGMKIATY  167



>gb|ABO45933.1| vacuolar H+-pyrophosphatase [Halostachys caspica]
Length=764

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   S+++ KNG AESLIEEEEG+
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPDSGISNNN-KNGIAESLIEEEEGL  63

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            +DH+VV KCAEIQ+AISEGATSFL+TEYQYVGIFMVAFA LI +FLGSVEGFST SQ CT
Sbjct  64   SDHSVVAKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAALILLFLGSVEGFSTSSQECT  123

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            YD+ + CKPALATA+FST+SFLLGA+TS+ SGFLGMKIATY
Sbjct  124  YDKARRCKPALATAIFSTVSFLLGAITSLASGFLGMKIATY  164



>gb|ADQ00196.1| vacuolar H+-PPase protein [Suaeda corniculata]
Length=764

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            +LPDLGTEI++P CA++GI F+L+QW +VS+VKLSP+   S+++ KNG AESLIEEEEG+
Sbjct  5    LLPDLGTEIIVPACAVIGIVFSLIQWYIVSQVKLSPDSGISNNN-KNGIAESLIEEEEGL  63

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            +DH+VV KCAEIQ+AISEGATSFL+TEYQYVGIFMVAFA LI +FLGSVEGFST SQ CT
Sbjct  64   SDHSVVAKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAALILLFLGSVEGFSTSSQECT  123

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            YD+ + CKPALATA+FST+SFLLGA+TS+ SGFLGMKIATY
Sbjct  124  YDKARRCKPALATAIFSTVSFLLGAITSLASGFLGMKIATY  164



>gb|AGJ81362.1| vacuolar H+ pyrophosphatase 1 [Brassica napus]
Length=768

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  287
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA +IFVFLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYQYVGVFMVFFAAIIFVFLGSVEGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T S+PCTYD TK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  TESKPCTYDSTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIATY  168



>ref|XP_002453419.1| hypothetical protein SORBIDRAFT_04g005710 [Sorghum bicolor]
 gb|EES06395.1| hypothetical protein SORBIDRAFT_04g005710 [Sorghum bicolor]
Length=766

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M A+ ILP+L T++LIPV A VGIAFA+VQW+LVSKV+L+PE+ A    AK+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQWVLVSKVRLTPERRADGGAAKSGPSDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST 
Sbjct  61   EEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTK  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  SQPCHYSKGKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  166



>ref|XP_008793954.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Phoenix dactylifera]
Length=767

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 145/168 (86%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA--SDSDAKNGFAESL  287
            MGA+ IL DL TEI+IPV A+VGI FAL+QW+LVS+VKLSPE+    + S  KNG ++ L
Sbjct  1    MGAA-ILTDLLTEIVIPVAAVVGIGFALMQWLLVSRVKLSPERQGPLAGSKNKNGCSDYL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ DHNVV KCAEIQSAI EGATSFLFTEYQYVGIFMVAFAIL+F+FLGSVEGFS
Sbjct  60   IEEEEGLTDHNVVVKCAEIQSAIYEGATSFLFTEYQYVGIFMVAFAILVFLFLGSVEGFS  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPC Y + K CKPALA AVFST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  120  TKSQPCAYSKDKYCKPALANAVFSTVSFLLGAITSLVSGFLGMKIATY  167



>ref|XP_009401376.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 144/166 (87%), Gaps = 4/166 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ IL  L TEILIPV A+VGIAFALVQW+LVSKV LSPEK A   D   G ++ LIE
Sbjct  1    MGAA-ILSGLLTEILIPVAAVVGIAFALVQWLLVSKVSLSPEKPAGSRD---GVSDYLIE  56

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST 
Sbjct  57   EEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTK  116

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            +QPCTY + K CKPALA A FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  117  AQPCTYSKDKYCKPALANAGFSTLSFLLGAITSLVSGFLGMKIATY  162



>gb|ABD98735.1| vacuolar H+-pyrophosphatase [Oxybasis glauca]
Length=763

 Score =   254 bits (650),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            +LPDLGTEILIPVCA++GI F+LVQW +V++VKLSP+   S+S+ KNG++ESLIEEE G+
Sbjct  5    LLPDLGTEILIPVCAVIGIVFSLVQWYIVAQVKLSPDSGRSNSN-KNGYSESLIEEE-GL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            ND  VV KCAEIQ+AISEG+TSFL+T YQYVG+FMVAFA+LIFVFLGSVEGFST SQ CT
Sbjct  63   NDPAVVAKCAEIQNAISEGSTSFLYTMYQYVGVFMVAFAVLIFVFLGSVEGFSTKSQECT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            YD++K CKPALATAVFST+SFLLGA+TS+ SGFLGMKIATY
Sbjct  123  YDKSKTCKPALATAVFSTVSFLLGAITSLASGFLGMKIATY  163



>ref|XP_009117814.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Brassica rapa]
Length=768

 Score =   254 bits (649),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  287
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA +IFVFLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYQYVGVFMVFFAAIIFVFLGSVEGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T S+PCTYD TK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  TESKPCTYDSTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIATY  168



>ref|XP_010691127.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   254 bits (648),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLIEEEEG  305
            ++ DL TEI IPVCA++GI F+LVQW LVSKVK+S ++  ++   AKNGF + LIEEEEG
Sbjct  1    MISDLATEIFIPVCAVIGIIFSLVQWFLVSKVKVSTDRHVNNGGSAKNGFNDYLIEEEEG  60

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
            +ND NVV KCAEIQ+AISEGATSFLFTEYQYVG+FM AFA+LIFVFLGSVEGFST SQPC
Sbjct  61   VNDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMCAFAVLIFVFLGSVEGFSTESQPC  120

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TY   K CKPALATA+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  121  TYSPLKKCKPALATALFSTVSFLLGAITSVVSGFLGMKIATY  162



>emb|CDY53310.1| BnaA09g56670D [Brassica napus]
Length=802

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  287
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYGDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA +IFVFLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYQYVGVFMVFFAAIIFVFLGSVEGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T S+PCTYD TK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  TESKPCTYDSTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIATY  168



>ref|XP_006852851.1| hypothetical protein AMTR_s00033p00195690 [Amborella trichopoda]
 gb|ERN14318.1| hypothetical protein AMTR_s00033p00195690 [Amborella trichopoda]
Length=765

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MGA+ IL +   EILIPV A++GI F+LVQW++V++VKLSP+  A  S +KNG+ + LIE
Sbjct  1    MGAA-ILSETLAEILIPVAAVIGIVFSLVQWLIVARVKLSPQAPAPSSKSKNGYTDYLIE  59

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST 
Sbjct  60   EEEGLNDHNVVVKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTK  119

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQ CTY + K CKPALA A+FST+SFLLGA+TSVVSG+LGMKIAT+
Sbjct  120  SQACTYSKDKTCKPALANAIFSTLSFLLGAITSVVSGYLGMKIATF  165



>ref|XP_009385121.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=771

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 141/163 (87%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK--SASDSDAKNGFAESLIEEEE  302
            ++ DL TE+LIPV ++VGI F+L+QW  VSKVKLSPE+    +    KNG+++ LIEEEE
Sbjct  5    MMSDLLTEVLIPVASVVGIFFSLLQWYFVSKVKLSPERQTRGAHDHGKNGYSDRLIEEEE  64

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            GINDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFMV FAILIF+FLGSVEGFST SQP
Sbjct  65   GINDHNVVVKCAEIQNAISEGATSFLFTEYKYVGIFMVVFAILIFLFLGSVEGFSTKSQP  124

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CTY + + CKPALA A+FST+SFLLGAVTS+VSGFLGMKIATY
Sbjct  125  CTYSKDRTCKPALANAIFSTLSFLLGAVTSIVSGFLGMKIATY  167



>ref|XP_009410369.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Musa acuminata subsp. malaccensis]
Length=767

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 147/168 (88%), Gaps = 3/168 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-SASDSDAKNGFA-ESL  287
            MGA+ +L  + TEILIPV A++GIAFAL+QW+LVS VKLSPE+ + +  + KNGFA + L
Sbjct  1    MGAA-MLTGVITEILIPVAAVIGIAFALLQWMLVSAVKLSPERQTPAGGNKKNGFAADFL  59

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEYQYVG+FM  FA+LIF+FLGSVEGFS
Sbjct  60   IEEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGVFMAVFAVLIFLFLGSVEGFS  119

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTY + K CKPALA AVFST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  120  TKSQPCTYSKDKFCKPALANAVFSTVSFLLGAITSVVSGFLGMKIATY  167



>emb|CDX87313.1| BnaA07g35600D [Brassica napus]
Length=769

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  287
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    DAKNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDAKNGNEDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSV+GFS
Sbjct  61   IEEEEGVNDESVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVLFAAIIFLFLGSVQGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  121  TKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  168



>ref|XP_010557616.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Tarenaya hassleriana]
Length=768

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 146/169 (86%), Gaps = 4/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAES  284
            MG + ILPDLGTEILIPVCA++GI FA  QW LVS+VKL P  +A+ +++   KNG+ + 
Sbjct  1    MGGA-ILPDLGTEILIPVCAVIGIGFAAFQWFLVSQVKLVPGAAAASTNSGGRKNGYDDY  59

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+NDHNVV KCAEIQ+AISEGA+SFLFTEY+YVGIFMV FA +IF  L SVEGF
Sbjct  60   LIEEEEGLNDHNVVVKCAEIQNAISEGASSFLFTEYKYVGIFMVIFAAVIFGALASVEGF  119

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST +QPCTYD+TK CKPALATA+FSTISFLLGA+TSVVSGFLGMKIAT+
Sbjct  120  STSTQPCTYDKTKRCKPALATALFSTISFLLGAITSVVSGFLGMKIATF  168



>gb|AFW66266.1| hypothetical protein ZEAMMB73_353171 [Zea mays]
Length=767

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  290
            M A+ ILP+LGT++LIPV A VGIAF+++QW+LVSKV+L+PE+ A    A K+G ++ LI
Sbjct  1    MAAAAILPELGTQVLIPVAAAVGIAFSVLQWVLVSKVRLAPERRADGGGAVKSGPSDYLI  60

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST
Sbjct  61   EEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFST  120

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  KSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  167



>gb|EYU24628.1| hypothetical protein MIMGU_mgv1a001756mg [Erythranthe guttata]
Length=764

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESLIEEEE  302
            +L DLGTEI+IPVCA++GIAF+L QW LVS+VK+ P+     +  + KNG+ + LI+EEE
Sbjct  3    LLSDLGTEIVIPVCAVIGIAFSLFQWYLVSRVKVKPDHGGEPAAKNGKNGYGDYLIDEEE  62

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
             IND NVV KCAEIQ+AISEGATSFLFTEYQYVGIFMVAFA+LIF+FLGSVEGFST SQ 
Sbjct  63   SINDQNVVAKCAEIQNAISEGATSFLFTEYQYVGIFMVAFAVLIFLFLGSVEGFSTKSQA  122

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CTY++ KLCKPALATA+FSTISF+LGA+TSV+SGF GMKIATY
Sbjct  123  CTYNKDKLCKPALATALFSTISFVLGAITSVLSGFFGMKIATY  165



