BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS135C10

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007158477.1|  hypothetical protein PHAVU_002G155600g             115   2e-25   Phaseolus vulgaris [French bean]
ref|XP_007158478.1|  hypothetical protein PHAVU_002G155600g             109   1e-23   Phaseolus vulgaris [French bean]
ref|XP_009589209.1|  PREDICTED: uncharacterized protein LOC104086...    108   5e-23   Nicotiana tomentosiformis
ref|XP_009782392.1|  PREDICTED: uncharacterized protein LOC104231...    104   1e-21   Nicotiana sylvestris
ref|XP_009782391.1|  PREDICTED: uncharacterized protein LOC104231...    100   3e-20   Nicotiana sylvestris
ref|XP_009782390.1|  PREDICTED: uncharacterized protein LOC104231...    100   3e-20   Nicotiana sylvestris
ref|XP_009589208.1|  PREDICTED: uncharacterized protein LOC104086...    100   3e-20   Nicotiana tomentosiformis
gb|KHN16846.1|  Methyl-CpG-binding domain-containing protein 13       97.8    1e-19   Glycine soja [wild soybean]
ref|XP_003532403.1|  PREDICTED: methyl-CpG-binding domain-contain...  97.4    2e-19   Glycine max [soybeans]
ref|XP_011072312.1|  PREDICTED: uncharacterized protein LOC105157...  96.3    3e-19   Sesamum indicum [beniseed]
ref|XP_011072316.1|  PREDICTED: uncharacterized protein LOC105157...  96.3    3e-19   Sesamum indicum [beniseed]
ref|XP_006580605.1|  PREDICTED: uncharacterized protein LOC100782433  96.3    4e-19   Glycine max [soybeans]
ref|XP_002276814.3|  PREDICTED: methyl-CpG-binding domain-contain...  94.4    4e-19   Vitis vinifera
gb|KHN23667.1|  Methyl-CpG-binding domain-containing protein 13       96.3    4e-19   Glycine soja [wild soybean]
ref|XP_010661063.1|  PREDICTED: methyl-CpG-binding domain-contain...  94.4    5e-19   Vitis vinifera
ref|XP_010661055.1|  PREDICTED: methyl-CpG-binding domain-contain...  94.4    6e-19   Vitis vinifera
ref|XP_002509754.1|  hypothetical protein RCOM_1685990                95.5    7e-19   
ref|XP_010661051.1|  PREDICTED: methyl-CpG-binding domain-contain...  94.4    8e-19   Vitis vinifera
ref|XP_010325420.1|  PREDICTED: uncharacterized protein LOC101264...  95.5    9e-19   Solanum lycopersicum
ref|XP_010325421.1|  PREDICTED: uncharacterized protein LOC101264...  95.5    9e-19   Solanum lycopersicum
ref|XP_004245626.1|  PREDICTED: uncharacterized protein LOC101264...  95.5    9e-19   Solanum lycopersicum
ref|XP_006358896.1|  PREDICTED: uncharacterized protein LOC102587...  95.1    1e-18   Solanum tuberosum [potatoes]
ref|XP_007158475.1|  hypothetical protein PHAVU_002G155600g           94.7    1e-18   Phaseolus vulgaris [French bean]
ref|XP_006358895.1|  PREDICTED: uncharacterized protein LOC102587...  95.1    1e-18   Solanum tuberosum [potatoes]
ref|XP_006358894.1|  PREDICTED: uncharacterized protein LOC102587...  95.1    1e-18   Solanum tuberosum [potatoes]
emb|CBI34715.3|  unnamed protein product                              94.7    1e-18   Vitis vinifera
ref|XP_007160033.1|  hypothetical protein PHAVU_002G287000g           94.7    2e-18   Phaseolus vulgaris [French bean]
ref|XP_004503754.1|  PREDICTED: uncharacterized protein LOC101511357  93.6    4e-18   Cicer arietinum [garbanzo]
gb|KDO55595.1|  hypothetical protein CISIN_1g0013392mg                88.6    1e-17   Citrus sinensis [apfelsine]
gb|KDO55594.1|  hypothetical protein CISIN_1g0013392mg                88.6    1e-17   Citrus sinensis [apfelsine]
gb|KDO55591.1|  hypothetical protein CISIN_1g0013392mg                88.6    1e-17   Citrus sinensis [apfelsine]
ref|XP_007040167.1|  Uncharacterized protein TCM_016211               91.3    2e-17   
ref|XP_007038659.1|  Methyl-CPG-binding domain protein 13, putati...  90.9    2e-17   
ref|XP_007038658.1|  Methyl-CPG-binding domain protein 13, putati...  90.5    2e-17   
gb|KJB39638.1|  hypothetical protein B456_007G022700                  91.3    2e-17   Gossypium raimondii
gb|KJB39637.1|  hypothetical protein B456_007G022700                  90.9    2e-17   Gossypium raimondii
gb|EPS58890.1|  hypothetical protein M569_15921                       82.8    5e-17   Genlisea aurea