>gb|ADJ67258.1| vaculor H+-pyrophosphatase [Sorghum bicolor]
Length=763

 Score =   251 bits (641),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL  L TE+ IPV A++GI FA+VQW+LVS+VKLSP  +A+    KNG+ + LIEEEEG+
Sbjct  3    ILSPLATEVFIPVAAVIGIVFAVVQWVLVSRVKLSPTAAAASGGGKNGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+A+SEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  63   NDHNVVVKCAEIQNAVSEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL TA+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  YSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIATY  163



>ref|XP_010541940.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Tarenaya hassleriana]
Length=765

 Score =   251 bits (641),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            ILPDLGTEILIPVCA++GI FA  QW LVS+VKL    +AS    KNG+ + LIEEEEG+
Sbjct  5    ILPDLGTEILIPVCAVIGIGFAAFQWFLVSQVKLVSGATASSGSRKNGYDDYLIEEEEGL  64

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDH VV KCAEIQ+AISEGA+SFLFTEY+YVGIFM  FA++I V LGSVEGFST +QPC 
Sbjct  65   NDHAVVVKCAEIQNAISEGASSFLFTEYKYVGIFMAIFAVVICVALGSVEGFSTSNQPCN  124

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            YD+TK CKPALATAVFST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  125  YDKTKECKPALATAVFSTVSFLLGAITSVVSGFLGMKIATY  165



>emb|CDY33390.1| BnaC05g11930D [Brassica napus]
Length=771

 Score =   251 bits (641),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 146/171 (85%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  278
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+V++S ++ AS S     + KNG+ 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVRVSADQGASSSSGGANNGKNGYG  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST ++PCTYD+TK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  GFSTENKPCTYDDTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIATY  171



>ref|NP_001288927.1| uncharacterized protein LOC103832483 [Brassica rapa]
 gb|AET95911.1| AVP1-2 [Brassica rapa]
Length=769

 Score =   251 bits (641),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  287
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    D KNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDGKNGNEDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSV+GFS
Sbjct  61   IEEEEGVNDESVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVLFAAIIFLFLGSVQGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  121  TKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  168



>ref|XP_008679906.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Zea mays]
Length=859

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  290
            M A+ ILP+LGT++LIPV A VGIAF+++QW+LVSKV+L+PE+ A    A K+G ++ LI
Sbjct  93   MAAAAILPELGTQVLIPVAAAVGIAFSVLQWVLVSKVRLAPERRADGGGAVKSGPSDYLI  152

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST
Sbjct  153  EEEEGLNDHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFST  212

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  213  KSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  259



>emb|CAN65456.1| hypothetical protein VITISV_035221 [Vitis vinifera]
Length=764

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEEG+
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDH+VVQKCAEIQ+AISEGATSFL+TEYQYVGIFMVAFAILIFVFLGSVEGFST SQPC 
Sbjct  63   NDHSVVQKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAILIFVFLGSVEGFSTKSQPCL  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y++ ++CKPALA A+FSTISFLLG +TS++SGFLGMKIATY
Sbjct  123  YNKGEMCKPALANAIFSTISFLLGGLTSLLSGFLGMKIATY  163



>emb|CBI25554.3| unnamed protein product [Vitis vinifera]
Length=764

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEEG+
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDH+VVQKCAEIQ+AISEGATSFL+TEYQYVGIFMVAFAILIFVFLGSVEGFST SQPC 
Sbjct  63   NDHSVVQKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAILIFVFLGSVEGFSTKSQPCL  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y++ ++CKPALA A+FSTISFLLG +TS++SGFLGMKIATY
Sbjct  123  YNKGEMCKPALANAIFSTISFLLGGLTSLLSGFLGMKIATY  163



>ref|NP_001266772.1| uncharacterized protein LOC101027208 [Zea mays]
 gb|ACN33286.1| unknown [Zea mays]
 gb|ACR36585.1| unknown [Zea mays]
Length=762

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL  L TE+ IPV A++GIAFA+VQW+LVS+VKLSP  +AS   +KNG+ + LIEEEEG+
Sbjct  3    ILSALATEVFIPVAAVIGIAFAVVQWVLVSRVKLSPAAAASGG-SKNGYGDYLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  62   NDHNVVVKCAEIQTAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL TA+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  122  YSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIATY  162



>ref|XP_006300952.1| hypothetical protein CARUB_v10021340mg [Capsella rubella]
 gb|EOA33850.1| hypothetical protein CARUB_v10021340mg [Capsella rubella]
Length=780

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 145/169 (86%), Gaps = 2/169 (1%)
 Frame = +3

Query  111  AMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAES  284
            AM A  +LP++ TE L+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D KNG  + 
Sbjct  11   AMLAKALLPEVWTETLVPVCAVVGIVFSLFQWYVVSCVKLTADRSDLSSTEDGKNGHGDY  70

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+NDH+VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSVEGF
Sbjct  71   LIEEEEGVNDHSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFLFLGSVEGF  130

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            S  SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  131  SIKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  179



>gb|AFW70478.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M A+ ILP+L T++LIPV A VGIAFA+VQW+LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQWVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST 
Sbjct  61   EEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTK  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPC Y + + CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  SQPCHYIKDQTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  166



>ref|XP_002438225.1| hypothetical protein SORBIDRAFT_10g009880 [Sorghum bicolor]
 gb|EER89592.1| hypothetical protein SORBIDRAFT_10g009880 [Sorghum bicolor]
 gb|ACV74424.1| vacuolar H+-pyrophosphatase [Sorghum bicolor]
Length=763

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +3

Query  126  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEG  305
            TIL  L T++ IPV A++GI FA+VQW+LVS+VKLSP  +A+    KNG+ + LIEEEEG
Sbjct  2    TILSPLATKVFIPVAAVIGIVFAVVQWVLVSRVKLSPAAAAASGGGKNGYGDYLIEEEEG  61

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
            +NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPC
Sbjct  62   LNDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPC  121

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TY++ K CKPAL TA+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  122  TYNKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIATY  163



>gb|ACT98610.2| vacuolar proton-inorganic pyrophosphatase [Diplachne fusca]
Length=763

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +L TE+ IPV  I+GIAFA+VQW+LVSKVKLSP  +AS  +   G+ + LIEEEEG+
Sbjct  3    ILSELATEVFIPVAGIIGIAFAIVQWVLVSKVKLSPAAAASGGNKNGGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFTEYQ+VGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  63   NDHNVVAKCAEIQTAISEGATSFLFTEYQHVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL TA+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  YSKDKNCKPALFTALFSTVSFLLGAITSLVSGFLGMKIATY  163



>gb|EYU21676.1| hypothetical protein MIMGU_mgv1a001720mg [Erythranthe guttata]
Length=769

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 145/167 (87%), Gaps = 6/167 (4%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS------ASDSDAKNGFAESLI  290
            +L + GTEI+IPVCA++GI F+LVQW +VSKVK+SPE+S      A+++    G+ + LI
Sbjct  3    LLSEQGTEIVIPVCAVIGIIFSLVQWYIVSKVKVSPERSGAAASPAANNGKNGGYNDYLI  62

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEE+GI+D NVV KCAEIQ+AISEGATSFL+TEYQYVGIFM+AFAILIF+FLGSVEGFST
Sbjct  63   EEEDGIDDQNVVAKCAEIQNAISEGATSFLYTEYQYVGIFMIAFAILIFLFLGSVEGFST  122

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             +QPCTY++  LCKPALATAVFST SFLLGAVTSV+SGFLGMKIATY
Sbjct  123  KNQPCTYNKETLCKPALATAVFSTASFLLGAVTSVISGFLGMKIATY  169



>ref|XP_004951662.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X3 [Setaria italica]
Length=765

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLIEEE  299
            + ILP+L T+++IPV A VGIAFA++QW+LVSKV+L+PE+  +D  A K G ++ LIEEE
Sbjct  2    AAILPELATQVVIPVAAAVGIAFAVLQWVLVSKVRLTPERGRADGGAAKTGPSDYLIEEE  61

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EG+NDHNVV KCAEIQSAISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST SQ
Sbjct  62   EGLNDHNVVVKCAEIQSAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTKSQ  121

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PC Y + K+CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  122  PCHYSKDKICKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  165



>ref|XP_010417704.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=769

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESL  287
            M A  +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D  NG  + L
Sbjct  1    MSAKALLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGTNGHGDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFLFLGSVEGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  121  TKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  168



>emb|CDY39975.1| BnaC06g40530D [Brassica napus]
Length=769

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 143/168 (85%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  287
            M    +LP+L TEIL+PVCA+VGIAF+L QW +VS VKL+ ++ AS    D KNG  + L
Sbjct  1    MTGKALLPELWTEILVPVCAVVGIAFSLFQWYIVSGVKLTADRGASSESEDGKNGNEDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSV+GFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVLFAAIIFLFLGSVQGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTYD+T  CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  121  TKSQPCTYDKTTTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  168



>ref|XP_010539519.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Tarenaya hassleriana]
Length=769

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 144/164 (88%), Gaps = 3/164 (2%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAESLIEEE  299
            +LP++GTE+++P+CA++GI F+LVQW LVS+VKL+ +  +S   A   KNG+ + LIEEE
Sbjct  6    LLPEIGTEVVVPLCAVIGIVFSLVQWFLVSRVKLTTDGGSSSGGANKGKNGYDDYLIEEE  65

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EG ND +VV KCAEIQ+AISEGATSFLFTEY+YVG FMV FAILIF+FLGSVEGFS+ SQ
Sbjct  66   EGGNDQSVVAKCAEIQNAISEGATSFLFTEYKYVGAFMVGFAILIFLFLGSVEGFSSKSQ  125

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTYD+T++CKPALATA FSTISFLLGAVTS++SGFLGMKIATY
Sbjct  126  PCTYDKTRMCKPALATAAFSTISFLLGAVTSLLSGFLGMKIATY  169



>emb|CDX81728.1| BnaC08g38730D [Brassica napus]
Length=1174

 Score =   253 bits (645),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD--AKNGFAESL  287
            M AS  LP+L TEILIPVCA+VGI F+L QW +VS+VK+S ++ AS S   AKNG+ + L
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVKVSGDQGASSSSGGAKNGYDDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA +IFVFLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYQYVGVFMVFFAAIIFVFLGSVEGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T S+PCTYD TK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  TESKPCTYDSTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIATY  168



>ref|XP_010537929.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Tarenaya hassleriana]
Length=769

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 145/169 (86%), Gaps = 3/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASD---SDAKNGFAES  284
            M A  +L ++GTEI++P+CA+VGI F+LVQW LVS+VKL+ ++ AS    ++ KNG+ + 
Sbjct  1    MVAVALLSEMGTEIVVPLCAVVGIVFSLVQWFLVSRVKLTDDRGASSGGANNGKNGYGDY  60

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG FMV FA LIF+FLGSVE F
Sbjct  61   LIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGAFMVLFAFLIFIFLGSVESF  120

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST SQPCTYD+T+ CKPALATA FST+SFLLGAVTS++SGFLGMKIATY
Sbjct  121  STKSQPCTYDKTRTCKPALATAAFSTVSFLLGAVTSLLSGFLGMKIATY  169



>ref|XP_010429951.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X1 [Camelina sativa]
 ref|XP_010429952.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like isoform X2 [Camelina sativa]
Length=769

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESLIEEEE  302
            +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D KNG  + LIEEEE
Sbjct  6    LLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGKNGHGDYLIEEEE  65

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            G+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSVEGFST SQP
Sbjct  66   GVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFLFLGSVEGFSTKSQP  125

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CTYD+T+ CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  126  CTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  168



>ref|XP_004951661.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
isoform X2 [Setaria italica]
Length=795

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLIEEE  299
            + ILP+L T+++IPV A VGIAFA++QW+LVSKV+L+PE+  +D  A K G ++ LIEEE
Sbjct  2    AAILPELATQVVIPVAAAVGIAFAVLQWVLVSKVRLTPERGRADGGAAKTGPSDYLIEEE  61

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EG+NDHNVV KCAEIQSAISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST SQ
Sbjct  62   EGLNDHNVVVKCAEIQSAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTKSQ  121

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PC Y + K+CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  122  PCHYSKDKICKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  165



>ref|NP_001288904.1| uncharacterized protein LOC103836019 [Brassica rapa]
 gb|AET95910.1| AVP1-1 [Brassica rapa]
Length=769

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 3/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAES  284
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+V++S ++ AS S +   KNG+ + 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVRVSADQGASSSSSGGSKNGYGDY  60

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVEGF
Sbjct  61   LIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVEGF  120

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST ++PCTYDETK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  STENKPCTYDETKTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  169



>emb|CDY36581.1| BnaA06g10340D [Brassica napus]
Length=771

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  278
            M A   LP+L TEILIPVCA+VGI F+L QW +VS+V++S ++ AS S     + KNG+ 
Sbjct  1    MVALAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRVRVSADQGASSSSGGANNGKNGYG  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST ++PCTYD+TK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  GFSTENKPCTYDDTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIATY  171



>gb|EAY84762.1| hypothetical protein OsI_06130 [Oryza sativa Indica Group]
Length=285

 Score =   236 bits (602),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 140/170 (82%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS----ASDSDAKNGFAE  281
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E         +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  61   YLIEEEEGLNDHNVVSKCAEIQTAISEGATSFLFTEYKYVGLFMSIFAVLIFLFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  FSTKSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  170



>ref|NP_001077542.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
 gb|AEE29350.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
Length=642

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  281
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  170



>gb|AFW77130.1| hypothetical protein ZEAMMB73_840165 [Zea mays]
Length=819

 Score =   249 bits (636),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL  L TE+ IPV A++GIAFA+VQW+LVS+VKLSP  +AS   +KNG+ + LIEEEEG+
Sbjct  3    ILSALATEVFIPVAAVIGIAFAVVQWVLVSRVKLSPAAAASGG-SKNGYGDYLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  62   NDHNVVVKCAEIQTAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL TA+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  122  YSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIATY  162



>ref|NP_001268155.1| vacuolar pyrophosphatase [Vitis vinifera]
 emb|CAD89675.2| vacuolar pyrophosphatase [Vitis vinifera]
Length=764

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL DLGTEIL+P CAIVGI F++VQWILVS+VKLSPE+ +  + +KNG AE LIEEEEG+
Sbjct  3    ILSDLGTEILVPACAIVGIVFSVVQWILVSRVKLSPERHSLSNSSKNGTAEYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDH+VVQKCAEIQ+AISEGATSFL+TEYQYVGIFMVAFAILIFVFLGSV GFST SQPC 
Sbjct  63   NDHSVVQKCAEIQNAISEGATSFLYTEYQYVGIFMVAFAILIFVFLGSVAGFSTKSQPCL  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y++ ++CKPALA A+FSTISFLLG +TS++SGFLGMKIATY
Sbjct  123  YNKGEMCKPALANAIFSTISFLLGGLTSLLSGFLGMKIATY  163



>gb|AET95912.1| PHP1 [Lagenaria siceraria]
Length=768

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 143/164 (87%), Gaps = 3/164 (2%)
 Frame = +3

Query  126  TILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKN---GFAESLIEE  296
            TILPDLG EI IPVCAIVGI F+LVQW  VS+VKLSP + ++++++     G+++ LIEE
Sbjct  4    TILPDLGAEIFIPVCAIVGILFSLVQWYYVSQVKLSPGRDSANNNSAAAKNGYSDYLIEE  63

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVGIFM+ FA+LIFVFLGSVEGFST  
Sbjct  64   EEGVNDHNVVIKCAEIQNAISEGATSFLFTEYKYVGIFMILFAVLIFVFLGSVEGFSTKP  123

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIAT  608
            Q C YD+TK CKPALATA FSTISF+LGAVTSVVSGFLGMKIAT
Sbjct  124  QACLYDKTKTCKPALATAAFSTISFVLGAVTSVVSGFLGMKIAT  167



>ref|XP_006646987.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=764

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE  302
            + ILP+L  ++LIPV A VGIAFA++QW+LVSKV+L+PE+       K+G ++ LIEEEE
Sbjct  2    AAILPELAAQVLIPVAAAVGIAFAVLQWVLVSKVRLTPERRGEGGAGKSGPSDYLIEEEE  61

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            G+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST SQP
Sbjct  62   GLNDHNVVSKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTKSQP  121

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            C Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  122  CHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  164



>gb|KFK43817.1| hypothetical protein AALP_AA1G177100 [Arabis alpina]
Length=771

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  281
            M  +T+LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVVATLLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA++IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAVVIFVFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST  +PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  FSTKDKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  170



>ref|XP_010472923.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=769

 Score =   246 bits (629),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS--ASDSDAKNGFAESL  287
            M A  +LP+L TEIL+PVCA+VGI F+L QW +VS VKL+ ++S  +S  D  NG  + L
Sbjct  1    MLAKALLPELWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRSDPSSTEDGTNGHGDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSVEGFS
Sbjct  61   IEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFLFLGSVEGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTY++T+ CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  121  TKSQPCTYEKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  168



>gb|ABR18024.1| unknown [Picea sitchensis]
Length=765

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 144/167 (86%), Gaps = 2/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA-KNGFAESLI  290
            MG + +L +  TE+LIPV A+VGIAFAL+QW LVS+VK++P+ S + S+  KNG+ E LI
Sbjct  1    MGGA-LLSETLTEVLIPVAAVVGIAFALIQWFLVSRVKVAPDHSHTPSNNNKNGYTEYLI  59

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG+NDHNVV KCAEIQ+AISEGA SFLFTEYQY+GIFMV FAILIF+FLGSVE FST
Sbjct  60   EEEEGVNDHNVVNKCAEIQNAISEGANSFLFTEYQYMGIFMVCFAILIFLFLGSVEKFST  119

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTY++  +CKPALA A+FSTISFLLG++TS+ SG+LGMKIATY
Sbjct  120  QSQPCTYNKEVMCKPALANAIFSTISFLLGSLTSIFSGYLGMKIATY  166



>gb|KFK42469.1| hypothetical protein AALP_AA2G261100 [Arabis alpina]
Length=769

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS--DAKNGFAESL  287
            M    +LP+L TEILIPVCA++GI F+L QW +VS VKL+ +   S S  D KNG  + L
Sbjct  1    MMTKAMLPELLTEILIPVCAVIGIIFSLFQWYIVSCVKLNSDGDVSSSLDDDKNGHEDYL  60

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+ND NVV KCAEIQ+AISEGATSFL+TEY+YV +FMV FA++IF+FLGSVEGFS
Sbjct  61   IEEEEGVNDENVVAKCAEIQTAISEGATSFLYTEYKYVSVFMVFFAVIIFLFLGSVEGFS  120

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  121  TKSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  168



>ref|XP_007217159.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica]
 gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica]
Length=767

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 141/166 (85%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  293
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++PE+ A     +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTPERHAPPPGPNSNKNGFNDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG++D NVV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLHDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD  + CKPALATA+FST++F+LG VTS++SGFLGMKIATY
Sbjct  122  SQPCTYDAQRTCKPALATAIFSTVAFVLGGVTSILSGFLGMKIATY  167



>gb|AAL57660.1| At1g15690/F7H2_3 [Arabidopsis thaliana]
Length=770

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  281
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  170



>ref|NP_173021.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
 sp|P31414.1|AVP1_ARATH RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump 1; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase 
1; Short=H(+)-PPase 1; AltName: Full=Vacuolar 
proton pyrophosphatase 1; AltName: Full=Vacuolar proton pyrophosphatase 
3 [Arabidopsis thaliana]
 gb|AAF82139.1|AC034256_3 Identical to Vacuolar proton pyrophosphatase (AVP3) from Arabidopsis 
thaliana gb|AB015138 and gb|M81892. ESTs gb|AA006922, 
gb|AA586042, gb|AA651053, gb|AA712863, gb|AA394384, gb|AA605347, 
gb|AA006474, gb|AA006772, gb|AA650817, gb|AA042538, gb|AA006217, 
gb|AW004149, gb|H36252, gb|H36659, gb|R30444, gb|W43600, 
gb|W43886, gb|W43517, gb|W43127, gb|N96656, gb|T14167, 
gb|T76140, gb|T21188, gb|Z17694, gb|Z17695 come from this 
gene [Arabidopsis thaliana]
 gb|AAA32754.1| vacuolar H+-phosphatase [Arabidopsis thaliana]
 gb|AAO00841.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE29349.1| Pyrophosphate-energized vacuolar membrane proton pump 1 [Arabidopsis 
thaliana]
Length=770

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  281
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  170



>ref|XP_002890120.1| vacuolar-type H+-pumping pyrophosphatase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66379.1| vacuolar-type H+-pumping pyrophosphatase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=770

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  281
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST S+PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  FSTDSKPCTYDTTRTCKPALATAGFSTIAFVLGAVTSVLSGFLGMKIATY  170



>gb|AAL84953.1| At1g15690/F7H2_3 [Arabidopsis thaliana]
Length=770

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  281
            M A  +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  170



>ref|XP_009148959.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Brassica rapa]
Length=771

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 143/171 (84%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-----DAKNGFA  278
            M A   LP+L TEILIPVCA+VGI F+L QW +VS+ ++S ++ AS       + KNG+ 
Sbjct  1    MVALAFLPELWTEILIPVCAVVGIVFSLFQWFIVSRFRVSADQGASSHCGGAINGKNGYG  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST ++PCTYD+TK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  GFSTENKPCTYDDTKTCKPALATAAFSTIAFILGAVTSVLSGFLGMKIATY  171



>emb|CDX96835.1| BnaA08g23780D [Brassica napus]
Length=769

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 146/169 (86%), Gaps = 3/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDA---KNGFAES  284
            M AS  LP+L TEILIPVCA+VGIAF+L QW +VS+V++S ++ AS S +   KNG+ + 
Sbjct  1    MVASAFLPELWTEILIPVCAVVGIAFSLFQWFIVSRVRVSADQGASSSSSGGSKNGYGDY  60

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTE +YVG+FMV FA +IFVFLGSVEGF
Sbjct  61   LIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTESRYVGVFMVIFAAIIFVFLGSVEGF  120

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST ++PCTYDETK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  STENKPCTYDETKTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  169



>ref|XP_009334631.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=767

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIEEE  299
            +L  L TEI+IPV A+VGI F+LVQW LVS+VK++PE+ A  S     KNG+ + LIEEE
Sbjct  4    LLSTLATEIVIPVAAVVGIVFSLVQWYLVSRVKVTPERQAPPSGPNSNKNGYNDILIEEE  63

Query  300  EGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQ  479
            EG+ND NVV KCAEIQ+AISEG+TSFLFT YQYVG+FMV FAILIF+FLGSVEGFST SQ
Sbjct  64   EGLNDQNVVTKCAEIQNAISEGSTSFLFTMYQYVGVFMVVFAILIFLFLGSVEGFSTKSQ  123