ref|XP_002510809.1|  conserved hypothetical protein                   89.4    5e-17   
ref|XP_007158476.1|  hypothetical protein PHAVU_002G155600g           89.4    7e-17   Phaseolus vulgaris [French bean]
ref|XP_006590528.1|  PREDICTED: methyl-CpG-binding domain-contain...  84.7    8e-17   
emb|CDP09782.1|  unnamed protein product                              89.0    9e-17   Coffea canephora [robusta coffee]
gb|EYU38370.1|  hypothetical protein MIMGU_mgv1a007205mg              87.0    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_008437229.1|  PREDICTED: transcriptional regulator ATRX ho...  87.8    2e-16   Cucumis melo [Oriental melon]
ref|XP_004143925.1|  PREDICTED: uncharacterized protein LOC101223188  88.2    2e-16   Cucumis sativus [cucumbers]
ref|XP_006477436.1|  PREDICTED: uncharacterized protein LOC102622266  87.8    3e-16   
ref|XP_008351681.1|  PREDICTED: uncharacterized protein LOC103415104  87.0    4e-16   
gb|KEH21030.1|  methyl-CpG-binding domain protein                     87.4    5e-16   Medicago truncatula
ref|XP_006440582.1|  hypothetical protein CICLE_v10018609mg           87.0    5e-16   Citrus clementina [clementine]
ref|XP_008392616.1|  PREDICTED: uncharacterized protein LOC103454798  87.0    5e-16   
ref|XP_006440581.1|  hypothetical protein CICLE_v10018609mg           87.0    5e-16   Citrus clementina [clementine]
ref|XP_009401689.1|  PREDICTED: uncharacterized protein LOC103985...  85.9    5e-16   
ref|XP_006440583.1|  hypothetical protein CICLE_v10018609mg           87.0    6e-16   
ref|XP_009401688.1|  PREDICTED: uncharacterized protein LOC103985...  85.5    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011463824.1|  PREDICTED: uncharacterized protein LOC101312...  85.5    2e-15   Fragaria vesca subsp. vesca
gb|KJB52811.1|  hypothetical protein B456_008G278300                  84.7    2e-15   Gossypium raimondii
ref|XP_011463825.1|  PREDICTED: uncharacterized protein LOC101312...  85.1    2e-15   Fragaria vesca subsp. vesca
gb|KHG28622.1|  Methyl-CpG-binding domain-containing 13 -like pro...  84.3    2e-15   Gossypium arboreum [tree cotton]
ref|XP_007211158.1|  hypothetical protein PRUPE_ppa027142mg           84.3    3e-15   
ref|XP_008238911.1|  PREDICTED: uncharacterized protein LOC103337528  83.6    4e-15   
gb|KDP25474.1|  hypothetical protein JCGZ_20630                       83.6    7e-15   Jatropha curcas
ref|XP_009375788.1|  PREDICTED: methyl-CpG-binding domain-contain...  83.6    8e-15   Pyrus x bretschneideri [bai li]
ref|XP_009375787.1|  PREDICTED: uncharacterized protein LOC103964...  83.6    8e-15   
ref|XP_009369054.1|  PREDICTED: uncharacterized protein LOC103958513  82.8    2e-14   
ref|XP_008367419.1|  PREDICTED: uncharacterized protein LOC103431052  82.4    2e-14   
gb|EMT07793.1|  hypothetical protein F775_13908                       82.4    2e-14   
ref|XP_008796741.1|  PREDICTED: uncharacterized protein LOC103712...  81.3    3e-14   Phoenix dactylifera
gb|EMS57086.1|  Methyl-CpG-binding domain-containing protein 13       81.6    3e-14   Triticum urartu
ref|XP_008796736.1|  PREDICTED: uncharacterized protein LOC103712...  80.9    4e-14   Phoenix dactylifera
ref|XP_008796738.1|  PREDICTED: uncharacterized protein LOC103712...  80.9    4e-14   Phoenix dactylifera
ref|XP_008437227.1|  PREDICTED: uncharacterized protein LOC103482...  80.9    4e-14   Cucumis melo [Oriental melon]
gb|KDO60033.1|  hypothetical protein CISIN_1g008463mg                 80.5    4e-14   Citrus sinensis [apfelsine]
ref|XP_008437228.1|  PREDICTED: uncharacterized protein LOC103482...  80.9    4e-14   Cucumis melo [Oriental melon]
ref|XP_006490367.1|  PREDICTED: methyl-CpG-binding domain-contain...  80.5    5e-14   Citrus sinensis [apfelsine]
ref|XP_006421896.1|  hypothetical protein CICLE_v10004647mg           80.5    5e-14   Citrus clementina [clementine]
gb|KDO60032.1|  hypothetical protein CISIN_1g008463mg                 80.5    5e-14   Citrus sinensis [apfelsine]
ref|XP_008796740.1|  PREDICTED: uncharacterized protein LOC103712...  80.1    7e-14   Phoenix dactylifera