Query  480  PCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            PCTYD  K CKPALATA+FST++F+LG +TSV+SGFLGMKIATY
Sbjct  124  PCTYDAKKTCKPALATAIFSTVAFVLGGITSVLSGFLGMKIATY  167



>dbj|BAE98517.1| hypothetical protein [Arabidopsis thaliana]
Length=767

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 143/165 (87%), Gaps = 4/165 (2%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAESLIEE  296
            +LP+L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ + LIEE
Sbjct  3    LLPELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGDYLIEE  62

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST +
Sbjct  63   EEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEGFSTDN  122

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            +PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  123  KPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  167



>ref|XP_006389797.1| hypothetical protein EUTSA_v10018163mg [Eutrema salsugineum]
 gb|ESQ27083.1| hypothetical protein EUTSA_v10018163mg [Eutrema salsugineum]
Length=768

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA-SDSDAKNGFAESLI  290
            M A  +LP+  TEIL+PVCA+VGI F+L QW +VS VKL+ ++    + D KNG  + LI
Sbjct  1    MMAKALLPEFWTEILVPVCAVVGIVFSLFQWYVVSCVKLTADRGGEHEGDGKNGHDDYLI  60

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEEEG++D +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IF+FLGSV+GFST
Sbjct  61   EEEEGVHDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAVIFLFLGSVQGFST  120

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTYD+T+ CKPALATAVFSTISF+LGAVTSV+SGFLGMKIATY
Sbjct  121  KSQPCTYDKTRTCKPALATAVFSTISFVLGAVTSVLSGFLGMKIATY  167



>ref|XP_003564217.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Brachypodium distachyon]
Length=762

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL  LGTE+ IPV A++GI FA+VQW+LV++VK++P  +A  + AKNG+ + LIEEEEG+
Sbjct  3    ILSALGTEVFIPVAAVIGIVFAVVQWVLVARVKVTP-GAAGATGAKNGYGDYLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVGIFM+ FA+LIF+FLGS+EGFST  +PCT
Sbjct  62   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGIFMIIFAVLIFLFLGSIEGFSTKGKPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K+CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  122  YSKDKICKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  162



>ref|XP_006306837.1| hypothetical protein CARUB_v10008378mg [Capsella rubella]
 gb|EOA39735.1| hypothetical protein CARUB_v10008378mg [Capsella rubella]
Length=766

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M A+ +LP+L TEIL+P+CA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVAAALLPELWTEILVPICAVVGILFSLFQWYVVSRVKLTTDLGASSSGGKNGHGDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEGIND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST 
Sbjct  61   EEEGINDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAGVIFVFLGSVEGFSTE  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ++ CTYD T+ CKPALATA FST++F+LGAVTSV+SGFLGMKIATY
Sbjct  121  NKACTYDTTRTCKPALATAAFSTVAFVLGAVTSVLSGFLGMKIATY  166



>gb|AIS71988.1| vacuolar pyrophosphatase 1 [Haloxylon ammodendron]
Length=767

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPE--KSASDSDAKNGFAESLIEEEE  302
            +LPDLGTEILIP+CA+VGI F+L QW +VS+VKLSP+  ++ ++++   G  E+LIEEEE
Sbjct  5    LLPDLGTEILIPLCAVVGILFSLFQWYIVSQVKLSPDSGRTNNNNNKNGGVVENLIEEEE  64

Query  303  GINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQP  482
            G+NDH+VV KCAEIQ+AISEGATSFL+TEYQYV IFM+ FA++IF+FLGSVEGFST SQ 
Sbjct  65   GLNDHSVVTKCAEIQTAISEGATSFLYTEYQYVAIFMIPFAVIIFLFLGSVEGFSTSSQE  124

Query  483  CTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            CTYD T+ CKPAL TA+FST++F+LGAVTS+ SGFLGMKIATY
Sbjct  125  CTYDNTRRCKPALFTAIFSTVAFVLGAVTSLASGFLGMKIATY  167



>ref|XP_008228676.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
[Prunus mume]
Length=767

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  293
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++P + A     +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTPGRHAPPAGPNSNKNGFNDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG++D NVV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLHDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD  + CKPALATAVFST++F+LG VTS++SGFLGMKIATY
Sbjct  122  SQPCTYDAQRTCKPALATAVFSTVAFVLGGVTSILSGFLGMKIATY  167



>ref|XP_010476656.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Camelina sativa]
Length=766

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTSDLGASSSAGKNGHEDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST 
Sbjct  61   EEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAGVIFVFLGSVEGFSTE  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ++ CTYD  ++CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  NKACTYDAKRVCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  166



>ref|XP_004965753.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=769

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKN---GFAES  284
            M +   LP+L T++++PV A+VGIAFA++QW+LVSKVKLSPE    D  +     G +E 
Sbjct  1    MASPAFLPELATQVIVPVAAVVGIAFAVLQWVLVSKVKLSPEPRRGDGSSGKSGAGASEY  60

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEGF
Sbjct  61   LIEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEGF  120

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST SQPC Y + K+CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  STKSQPCHYSKGKMCKPALANALFSTIAFVLGAVTSLVSGFLGMKIATY  169



>emb|CAG29370.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M A+ I   L T++LIPV A VGIAFA+VQW+LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAIPSKLATQVLIPVAAAVGIAFAVVQWVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST 
Sbjct  61   EEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTK  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPC Y + + CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  SQPCHYIKDQTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  166



>ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Fragaria vesca subsp. vesca]
Length=767

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  293
            + +L  L TEI+IPVCA+VGI F+L+QW LVS+V+++P+++A     +  KNGF + LIE
Sbjct  2    AVLLSYLATEIVIPVCAVVGILFSLLQWYLVSRVRVTPDRNAPAPGTNAKKNGFNDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ D NVV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FA+LIF+FLGSV+GFST 
Sbjct  62   EEEGVTDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMVVFAVLIFLFLGSVKGFSTE  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD T  CKPALATA+FST++FLLG +TS++SGFLGMKIATY
Sbjct  122  SQPCTYDVTSTCKPALATALFSTVAFLLGGITSLLSGFLGMKIATY  167



>ref|XP_006656294.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=772

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 142/169 (84%), Gaps = 5/169 (3%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP-----EKSASDSDAKNGFAES  284
            ++ ILPDL T++L+P  A+VGIAFA+ QW+LVSKVK+ P     E SAS      G +E 
Sbjct  4    SAAILPDLATQVLVPAAAVVGIAFAVAQWVLVSKVKMMPVERRGEGSASGPGKNGGASEY  63

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+N+HNVV+KC+EIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGF
Sbjct  64   LIEEEEGLNEHNVVEKCSEIQNAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGF  123

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSGFLGMKIATY
Sbjct  124  STKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIATY  172



>ref|XP_010459106.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=766

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTTDLGASSSAGKNGHEDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST 
Sbjct  61   EEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAGVIFVFLGSVEGFSTE  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ++ CTYD  ++CKPALATA FST++F+LGAVTSV+SGFLGMKIATY
Sbjct  121  NKACTYDAKRICKPALATAAFSTVAFVLGAVTSVLSGFLGMKIATY  166



>ref|XP_010497310.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Camelina sativa]
Length=766

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 142/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M AS +LP+L TEIL+PVCA+VGI F+L QW +VS+VKL+ +  AS S  KNG  + LIE
Sbjct  1    MVASALLPELWTEILVPVCAVVGILFSLFQWYVVSRVKLTSDLGASSSAGKNGHEDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEGFST 
Sbjct  61   EEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAGVIFVFLGSVEGFSTE  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ++ CTYD  ++CKPALATA FST++F+LGAVTSV+SGFLGMKIATY
Sbjct  121  NKACTYDAKRVCKPALATAAFSTVAFVLGAVTSVLSGFLGMKIATY  166



>gb|AJR29310.1| H+-pyrophosphatase [Secale cereale]
Length=762

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +LGT+I+IPVC +VGI FA+ QW +VSKVK++P  +++ + +KNG+ + LIEEEEG+
Sbjct  3    ILGELGTQIIIPVCGVVGIVFAVAQWFIVSKVKVTPGAASATAGSKNGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FM+ FA++IFVFLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMIVFAVVIFVFLGSIEGFSTKGQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y  T  CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  Y-STGTCKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  162



>gb|AAL11506.1|AF367446_1 vacuolar H+-pyrophosphatase [Prunus persica]
Length=767

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA---SDSDAKNGFAESLIE  293
            + +L  L TEI+IPV A++GI F+LVQW +VS+VK++ E+ A     +  KNGF + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVIGIVFSLVQWFIVSRVKVTLERHAPPAGPNSNKNGFNDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG++D NVV KCAEIQ+AISEGATSFLFTEYQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLHDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD  + CKPALATA+FST++F+LG VTS++SGFLGMKIATY
Sbjct  122  SQPCTYDAQRTCKPALATAIFSTVAFVLGGVTSILSGFLGMKIATY  167



>gb|AEI17666.1| vacuolar H+-pyrophosphatase [Salicornia europaea]
Length=763

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLIEEEEG  305
            ++ DL TEILIP CA+VGI F+LVQW +V+KVK+S EK  ++   AKNG+ + LIEEE+G
Sbjct  1    MISDLATEILIPACAVVGILFSLVQWFIVAKVKVSSEKHVNNGGSAKNGYNDYLIEEEDG  60

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
             ND  V+ KCAEIQ+AISEGATSFLFTEYQYVG+FMVAFAILIF+FLGSVEGFST  Q C
Sbjct  61   ANDQEVIAKCAEIQNAISEGATSFLFTEYQYVGVFMVAFAILIFLFLGSVEGFSTKGQAC  120

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TY   K CKPALATA+FSTISF+LGAVTSVVSGFLGMKIAT+
Sbjct  121  TYSPLKECKPALATALFSTISFVLGAVTSVVSGFLGMKIATF  162



>dbj|BAA32210.1| Vacuolar proton pyrophosphatase [Arabidopsis thaliana]
Length=770

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 144/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  281
            M A  +L +L TEIL+P+CA++GIAF+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVAPALLLELWTEILVPICAVIGIAFSLFQWYVVSRVKLTSDLGASSSGGANNGKNGYGD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST ++PCTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  FSTDNKPCTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  170



>dbj|BAJ91598.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 141/171 (82%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-----SASDSDAKNGFA  278
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE      SAS +  K+G  
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRAEGGSASAAGGKDGAT  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            E LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+Y G FM  FA+LIFVFLGS+E
Sbjct  61   EYLIEEEEGLNDHNVVLKCAEIQTAISEGATSFLFTEYKYAGGFMTIFAVLIFVFLGSIE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQPC Y   K CKPALA A FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  GFSTKSQPCHYSVGKTCKPALANAAFSTIAFVLGAVTSLVSGFLGMKIATY  171



>ref|XP_010033979.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1 [Eucalyptus grandis]
 gb|KCW53849.1| hypothetical protein EUGRSUZ_J03081 [Eucalyptus grandis]
Length=769

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 140/167 (84%), Gaps = 6/167 (4%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKN------GFAESLI  290
            +L  L TEI IP CA+VGI F+LVQW+LVS+VKL+PE  A  S +        G+ E LI
Sbjct  3    LLSPLATEIAIPACALVGIVFSLVQWLLVSRVKLTPEPRAPSSSSPGSNNNKNGYGEYLI  62

Query  291  EEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
            EEE+G+NDH+VV KCAEIQSAISEGATSFLFTEYQYVG+FMVAFA+LIF+FLGSVE FST
Sbjct  63   EEEDGVNDHSVVAKCAEIQSAISEGATSFLFTEYQYVGVFMVAFAVLIFLFLGSVESFST  122

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             SQPCTYD +KLCKPALATAVFST+SFLLG  TSVVSGFLGMKIATY
Sbjct  123  QSQPCTYDPSKLCKPALATAVFSTVSFLLGGFTSVVSGFLGMKIATY  169



>ref|XP_009336318.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis]
Length=767

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 139/166 (84%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  293
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG  + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGCNDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND NVV KCAEIQ+AISEG+TSFLFT YQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLNDQNVVVKCAEIQNAISEGSTSFLFTMYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD  K CKPALATA+FST++F+LG +TSV+SGFLGMKIATY
Sbjct  122  SQPCTYDAAKTCKPALATAIFSTVAFVLGGITSVLSGFLGMKIATY  167



>ref|XP_009338516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Pyrus x bretschneideri]
Length=767

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 139/166 (84%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  293
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG  + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGCNDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND NVV KCAEIQ+AISEG+TSFLFT YQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLNDQNVVVKCAEIQNAISEGSTSFLFTMYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD  K CKPALATA+FST++F+LG +TSV+SGFLGMKIATY
Sbjct  122  SQPCTYDAAKTCKPALATAIFSTVAFVLGGITSVLSGFLGMKIATY  167



>ref|XP_006648065.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=762

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL D+ TE+LIP+ A+VGIAF++ QW+LV++VKL+P    + S  K+ + +SLIEEEEG+
Sbjct  3    ILSDVATEVLIPIAAVVGIAFSIAQWVLVARVKLAPTPPGA-SRGKDSYGDSLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AI+EGATSFLFTEYQYVG+FM  FA++IF+FLGSVEGFST S PCT
Sbjct  62   NDHNVVAKCAEIQNAIAEGATSFLFTEYQYVGVFMSIFAVVIFLFLGSVEGFSTKSHPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL  A+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  122  YSKDKECKPALFNALFSTVSFLLGAITSVVSGFLGMKIATY  162



>gb|EMT29715.1| Pyrophosphate-energized vacuolar membrane proton pump [Aegilops 
tauschii]
Length=761

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 137/161 (85%), Gaps = 2/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +A+   +KNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVVGIVFAIAQWFIVSKVKVTPGAAAAGG-SKNGYGDYLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IFVFLGS+EGFST  QPCT
Sbjct  62   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAVIFVFLGSIEGFSTKGQPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y  T  CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  122  Y-STGTCKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  161



>gb|AAP55210.1| vacuolar proton-inorganic pyrophosphatase [Triticum aestivum]
Length=762

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +++    KNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVVGIVFAVAQWFIVSKVKVTPGAASAAGGGKNGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IFVFLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAVIFVFLGSIEGFSTKGQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y  T  CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  Y-STGTCKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  162



>ref|NP_001105380.1| vacuolar proton pump homolog1 [Zea mays]
 emb|CAG29369.1| vacuolar H+-translocating inorganic pyrophosphatase [Zea mays]
Length=766

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M A+ ILP+L T++LIPV A VGIAFA+VQ +LVSKV+++PE+ A     K+G ++ LIE
Sbjct  1    MAAAAILPELATQVLIPVAAAVGIAFAVVQLVLVSKVRVTPERRADGGAVKSGPSDYLIE  60

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FAILIF+FLGSVEGFST 
Sbjct  61   EEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYKYVGLFMGIFAILIFLFLGSVEGFSTK  120

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPC Y + + CKP LA A+FSTI+F+L AVTS+VSGFLGMKIATY
Sbjct  121  SQPCHYIKDQTCKPXLANAIFSTIAFVLCAVTSLVSGFLGMKIATY  166



>ref|XP_008372806.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Malus domestica]
Length=1179

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 140/166 (84%), Gaps = 3/166 (2%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS---DAKNGFAESLIE  293
            + +L  L TEI+IPV A+VGI F+LVQW LVS VK++PE++A  S     KNG+ + LIE
Sbjct  2    AVLLSTLATEIVIPVAAVVGIVFSLVQWFLVSLVKVTPERNAPPSGPNSNKNGYNDYLIE  61

Query  294  EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTM  473
            EEEG+ND NVV KCAEIQ+AISEG+TSFLFT YQYVG+FMV FAILIF+FLGSVEGFST 
Sbjct  62   EEEGLNDQNVVVKCAEIQNAISEGSTSFLFTMYQYVGVFMVVFAILIFLFLGSVEGFSTK  121

Query  474  SQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            SQPCTYD  K CKPALATA+FST++F+LG +TSV+SGFLGMKIATY
Sbjct  122  SQPCTYDAAKTCKPALATAIFSTVAFVLGGITSVLSGFLGMKIATY  167



>dbj|BAB18681.1| vacuolar proton-inorganic pyrophosphatase [Hordeum vulgare subsp. 
vulgare]
Length=771

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEK-----SASDSDAKNGFA  278
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE      SAS   AK+G  
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRAEGGSASAVGAKDGAT  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            E LIEEEEG+NDHNVV KCAEIQ+AISEG TSFLFTEY+Y G FM  FA+LIFVFLGS+E
Sbjct  61   EYLIEEEEGLNDHNVVLKCAEIQTAISEGQTSFLFTEYKYAGGFMTIFAVLIFVFLGSIE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST SQPC Y   K CKPALA A FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  GFSTKSQPCHYSVGKTCKPALANAAFSTIAFVLGAVTSLVSGFLGMKIATY  171



>gb|AAA61609.1| pyrophosphatase [Beta vulgaris]
Length=761

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS-DAKNGFAESLIEEEEG  305
            ++ DL TEI IPVCA++G   +  QW LVSKVK+S ++  ++   AKNGF + LIEEEEG
Sbjct  1    MISDLATEIFIPVCAVIGY-ISCYQWFLVSKVKVSTDRHVNNGGSAKNGFNDYLIEEEEG  59

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
            +ND NVV KCAEIQ+AISEGATSFLFTEYQYVG+FM AFA+LIFVFLGSVEGFST SQPC
Sbjct  60   VNDQNVVAKCAEIQNAISEGATSFLFTEYQYVGVFMCAFAVLIFVFLGSVEGFSTESQPC  119

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIAT  608
            TY   K CKPALATA+FST+SFLLGA+TSVVSGFLGMKIAT
Sbjct  120  TYSPLKKCKPALATALFSTVSFLLGAITSVVSGFLGMKIAT  160



>gb|AHZ97880.1| vacuolar H+-pyrophosphatase [Olimarabidopsis pumila]
Length=770

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 143/170 (84%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDS----DAKNGFAE  281
            M A+ +LP+L TEIL+P+CA+VGI F+L QW +VS+VKL+ +  AS S    + KNG+ +
Sbjct  1    MVATALLPELWTEILVPICAVVGILFSLFQWYVVSRVKLTTDLGASSSGGANNGKNGYGD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEE +ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FM+ FA +IFVFLGSVEG
Sbjct  61   YLIEEEECVNDQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMIFFAAVIFVFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST ++ CTYD T+ CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  FSTENKACTYDTTRTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  170



>gb|ACA63883.1| vacuolar proton-inorganic pyrophosphatase [Hordeum vulgare]
Length=762

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IF+FLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAIIFLFLGSIEGFSTKGQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y +   CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  YSKGT-CKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  162



>sp|Q06572.2|AVP_HORVU RecName: Full=Pyrophosphate-energized vacuolar membrane proton 
pump; AltName: Full=Pyrophosphate-energized inorganic pyrophosphatase; 
Short=H(+)-PPase [Hordeum vulgare]
 dbj|BAA02717.2| inorganic pyrophosphatase [Hordeum vulgare subsp. vulgare]
Length=762

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IF+FLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAIIFLFLGSIEGFSTKGQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y +   CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  YSKGT-CKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  162



>dbj|BAJ88084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=762

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IF+FLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAIIFLFLGSIEGFSTKGQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y +   CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  YSKGT-CKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  162



>dbj|BAK04633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=718

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +LGTEILIPVC ++GI FA+ QW +VSKVK++P  +++ + AKNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IF+FLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAIIFLFLGSIEGFSTKGQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y +   CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  YSKGT-CKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  162



>ref|XP_004954254.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=762

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL D  TE+L+P+ A+VGIAFA+ QW+LVS+VKLSP       D K+   +SLIEEEEG+
Sbjct  3    ILSDAATEVLVPLAAVVGIAFAVAQWVLVSRVKLSPSARGGARD-KDVLGDSLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV +CAEIQ+AI++GATSFLFTEY+YVGIFM  FA++IFVFLGSVEGFST + PCT
Sbjct  62   NDHNVVVRCAEIQNAIAQGATSFLFTEYRYVGIFMSIFAVVIFVFLGSVEGFSTRTHPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + + CKPAL  A+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  122  YSKGRECKPALFNALFSTVSFLLGAITSVVSGFLGMKIATY  162



>dbj|BAD25066.1| putative inorganic diphosphatase [Oryza sativa Japonica Group]
 gb|EEE56454.1| hypothetical protein OsJ_05651 [Oryza sativa Japonica Group]
Length=770

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 140/170 (82%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS----ASDSDAKNGFAE  281
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E         +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  61   YLIEEEEGLNDHNVVSKCAEIQTAISEGATSFLFTEYKYVGLFMSIFAVLIFLFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  FSTKSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  170



>dbj|BAD02277.1| vacuolar proton pyrophosphatase [Oryza sativa Japonica Group]
Length=770

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 140/170 (82%), Gaps = 4/170 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS----ASDSDAKNGFAE  281
            M A+ ILP+L  +++IPV A VGIAFA++QW LVSKVKL+ E         +  K+G ++
Sbjct  1    MAAAAILPELAAQVVIPVAAAVGIAFAVLQWALVSKVKLTAEPRRGEAGGAAGGKSGPSD  60

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  61   YLIEEEEGLNDHNVVSKCAEIQTAISEGATSFLFTEYKYVGLFMSIFAVLIFLFLGSVEG  120

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  FSTKSQPCHYSKDKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  170



>ref|NP_001058184.1| Os06g0644200 [Oryza sativa Japonica Group]
 dbj|BAD37431.1| inorganic diphosphatase, H+-translocating, vacuolar membrane 
[Oryza sativa Japonica Group]
 dbj|BAF20098.1| Os06g0644200 [Oryza sativa Japonica Group]
 dbj|BAG94303.1| unnamed protein product [Oryza sativa Japonica Group]
Length=782

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 142/178 (80%), Gaps = 7/178 (4%)
 Frame = +3

Query  99   AEATAMGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD------  260
            A  + +  + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +        
Sbjct  5    ARISQVAMAAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAG  64

Query  261  -AKNGFAESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIF  437
                  +E LIEEEEG+N+HNVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF
Sbjct  65   KDGGAASEYLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIF  124

Query  438  VFLGSVEGFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            +FLGSVEGFST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSGFLGMKIATY
Sbjct  125  LFLGSVEGFSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIATY  182



>dbj|BAA31523.1| ovp1 [Oryza sativa]
Length=771

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 139/170 (82%), Gaps = 7/170 (4%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  281
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+N+HNVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  62   YLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEG  121