ref|XP_008796735.1|  PREDICTED: uncharacterized protein LOC103712...  80.1    9e-14   Phoenix dactylifera
ref|XP_008796737.1|  PREDICTED: uncharacterized protein LOC103712...  79.7    9e-14   Phoenix dactylifera
ref|XP_010035117.1|  PREDICTED: uncharacterized protein LOC104424...  79.0    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010035118.1|  PREDICTED: methyl-CpG-binding domain-contain...  79.0    2e-13   Eucalyptus grandis [rose gum]
ref|XP_004972592.1|  PREDICTED: methyl-CpG-binding domain-contain...  79.0    2e-13   Setaria italica
emb|CBI31785.3|  unnamed protein product                              77.4    5e-13   Vitis vinifera
ref|XP_010662494.1|  PREDICTED: uncharacterized protein LOC100263...  77.4    5e-13   Vitis vinifera
ref|XP_010273135.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.0    7e-13   Nelumbo nucifera [Indian lotus]
ref|XP_011030071.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.0    8e-13   Populus euphratica
ref|XP_011030070.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.0    8e-13   Populus euphratica
ref|XP_011012359.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.0    9e-13   Populus euphratica
ref|XP_011030072.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.0    9e-13   Populus euphratica
ref|XP_011012358.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.0    9e-13   Populus euphratica
ref|XP_011012360.1|  PREDICTED: methyl-CpG-binding domain-contain...  77.0    9e-13   Populus euphratica
ref|XP_010918514.1|  PREDICTED: methyl-CpG-binding domain-contain...  76.3    9e-13   
ref|XP_009595657.1|  PREDICTED: methyl-CpG-binding domain-contain...  76.3    1e-12   Nicotiana tomentosiformis
ref|XP_010918513.1|  PREDICTED: methyl-CpG-binding domain-contain...  76.3    1e-12   
ref|XP_010662495.1|  PREDICTED: uncharacterized protein LOC100263...  76.3    1e-12   Vitis vinifera
ref|XP_010934846.1|  PREDICTED: uncharacterized protein LOC105054...  76.3    1e-12   Elaeis guineensis
ref|XP_008662741.1|  PREDICTED: uncharacterized protein LOC103641...  74.7    5e-12   Zea mays [maize]
ref|XP_008662742.1|  PREDICTED: uncharacterized protein LOC103641...  74.7    5e-12   Zea mays [maize]
ref|XP_011041595.1|  PREDICTED: uncharacterized protein LOC105137...  74.3    6e-12   Populus euphratica
ref|NP_001061241.1|  Os08g0206700                                     73.6    6e-12   
ref|XP_011048654.1|  PREDICTED: methyl-CpG-binding domain-contain...  74.3    7e-12   Populus euphratica
ref|XP_011041590.1|  PREDICTED: uncharacterized protein LOC105137...  74.3    7e-12   Populus euphratica
ref|XP_011041593.1|  PREDICTED: uncharacterized protein LOC105137...  74.3    7e-12   Populus euphratica
ref|XP_011041592.1|  PREDICTED: uncharacterized protein LOC105137...  74.3    7e-12   Populus euphratica
ref|XP_011048657.1|  PREDICTED: uncharacterized protein LOC105142...  74.3    7e-12   Populus euphratica
ref|XP_011048652.1|  PREDICTED: methyl-CpG-binding domain-contain...  74.3    7e-12   Populus euphratica
ref|XP_011048653.1|  PREDICTED: methyl-CpG-binding domain-contain...  74.3    7e-12   Populus euphratica
ref|XP_011041591.1|  PREDICTED: uncharacterized protein LOC105137...  74.3    7e-12   Populus euphratica
ref|XP_009760427.1|  PREDICTED: methyl-CpG-binding domain-contain...  73.2    1e-11   Nicotiana sylvestris
dbj|BAK01530.1|  predicted protein                                    73.6    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010234460.1|  PREDICTED: uncharacterized protein LOC100834...  73.2    2e-11   
ref|XP_010234457.1|  PREDICTED: uncharacterized protein LOC100834...  73.2    2e-11   Brachypodium distachyon [annual false brome]
ref|NP_001170014.1|  hypothetical protein                             72.0    2e-11   Zea mays [maize]
gb|EMT22364.1|  hypothetical protein F775_06449                       72.4    2e-11   
ref|XP_006653226.1|  PREDICTED: uncharacterized protein LOC102699500  72.4    2e-11   
ref|XP_002318826.1|  hypothetical protein POPTR_0012s13490g           72.8    2e-11   
ref|XP_006659212.1|  PREDICTED: uncharacterized protein LOC102718198  72.8    3e-11   Oryza brachyantha