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSGFLGMKIATY
Sbjct  122  FSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIATY  171



>dbj|BAA08232.1| vacuolar H+-pyrophosphatase [Oryza sativa (japonica cultivar-group)]
Length=771

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 139/170 (82%), Gaps = 7/170 (4%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  281
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+N+HNVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  62   YLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEG  121

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSGFLGMKIATY
Sbjct  122  FSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIATY  171



>gb|EAZ01854.1| hypothetical protein OsI_23875 [Oryza sativa Indica Group]
Length=784

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 139/170 (82%), Gaps = 7/170 (4%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  281
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+N+HNVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  62   YLIEEEEGLNEHNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEG  121

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSGFLGMKIATY
Sbjct  122  FSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIATY  171



>emb|CDX83972.1| BnaC08g16730D [Brassica napus]
Length=769

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA---ES  284
            M AS  LP+L TEIL+PVCA+VGIAF+L QW +VS+V++S ++ AS S +        + 
Sbjct  1    MVASAFLPELWTEILVPVCAVVGIAFSLFQWFIVSRVRVSSDQGASSSSSGGSKNGYGDY  60

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+ND +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVEGF
Sbjct  61   LIEEEEGVNDQSVVAKCAEIQTAISEGATSFLFTEYRYVGVFMVIFAAIIFVFLGSVEGF  120

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST ++PCTYDETK CKPALATA FSTI+F+LGAVTSV+SGFLGMKIATY
Sbjct  121  STENKPCTYDETKTCKPALATAAFSTIAFVLGAVTSVLSGFLGMKIATY  169



>ref|XP_006416887.1| hypothetical protein EUTSA_v10006869mg [Eutrema salsugineum]
 gb|ESQ35240.1| hypothetical protein EUTSA_v10006869mg [Eutrema salsugineum]
Length=771

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 144/171 (84%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNG-----FA  278
            M AS  LP+L TEIL+PVCA++GIAF+L QW +VS+V+++ ++ AS S   +      + 
Sbjct  1    MVASAFLPELWTEILVPVCAVIGIAFSLFQWFIVSRVRVTADQGASSSSGGSNNGKNGYG  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+N+ +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGLNEQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFVFLGSVE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST ++PCTYD+TK CKPALATA FST++F+LGAVTSV+SGFLGMKIATY
Sbjct  121  GFSTKNKPCTYDDTKTCKPALATAAFSTVAFVLGAVTSVLSGFLGMKIATY  171



>gb|AAR08913.2| pyrophosphate-energized vacuolar membrane proton pump [Eutrema 
salsugineum]
Length=771

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 144/171 (84%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNG-----FA  278
            M AS  LP+L TEIL+PVCA++GIAF+L QW +VS+V+++ ++ AS S   +      + 
Sbjct  1    MVASAFLPELWTEILVPVCAVIGIAFSLFQWFIVSRVRVTADQGASSSSGGSNNGKNGYG  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            + LIEEEEG+N+ +VV KCAEIQ+AISEGATSFLFTEY+YVG+FMV FA +IFVFLGSVE
Sbjct  61   DYLIEEEEGLNEQSVVAKCAEIQTAISEGATSFLFTEYKYVGVFMVFFAAIIFVFLGSVE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GFST ++PCTYD+TK CKPALATA FST++F+LGAVTSV+SGFLGMKIATY
Sbjct  121  GFSTKNKPCTYDDTKTCKPALATAAFSTVAFVLGAVTSVLSGFLGMKIATY  171



>gb|EEE66103.1| hypothetical protein OsJ_22136 [Oryza sativa Japonica Group]
Length=771

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 137/170 (81%), Gaps = 7/170 (4%)
 Frame = +3

Query  123  STILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSD-------AKNGFAE  281
            + ILPDL T++L+P  A+VGIAFA+VQW+LVSKVK++ E+   +              +E
Sbjct  2    AAILPDLATQVLVPAAAVVGIAFAVVQWVLVSKVKMTAERRGGEGSPGAAAGKDGGAASE  61

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+N  NVV+KC+EIQ AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVEG
Sbjct  62   YLIEEEEGLNGQNVVEKCSEIQHAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVEG  121

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST SQPC Y + ++CKPALA A+FST++F+LGAVTS+VSGFLGMKIATY
Sbjct  122  FSTKSQPCHYSKDRMCKPALANAIFSTVAFVLGAVTSLVSGFLGMKIATY  171



>ref|XP_002454723.1| hypothetical protein SORBIDRAFT_04g036230 [Sorghum bicolor]
 gb|EES07699.1| hypothetical protein SORBIDRAFT_04g036230 [Sorghum bicolor]
Length=759

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 132/161 (82%), Gaps = 4/161 (2%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL ++ TE+LIP+ A VGIAFA+ QW+LVS+VKL+P  S  D D     AESLIEEEEG+
Sbjct  3    ILSEVATEVLIPLAAAVGIAFAVAQWVLVSRVKLAPS-SGRDKDV---LAESLIEEEEGL  58

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV +CAEIQ AI+EGATSFLFTEY+YVG FM  FA +IFVFLGSV+GFST S+PC 
Sbjct  59   NDHNVVVRCAEIQCAIAEGATSFLFTEYRYVGAFMCVFAAVIFVFLGSVDGFSTQSRPCA  118

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y E K CKPAL  AVFST++FLLGA TSVVSGFLGMK+ATY
Sbjct  119  YSEGKQCKPALFNAVFSTVAFLLGAATSVVSGFLGMKVATY  159



>gb|EMS65629.1| Pyrophosphate-energized vacuolar membrane proton pump [Triticum 
urartu]
Length=762

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL +LGTEILIPVC +VGI FA+ QW +VSKVK++P  +++    KNG+ + LIEEEEG+
Sbjct  3    ILGELGTEILIPVCGVVGIVFAVAQWFIVSKVKVTPGAASAGGGGKNGYGDYLIEEEEGL  62

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFT YQYVG+FMV FA +IFVFLGS+EGFST  QPCT
Sbjct  63   NDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVFAAVIFVFLGSIEGFSTKGQPCT  122

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y  T  CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  123  Y-STGTCKPALYTALFSTASFLLGAITSLVSGFLGMKIATY  162



>gb|AAP06752.1| vacuolar proton-inorganic pyrophosphatase [Hordeum brevisubulatum]
Length=773

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 6/170 (4%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA------E  281
            A+ ILP+L T++++PV A VGIAFA++QW LVSKVK++PE+    S +           E
Sbjct  4    AAAILPELATQLVVPVAAAVGIAFAVLQWFLVSKVKVAPERRGEGSGSAGAGGGKDGASE  63

Query  282  SLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEG  461
             LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+Y G FM  FA+LIFVFLGS+EG
Sbjct  64   YLIEEEEGLNDHNVVLKCAEIQTAISEGATSFLFTEYKYAGGFMTVFAVLIFVFLGSIEG  123

Query  462  FSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            FST SQPC Y   K CKPALA A FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  124  FSTKSQPCHYSVGKTCKPALANAAFSTIAFVLGAVTSLVSGFLGMKIATY  173



>ref|XP_004964695.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Setaria italica]
Length=762

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL  L TE+ IP+  I+GIAFA+VQW++VS+VKLSP  +AS   +KNG+ + LIEEEEG+
Sbjct  3    ILSPLATEVFIPIAGIIGIAFAVVQWVIVSRVKLSPAAAASGG-SKNGYGDYLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  62   NDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL TA+FST SFLLGA+TS+VSGFLGMKIATY
Sbjct  122  YSKGKYCKPALFTALFSTASFLLGAITSLVSGFLGMKIATY  162



>gb|ABX10014.1| vacuolar H+-pyrophosphatase [Triticum aestivum]
Length=775

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 137/175 (78%), Gaps = 9/175 (5%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGF------  275
            M A+ ILP+L T++++PV A VGIAFA++QW+LVSKVK++PE       A  G       
Sbjct  1    MVAAAILPELATQLVVPVAAAVGIAFAVLQWVLVSKVKVAPEPRGEGGSAAGGGAGAGAK  60

Query  276  ---AESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFL  446
               +E LIEEEEG+NDHN+V KCAEIQ+AISEGATSFLFTEY+Y G FM  FA+LIFVFL
Sbjct  61   DGASEYLIEEEEGLNDHNIVLKCAEIQTAISEGATSFLFTEYKYAGGFMTVFAVLIFVFL  120

Query  447  GSVEGFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            GS+EGFST SQPC Y   K CKPALA A FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  GSIEGFSTKSQPCHYSVGKTCKPALANAAFSTIAFVLGAVTSLVSGFLGMKIATY  175



>gb|EAZ24976.1| hypothetical protein OsJ_08754 [Oryza sativa Japonica Group]
Length=751

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL D+ TE+LIP+ AI+GI F++ QW+LV++VKL+P +  + S +K+G+ +SLIEEEEG+
Sbjct  3    ILSDVATEVLIPIAAIIGIGFSIAQWVLVARVKLAPSQPGA-SRSKDGYGDSLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AI+EGATSFLFTEYQYVG+FM  FA++IF+FLGSVEGFST + PCT
Sbjct  62   NDHNVVAKCAEIQNAIAEGATSFLFTEYQYVGVFMSIFAVVIFLFLGSVEGFSTKTHPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL  A+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  122  YSKDKECKPALFNALFSTVSFLLGAITSVVSGFLGMKIATY  162



>ref|NP_001048422.1| Os02g0802500 [Oryza sativa Japonica Group]
 dbj|BAD02276.1| vacuolar proton pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAD36028.1| proton translocating pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAD36736.1| proton translocating pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAF10336.1| Os02g0802500 [Oryza sativa Japonica Group]
 gb|EAY87900.1| hypothetical protein OsI_09320 [Oryza sativa Indica Group]
Length=762

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL D+ TE+LIP+ AI+GI F++ QW+LV++VKL+P +  + S +K+G+ +SLIEEEEG+
Sbjct  3    ILSDVATEVLIPIAAIIGIGFSIAQWVLVARVKLAPSQPGA-SRSKDGYGDSLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AI+EGATSFLFTEYQYVG+FM  FA++IF+FLGSVEGFST + PCT
Sbjct  62   NDHNVVAKCAEIQNAIAEGATSFLFTEYQYVGVFMSIFAVVIFLFLGSVEGFSTKTHPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL  A+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  122  YSKDKECKPALFNALFSTVSFLLGAITSVVSGFLGMKIATY  162



>emb|CAF18416.1| proton translocating pyrophosphatase [Oryza sativa]
Length=762

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL D+ TE+LIP+ AI+GI F++ QW+LV++VKL+P +  + S +K+G+ +SLIEEEEG+
Sbjct  3    ILSDVATEVLIPIAAIIGIGFSIAQWVLVARVKLAPSQPGA-SRSKDGYGDSLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AI+EGATSFLFTEYQYVG+FM  FA++IF+FLGSVEGFST + PCT
Sbjct  62   NDHNVVAKCAEIQNAIAEGATSFLFTEYQYVGVFMSIFAVVIFLFLGSVEGFSTKTHPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL  A+FST+SFLLGA+TSVVSGFLGMKIATY
Sbjct  122  YSKDKECKPALFNALFSTVSFLLGAITSVVSGFLGMKIATY  162



>gb|AGT16998.1| diphosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA----ESL  287
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D  A    A    E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGAGGASEYL  63

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE FS
Sbjct  64   IEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMSIFAVLIFLFLGSVESFS  123

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPC Y + K+CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  124  TKSQPCHYSKGKMCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  171



>gb|AGT15917.1| vacuolar H+-pyrophosphatase [Saccharum hybrid cultivar R570]
 gb|AGT16391.1| vacuolar H+-pyrophosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 141/168 (84%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA----ESL  287
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D  A         E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGGAGASEYL  63

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE FS
Sbjct  64   IEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVESFS  123

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPC Y + K+CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  124  TKSQPCHYSKGKMCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  171



>gb|AGT16227.1| vacuolar proton pyrophosphatase [Saccharum hybrid cultivar R570]
Length=771

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 141/168 (84%), Gaps = 4/168 (2%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA----ESL  287
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE   +D  A         E L
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGSAGKSGGAGASEYL  63

Query  288  IEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            IEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE FS
Sbjct  64   IEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVESFS  123

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T SQPC Y + K+CKPALA A+FSTI+F+LGA+TS+VSGFLGMKIATY
Sbjct  124  TKSQPCHYSKGKMCKPALANAIFSTIAFVLGAITSLVSGFLGMKIATY  171



>dbj|BAF63470.1| vacuolar proton-pyrophosphatase [Potamogeton distinctus]
Length=767

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +3

Query  147  TEILIPVCAIVGIAFALVQWILVSKVKL---SPEKSASDSDAKNGFAESLIEEEEGINDH  317
            +E+LIP+ A++GIAF+L QW LVS+VK+    P + A  S+ KNG  + L+EEEE I+D 
Sbjct  11   SEVLIPLAAVIGIAFSLAQWYLVSRVKVIGADPVQRAR-SERKNGLGDYLVEEEEAIDDQ  69

Query  318  NVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDE  497
            +V+ KCA+IQ AISEGATSFLFTEY+YVG+FM AFA+LIF+FLGSVEGFST SQPCTY +
Sbjct  70   SVIDKCADIQKAISEGATSFLFTEYKYVGMFMTAFAVLIFLFLGSVEGFSTKSQPCTYTK  129

Query  498  TKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
              +CKPALA A+FST+SFLLGA+TSVV+GF GMKIATY
Sbjct  130  DTMCKPALANALFSTVSFLLGAITSVVAGFFGMKIATY  167



>ref|XP_006841407.1| hypothetical protein AMTR_s00003p00014700 [Amborella trichopoda]
 gb|ERN03082.1| hypothetical protein AMTR_s00003p00014700 [Amborella trichopoda]
Length=764

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 138/167 (83%), Gaps = 4/167 (2%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            M +S +L +   ++LIPV AI+GI FAL+QW LVS+V++SPE     S A NG+ + LIE
Sbjct  1    MASSALLGETLAQVLIPVAAIIGIVFALLQWYLVSQVRVSPEHR---SGANNGYDDRLIE  57

Query  294  -EEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFST  470
             EEEG +   V+ KCAEIQ AISEGATSFL+TEY+Y+GIFM AFAI+IF+FLGSV+GFST
Sbjct  58   DEEEGADSVGVITKCAEIQQAISEGATSFLYTEYKYLGIFMGAFAIIIFLFLGSVKGFST  117

Query  471  MSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             S+PC+Y++ KLCKPALA AVF+T++FLLGAVTSV+SGFLGMKIATY
Sbjct  118  QSEPCSYNKEKLCKPALANAVFTTVAFLLGAVTSVLSGFLGMKIATY  164



>ref|XP_006656699.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Oryza brachyantha]
Length=801

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 137/199 (69%), Gaps = 38/199 (19%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSP---------------------EKS  245
            IL +LGTE+ +PV A VGIAFA+VQW+LV++VKLS                      E+ 
Sbjct  3    ILSELGTEVFVPVAAAVGIAFAVVQWVLVARVKLSEDAAGASGGGKNGGYGDYLIEEEEG  62

Query  246  ASDSDA-----------------KNGFAESLIEEEEGINDHNVVQKCAEIQSAISEGATS  374
             +D +                    G+ + LIEEEEG+NDHNVV KC EIQSAISEGATS
Sbjct  63   LNDHNVVVKCREIQSAISEGERRTGGYGDYLIEEEEGLNDHNVVVKCREIQSAISEGATS  122

Query  375  FLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDETKLCKPALATAVFSTISFL  554
            FLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCTY + K CKPAL  A+FST SFL
Sbjct  123  FLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKSQPCTYSKDKYCKPALFNALFSTASFL  182

Query  555  LGAVTSVVSGFLGMKIATY  611
            LGA+TS+VSGFLGMKIAT+
Sbjct  183  LGAITSLVSGFLGMKIATF  201



>ref|NP_001146732.1| uncharacterized protein LOC100280334 [Zea mays]
 gb|ACL54639.1| unknown [Zea mays]
 gb|AFW87296.1| hypothetical protein ZEAMMB73_037805 [Zea mays]
Length=771

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 140/171 (82%), Gaps = 5/171 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-----  278
            M +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKLSPE    D  A    A     
Sbjct  1    MASSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLSPEPRRGDGSAGKSGAGAGAS  60

Query  279  ESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVE  458
            E LIEEEEG+N+HNVV K AEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE
Sbjct  61   EYLIEEEEGLNEHNVVVKYAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVE  120

Query  459  GFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
             FST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  121  SFSTKSQPCHYSKGKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  171



>ref|XP_010042849.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Eucalyptus grandis]
Length=320

 Score =   209 bits (532),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 132/162 (81%), Gaps = 6/162 (4%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE-EEEG  305
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S      D   K+G+ + LIE EEEG
Sbjct  3    VLSEALTQILIPTSALIGIGFALLQWLLVSKVKVS-----VDYGKKDGYKDKLIEDEEEG  57

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
              + + V KCAEIQ+AIS GATSFLFT+Y+Y+GIFMVAFA +IF+FLGSV+GFST S+PC
Sbjct  58   AENADAVIKCAEIQNAISVGATSFLFTQYKYLGIFMVAFAAVIFLFLGSVKGFSTQSEPC  117

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TY+   LCKPALA A+FSTI+FLLGA+TSV+SGFLGMKIATY
Sbjct  118  TYNPGNLCKPALANAMFSTIAFLLGALTSVLSGFLGMKIATY  159



>ref|XP_003563306.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Brachypodium distachyon]
Length=773

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 135/172 (78%), Gaps = 11/172 (6%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKS-----------ASDSDAKNGF  275
            +L +L T++++PV A+VGIAFA++QW+LVSKVK++PE+             +  +     
Sbjct  2    VLSELATQLVVPVAAVVGIAFAVLQWVLVSKVKVTPERRDGEGASSGAAAGAGKNGAAAG  61

Query  276  AESLIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSV  455
            +E LIEEEEG+NDHNVV KCAEIQ+AISEGATSFLFTEY+Y G FM  FA+LIF+FLGS+
Sbjct  62   SEYLIEEEEGLNDHNVVVKCAEIQTAISEGATSFLFTEYKYAGGFMAIFAVLIFLFLGSI  121

Query  456  EGFSTMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            EGFST  Q C Y + K CKPALA A+FSTI+F+LGA+TS+VSGFLGMKIATY
Sbjct  122  EGFSTKDQACHYSKGKTCKPALANALFSTIAFVLGAITSLVSGFLGMKIATY  173



>gb|AFW85592.1| vacuolar proton pump-like protein [Zea mays]
Length=762

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEEGI  308
            IL  L TE+LIPV A++GIAFA+VQW++VS+VKLSP  S         +A+SLIEEEEG+
Sbjct  3    ILSALATEVLIPVAAVIGIAFAVVQWVVVSRVKLSPAASGGSGGKAG-YADSLIEEEEGL  61

Query  309  NDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCT  488
            NDHNVV KCAEIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST SQPCT
Sbjct  62   NDHNVVVKCAEIQNAISEGATSFLFTEYQYVGIFMAIFAVVIFLFLGSVEGFSTKSQPCT  121

Query  489  YDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            Y + K CKPAL TA+FST+SFLLGA+TS+VSGFLGMKIATY
Sbjct  122  YSKDKYCKPALFTALFSTVSFLLGAITSLVSGFLGMKIATY  162



>ref|XP_002437341.1| hypothetical protein SORBIDRAFT_10g025280 [Sorghum bicolor]
 gb|EER88708.1| hypothetical protein SORBIDRAFT_10g025280 [Sorghum bicolor]
Length=772

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 138/169 (82%), Gaps = 5/169 (3%)
 Frame = +3

Query  120  ASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFA-----ES  284
            +S  LP+LGT++++PV A+VGIAFA++QW+LVSKVKL+PE       +          E 
Sbjct  4    SSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPPRRGDGSAGKSGGAGASEF  63

Query  285  LIEEEEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGF  464
            LIEEEEG+N+HNVV KCAEIQ+AISEGATSFLFTEY+YVG+FM  FA+LIF+FLGSVE F
Sbjct  64   LIEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKYVGLFMGIFAVLIFLFLGSVESF  123

Query  465  STMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            ST SQPC Y + K CKPALA A+FSTI+F+LGAVTS+VSGFLGMKIATY
Sbjct  124  STKSQPCHYSKGKTCKPALANAIFSTIAFVLGAVTSLVSGFLGMKIATY  172



>ref|XP_010039554.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Eucalyptus grandis]
 gb|KCW45903.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
 gb|KCW45904.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
Length=759

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 134/162 (83%), Gaps = 6/162 (4%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE-EEEG  305
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S     +D   K+G+ + LIE EEEG
Sbjct  3    VLSEALTQILIPASALIGIGFALLQWLLVSKVKVS-----ADYGKKDGYKDKLIEDEEEG  57

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
              + + V KCAEIQ+AIS GATSFLFT+Y+Y+GIFMVAFA++IF+FLGSV+GFST S+PC
Sbjct  58   AENADAVIKCAEIQNAISVGATSFLFTQYKYLGIFMVAFAVVIFLFLGSVKGFSTQSEPC  117

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TY+   LCKPALA A+FSTI+FLLGA+TSV+SGFLGMKIATY
Sbjct  118  TYNPGNLCKPALANAMFSTIAFLLGALTSVLSGFLGMKIATY  159



>gb|KCW45902.1| hypothetical protein EUGRSUZ_L00271 [Eucalyptus grandis]
Length=776

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 134/162 (83%), Gaps = 6/162 (4%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE-EEEG  305
            +L +  T+ILIP  A++GI FAL+QW+LVSKVK+S     +D   K+G+ + LIE EEEG
Sbjct  3    VLSEALTQILIPASALIGIGFALLQWLLVSKVKVS-----ADYGKKDGYKDKLIEDEEEG  57

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
              + + V KCAEIQ+AIS GATSFLFT+Y+Y+GIFMVAFA++IF+FLGSV+GFST S+PC
Sbjct  58   AENADAVIKCAEIQNAISVGATSFLFTQYKYLGIFMVAFAVVIFLFLGSVKGFSTQSEPC  117

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TY+   LCKPALA A+FSTI+FLLGA+TSV+SGFLGMKIATY
Sbjct  118  TYNPGNLCKPALANAMFSTIAFLLGALTSVLSGFLGMKIATY  159