ref|XP_008791903.1|  PREDICTED: uncharacterized protein LOC103708650  72.0    3e-11   Phoenix dactylifera
ref|NP_001052334.1|  Os04g0266400                                     70.5    3e-11   
emb|CAD39968.2|  OSJNBa0072D08.3                                      71.6    3e-11   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66253.1|  OSIGBa0139I12.2                                      71.6    3e-11   Oryza sativa [red rice]
dbj|BAG89597.1|  unnamed protein product                              72.0    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76899.1|  hypothetical protein OsI_15124                        71.2    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008678194.1|  PREDICTED: uncharacterized protein LOC103652994  72.0    4e-11   Zea mays [maize]
ref|XP_002444023.1|  hypothetical protein SORBIDRAFT_07g006030        72.4    4e-11   Sorghum bicolor [broomcorn]
gb|AFW61002.1|  hypothetical protein ZEAMMB73_269384                  72.0    4e-11   
ref|XP_002321896.2|  hypothetical protein POPTR_0015s13470g           72.0    4e-11   Populus trichocarpa [western balsam poplar]
dbj|BAA89308.1|  AHM2                                                 70.5    4e-11   Triticum aestivum [Canadian hard winter wheat]
emb|CDP05220.1|  unnamed protein product                              71.2    5e-11   Coffea canephora [robusta coffee]
gb|EMT11132.1|  hypothetical protein F775_24324                       70.5    6e-11   
ref|XP_003581103.2|  PREDICTED: uncharacterized protein LOC100844...  70.9    7e-11   Brachypodium distachyon [annual false brome]
ref|XP_004976791.1|  PREDICTED: methyl-CpG-binding domain-contain...  70.1    8e-11   
gb|AGT16604.1|  hypothetical protein SHCRBa_016_K03_R_160             70.1    1e-10   Saccharum hybrid cultivar R570
ref|XP_002448522.1|  hypothetical protein SORBIDRAFT_06g028360        69.3    1e-10   Sorghum bicolor [broomcorn]
gb|EEC83090.1|  hypothetical protein OsI_28224                        70.1    2e-10   Oryza sativa Indica Group [Indian rice]
gb|EMS68477.1|  hypothetical protein TRIUR3_20569                     69.7    2e-10   Triticum urartu
ref|XP_006664919.1|  PREDICTED: uncharacterized protein LOC102722078  67.4    2e-10   
ref|XP_009390518.1|  PREDICTED: uncharacterized protein LOC103976...  69.3    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390512.1|  PREDICTED: uncharacterized protein LOC103976...  69.3    2e-10   
ref|XP_009390529.1|  PREDICTED: uncharacterized protein LOC103976...  69.3    2e-10   
gb|EEE68228.1|  hypothetical protein OsJ_26412                        69.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006353332.1|  PREDICTED: methyl-CpG-binding domain-contain...  68.9    3e-10   Solanum tuberosum [potatoes]
ref|XP_010521336.1|  PREDICTED: methyl-CpG-binding domain-contain...  68.9    4e-10   
ref|XP_002447565.1|  hypothetical protein SORBIDRAFT_06g004050        67.4    4e-10   
ref|XP_010444604.1|  PREDICTED: methyl-CpG-binding domain-contain...  68.6    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_004234378.1|  PREDICTED: methyl-CpG-binding domain-contain...  68.2    5e-10   Solanum lycopersicum
ref|XP_010444597.1|  PREDICTED: methyl-CpG-binding domain-contain...  68.6    5e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010317585.1|  PREDICTED: methyl-CpG-binding domain-contain...  68.2    5e-10   
ref|XP_011076193.1|  PREDICTED: methyl-CpG-binding domain-contain...  68.2    5e-10   
gb|EYU25079.1|  hypothetical protein MIMGU_mgv11b021680mg             67.0    6e-10   Erythranthe guttata [common monkey flower]
ref|XP_010676506.1|  PREDICTED: uncharacterized protein LOC104892...  68.2    7e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676507.1|  PREDICTED: uncharacterized protein LOC104892...  68.2    7e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676508.1|  PREDICTED: uncharacterized protein LOC104892...  68.2    8e-10   