>ref|NP_001056966.1| Os06g0178900 [Oryza sativa Japonica Group]
 dbj|BAA08233.1| vacuolar H+-pyrophosphatase [Oryza sativa (japonica cultivar-group)]
 dbj|BAA31524.1| ovp2 [Oryza sativa]
 dbj|BAC22237.1| putative inorganic pyrophosphatase [Oryza sativa Japonica Group]
 dbj|BAF18880.1| Os06g0178900 [Oryza sativa Japonica Group]
 gb|EAY99896.1| hypothetical protein OsI_21891 [Oryza sativa Indica Group]
 gb|EAZ36023.1| hypothetical protein OsJ_20329 [Oryza sativa Japonica Group]
 dbj|BAG90185.1| unnamed protein product [Oryza sativa Japonica Group]
Length=767

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSA----SDSDAKNGFAESLIEE  296
            IL  LGTE+ IPV A VG+AFA+ QW+LV++VK++P  +A    S      G+ + LIEE
Sbjct  3    ILSALGTEVFIPVAAAVGVAFAVAQWLLVARVKVNPAHAAAAAASGGSKNGGYGDYLIEE  62

Query  297  EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMS  476
            EEG+NDHNVV KC EIQ+AISEGATSFLFTEYQYVGIFM  FA++IF+FLGSVEGFST S
Sbjct  63   EEGLNDHNVVVKCHEIQTAISEGATSFLFTEYQYVGIFMSIFAVVIFLFLGSVEGFSTKS  122

Query  477  QPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            QPCTY + K CKPAL  A+FST SFLLGA+TS+VSG+LGMKIAT+
Sbjct  123  QPCTYSKDKYCKPALFNALFSTASFLLGAITSLVSGYLGMKIATF  167



>gb|ACN40474.1| unknown [Picea sitchensis]
Length=764

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 5/168 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MG + +L +  +EILIPV A++GI F+L+QW+LVS+VK+ PEK++S ++    + E L++
Sbjct  1    MGGA-LLSETLSEILIPVAAVIGIGFSLLQWLLVSRVKVGPEKASSRNNGV--YNEFLLD  57

Query  294  E--EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            E  EEG +  N V KCAEIQ+AIS GATSFLFT+Y+Y+GIF V F +LIF+FLGSVEGFS
Sbjct  58   EADEEGTDVRNAVPKCAEIQNAISLGATSFLFTQYKYLGIFTVCFGLLIFLFLGSVEGFS  117

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T  QPC YD  K+CKPALA A+FSTI+F+LGA TSV+SG+LGMKIATY
Sbjct  118  TNQQPCNYDTAKMCKPALANALFSTIAFVLGAFTSVLSGYLGMKIATY  165



>gb|ABR16052.1| unknown [Picea sitchensis]
Length=764

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 5/168 (3%)
 Frame = +3

Query  114  MGASTILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE  293
            MG + +L +  +EILIPV A++GI F+L+QW+LVS+VK+ PEK++S ++    + E L++
Sbjct  1    MGGA-LLSETLSEILIPVAAVIGIGFSLLQWLLVSRVKVGPEKASSRNNGV--YNEFLLD  57

Query  294  E--EEGINDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFS  467
            E  EEG +  N V KCAEIQ+AIS GATSFLFT+Y+Y+GIF V F +LIF+FLGSVEGFS
Sbjct  58   EADEEGTDVRNAVPKCAEIQNAISLGATSFLFTQYKYLGIFTVCFGLLIFLFLGSVEGFS  117

Query  468  TMSQPCTYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            T  QPC YD  K+CKPALA A+FSTI+F+LGA TSV+SG+LGMKIATY
Sbjct  118  TNQQPCNYDTAKMCKPALANALFSTIAFVLGAFTSVLSGYLGMKIATY  165



>ref|XP_007031139.1| Inorganic H pyrophosphatase family protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11641.1| Inorganic H pyrophosphatase family protein isoform 2, partial 
[Theobroma cacao]
Length=543

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 124/158 (78%), Gaps = 9/158 (6%)
 Frame = +3

Query  147  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE---EEEGINDH  317
            T+ILIPV A+VGI FAL QW LVS+VK+S       +D+ N + E LIE   EEEGI++ 
Sbjct  9    TQILIPVAALVGIGFALFQWFLVSRVKVSS------NDSSNEYKEKLIEADEEEEGIDNL  62

Query  318  NVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDE  497
             V  KCAEIQ AIS GATSFLFTEY+Y+GIFM  F  +IF+FLGSV GFST S+PCTY++
Sbjct  63   EVSIKCAEIQHAISVGATSFLFTEYKYLGIFMGVFGAIIFLFLGSVRGFSTKSEPCTYNQ  122

Query  498  TKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
               CKPALA A+FSTI+FLLGA+TSV+SGFLGMKIATY
Sbjct  123  GNTCKPALANALFSTIAFLLGALTSVLSGFLGMKIATY  160



>ref|XP_011023767.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 
1-like [Populus euphratica]
Length=757

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 126/156 (81%), Gaps = 8/156 (5%)
 Frame = +3

Query  147  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-GINDHNV  323
            T++LIP  A+VGIAFAL+QW LVSKVK+S        D+ NG++  LIEEEE GI+   V
Sbjct  9    TQVLIPAAALVGIAFALLQWYLVSKVKVS-------GDSSNGYSSKLIEEEEDGIDSLEV  61

Query  324  VQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDETK  503
              KCAEIQ+AIS GATSFLFT+Y+Y+G+FM  FA +IF FLGSV+GFST S+PCTY + K
Sbjct  62   SIKCAEIQNAISVGATSFLFTQYKYLGVFMGVFAAIIFFFLGSVKGFSTKSEPCTYSQGK  121

Query  504  LCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            LCKPALA A FST++FLLGA+TSV+SGFLGMKIATY
Sbjct  122  LCKPALANAAFSTLAFLLGALTSVLSGFLGMKIATY  157



>emb|CBI39586.3| unnamed protein product [Vitis vinifera]
Length=759

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 133/162 (82%), Gaps = 6/162 (4%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-G  305
            ++ D  T++LIPV A+VGI FAL+QW+LVSKVK+S     +DSD  NG+++ LIEEEE G
Sbjct  3    VMGDTFTQLLIPVAALVGIGFALLQWLLVSKVKVS-----ADSDLNNGYSDRLIEEEEEG  57

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
            I+  +V  KCAEIQ+AIS GATSFLFTEY+Y+ IFM  F  +IF+FLGSV+GFST S+PC
Sbjct  58   IDHEDVAAKCAEIQNAISVGATSFLFTEYRYLSIFMGVFGAIIFLFLGSVKGFSTKSEPC  117

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TY+   LCKPALA A+FSTI+FLLGA+TSV+SGFLGMKIATY
Sbjct  118  TYNTGSLCKPALANALFSTIAFLLGAMTSVLSGFLGMKIATY  159



>ref|XP_010259323.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like 
[Nelumbo nucifera]
Length=761

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 127/156 (81%), Gaps = 4/156 (3%)
 Frame = +3

Query  147  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-GINDHNV  323
            T+ILIPV AIVGI FAL+QW+LVS+V++S +    DS   NG ++ LIEEEE  ++ H V
Sbjct  9    TQILIPVAAIVGIGFALLQWLLVSRVRVSADP---DSGLDNGCSDRLIEEEEESVDIHGV  65

Query  324  VQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDETK  503
              KCAEIQ+AIS GATSFLFTEY+Y+ IFM  F  +IF+FLGSV+GFS  S+PCTY++  
Sbjct  66   AAKCAEIQNAISVGATSFLFTEYKYLSIFMTVFGAIIFLFLGSVKGFSIKSEPCTYNKEN  125

Query  504  LCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            LCKPALA A+FST++FLLGA+TSV+SGFLGMKIAT+
Sbjct  126  LCKPALANAIFSTVAFLLGALTSVLSGFLGMKIATF  161



>ref|XP_002318956.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
 gb|EEE94879.1| inorganic pyrophosphatase family protein [Populus trichocarpa]
Length=757

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 126/156 (81%), Gaps = 8/156 (5%)
 Frame = +3

Query  147  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-GINDHNV  323
            T++LIP  A+VGIAFAL+QW LVSKVK+S        D+ NG++  LIEEEE GI+   V
Sbjct  9    TQVLIPAAALVGIAFALLQWYLVSKVKVS-------GDSSNGYSGKLIEEEEDGIDSLEV  61

Query  324  VQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDETK  503
              KCAEIQ+AIS GATSFLFT+Y+Y+ +FMV FA +IF FLGSV+GFST S+PCTY + K
Sbjct  62   SIKCAEIQNAISVGATSFLFTQYKYLSVFMVVFAAIIFFFLGSVKGFSTKSEPCTYSQGK  121

Query  504  LCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            LCKPALA A FST++FLLGA+TSV+SGFLGMKIATY
Sbjct  122  LCKPALANAAFSTLAFLLGALTSVLSGFLGMKIATY  157



>ref|NP_001268072.1| H+-pyrophosphatase [Vitis vinifera]
 gb|AAF69010.1|AF257777_1 H+-pyrophosphatase [Vitis vinifera]
Length=759

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 132/162 (81%), Gaps = 6/162 (4%)
 Frame = +3

Query  129  ILPDLGTEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIEEEE-G  305
            ++ D  T++LIPV A+VGI FAL+QW+LVSKVK+S     +DSD  NG+++ LIEEEE G
Sbjct  3    VMGDAFTQLLIPVAALVGIGFALLQWLLVSKVKVS-----ADSDLNNGYSDRLIEEEEEG  57

Query  306  INDHNVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPC  485
            I+  +V  KCAEIQ+AIS GATSFLFTEY+Y+ IFM  F  +IF+FLGSV+GFST S+PC
Sbjct  58   IDHEDVAAKCAEIQNAISVGATSFLFTEYRYLSIFMGVFGAIIFLFLGSVKGFSTKSEPC  117

Query  486  TYDETKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
            TY+   LCKPALA A+FSTI+FLLGA+TSV SGFLGMKIATY
Sbjct  118  TYNTGSLCKPALANALFSTIAFLLGAMTSVFSGFLGMKIATY  159



>gb|KJB26321.1| hypothetical protein B456_004G237000 [Gossypium raimondii]
Length=699

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 125/158 (79%), Gaps = 9/158 (6%)
 Frame = +3

Query  147  TEILIPVCAIVGIAFALVQWILVSKVKLSPEKSASDSDAKNGFAESLIE---EEEGINDH  317
            T+I+IP+ ++VGI FAL+QW LVS+VKLS +      D+ NG+ + LIE   EEEGIN+ 
Sbjct  9    TQIVIPLASLVGIGFALLQWFLVSRVKLSSQ------DSSNGYKQKLIESDEEEEGINNL  62

Query  318  NVVQKCAEIQSAISEGATSFLFTEYQYVGIFMVAFAILIFVFLGSVEGFSTMSQPCTYDE  497
             +  KC EIQ AIS GATSFLFTEY+Y+GIFM  F  +IF+FLGSV+GFST S+PCTY +
Sbjct  63   EISIKCTEIQHAISVGATSFLFTEYKYLGIFMCVFGAIIFLFLGSVKGFSTKSEPCTYSQ  122

Query  498  TKLCKPALATAVFSTISFLLGAVTSVVSGFLGMKIATY  611
               CKPALA A+FSTI+FLLGA+TSV+SG+LGMKIATY
Sbjct  123  GNTCKPALANAIFSTIAFLLGALTSVLSGYLGMKIATY  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660