ref|XP_010482573.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.8    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010482572.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.8    9e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011084407.1|  PREDICTED: methyl-CpG-binding domain-contain...  67.0    1e-09   Sesamum indicum [beniseed]
ref|XP_004977782.1|  PREDICTED: uncharacterized protein LOC101761695  66.6    1e-09   
ref|XP_006279588.1|  hypothetical protein CARUB_v10026033mg           67.0    1e-09   
ref|XP_006279589.1|  hypothetical protein CARUB_v10026033mg           67.0    2e-09   Capsella rubella
gb|KFK26832.1|  hypothetical protein AALP_AA8G299600                  67.0    2e-09   Arabis alpina [alpine rockcress]
ref|NP_001105290.1|  LOC542207                                        65.1    2e-09   
ref|XP_006652812.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    3e-09   Oryza brachyantha
ref|XP_006652814.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    3e-09   Oryza brachyantha
ref|XP_003572272.2|  PREDICTED: uncharacterized protein LOC100826562  65.1    3e-09   Brachypodium distachyon [annual false brome]
emb|CBI34714.3|  unnamed protein product                              65.9    3e-09   Vitis vinifera
ref|XP_008234128.1|  PREDICTED: methyl-CpG-binding domain-contain...  65.5    4e-09   Prunus mume [ume]
gb|AFW57951.1|  methyl-binding domain MBD113 protein                  65.1    5e-09   
gb|EEC77988.1|  hypothetical protein OsI_17375                        64.7    5e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004982529.1|  PREDICTED: uncharacterized protein LOC101763097  64.7    5e-09   
ref|XP_008662320.1|  PREDICTED: LOC542207 isoform X3                  65.1    5e-09   Zea mays [maize]
gb|AFW57954.1|  methyl-binding domain MBD113 protein                  65.1    5e-09   
ref|NP_001053858.1|  Os04g0613800                                     64.7    5e-09   
ref|XP_008662316.1|  PREDICTED: LOC542207 isoform X1                  65.1    5e-09   
ref|NP_001159179.1|  uncharacterized protein LOC100304264             64.7    5e-09   
ref|XP_008662319.1|  PREDICTED: LOC542207 isoform X2                  65.1    6e-09   Zea mays [maize]
gb|EMT21477.1|  hypothetical protein F775_23896                       64.7    6e-09   
emb|CAE05215.3|  OSJNBa0070C17.22                                     64.7    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009418271.1|  PREDICTED: uncharacterized protein LOC103998...  62.0    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_200036.1|  methyl-CPG-binding domain protein 13                63.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM97069.1|  unknown protein                                       63.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010107428.1|  Methyl-CpG-binding domain-containing protein 13  63.9    1e-08   
ref|XP_009418270.1|  PREDICTED: uncharacterized protein LOC103998...  62.4    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008665005.1|  PREDICTED: uncharacterized protein LOC103643620  62.8    2e-08   
ref|XP_007152298.1|  hypothetical protein PHAVU_004G117900g           63.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_006653233.1|  PREDICTED: uncharacterized protein LOC102703961  61.6    4e-08   
tpg|DAA59672.1|  TPA: hypothetical protein ZEAMMB73_581852            61.6    7e-08   
ref|XP_002865903.1|  hypothetical protein ARALYDRAFT_495292           62.0    7e-08   
gb|AFW80349.1|  hypothetical protein ZEAMMB73_827373                  61.6    7e-08   
gb|EAZ30036.1|  hypothetical protein OsJ_14093                        61.2    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008439211.1|  PREDICTED: methyl-CpG-binding domain-contain...  58.9    7e-08   Cucumis melo [Oriental melon]
ref|XP_008674081.1|  PREDICTED: uncharacterized protein LOC103650258  59.3    7e-08   
ref|XP_010089149.1|  hypothetical protein L484_024324                 61.6    8e-08   
emb|CAD39866.2|  OSJNBb0058J09.3                                      60.8    9e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580540.1|  PREDICTED: uncharacterized protein LOC100838054  60.8    1e-07   
emb|CAH67925.1|  OSIGBa0138E08-OSIGBa0161L23.6                        60.8    1e-07   Oryza sativa [red rice]
gb|EAY93364.1|  hypothetical protein OsI_15161                        60.5    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_008439210.1|  PREDICTED: methyl-CpG-binding domain-contain...  58.5    2e-07   
ref|XP_008439209.1|  PREDICTED: methyl-CpG-binding domain-contain...  58.5    2e-07   Cucumis melo [Oriental melon]
tpg|DAA50117.1|  TPA: hypothetical protein ZEAMMB73_042225            59.7    2e-07   
ref|XP_002461981.1|  hypothetical protein SORBIDRAFT_02g011480        58.5    3e-07   
ref|XP_006401848.1|  hypothetical protein EUTSA_v10012954mg           59.7    3e-07   Eutrema salsugineum [saltwater cress]
ref|XP_008796743.1|  PREDICTED: uncharacterized protein LOC103712...  59.7    4e-07   Phoenix dactylifera
ref|XP_002466891.1|  hypothetical protein SORBIDRAFT_01g015940        57.8    4e-07   
gb|ABO69709.1|  MBD3                                                  56.6    6e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002444304.1|  hypothetical protein SORBIDRAFT_07g019900        57.8    8e-07   
ref|XP_008796742.1|  PREDICTED: uncharacterized protein LOC103712...  58.5    9e-07   Phoenix dactylifera
ref|XP_002466890.1|  hypothetical protein SORBIDRAFT_01g015930        57.8    9e-07   
ref|XP_002448792.1|  hypothetical protein SORBIDRAFT_06g033275        57.8    1e-06   
gb|EMT08445.1|  hypothetical protein F775_07512                       57.0    1e-06   
ref|XP_010693525.1|  PREDICTED: uncharacterized protein LOC104906467  57.0    2e-06   Beta vulgaris subsp. vulgaris [field beet]
emb|CAH67758.1|  H0124E07.5                                           56.6    3e-06   Oryza sativa [red rice]
ref|XP_002444202.1|  hypothetical protein SORBIDRAFT_07g014920        55.8    4e-06   
emb|CAE04540.2|  OSJNBa0040D17.8                                      55.8    5e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ29862.1|  hypothetical protein OsJ_13921                        55.8    5e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KHN28399.1|  Methyl-CpG-binding domain-containing protein 13       55.8    6e-06   Glycine soja [wild soybean]
gb|EEE60561.1|  hypothetical protein OsJ_13923                        55.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAE01997.2|  OSJNBb0033G08.13                                     55.1    9e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAN74037.1|  hypothetical protein VITISV_023406                   55.5    9e-06   Vitis vinifera
emb|CAE01991.2|  OSJNBb0033G08.7                                      55.1    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60563.1|  hypothetical protein OsJ_13925                        54.7    1e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99501.1|  predicted protein                                    54.7    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC76836.1|  hypothetical protein OsI_14986                        53.9    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_011015295.1|  PREDICTED: methyl-CpG-binding domain-contain...  52.8    2e-05   Populus euphratica
emb|CDY31911.1|  BnaC09g28330D                                        54.3    2e-05   Brassica napus [oilseed rape]
gb|KGN57363.1|  hypothetical protein Csa_3G181990                     54.3    2e-05   Cucumis sativus [cucumbers]
ref|XP_009106826.1|  PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-b...  54.3    2e-05   
ref|XP_006846186.1|  hypothetical protein AMTR_s00012p00212320        53.9    2e-05   
dbj|BAK04695.1|  predicted protein                                    53.9    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002961436.1|  hypothetical protein SELMODRAFT_437797           53.5    4e-05   
ref|XP_008378256.1|  PREDICTED: uncharacterized protein LOC103441353  53.5    4e-05   
ref|XP_006827729.1|  hypothetical protein AMTR_s00009p00261370        53.5    4e-05   Amborella trichopoda
ref|XP_002990266.1|  hypothetical protein SELMODRAFT_428715           53.1    5e-05   
emb|CDY00521.1|  BnaA10g07520D                                        52.8    7e-05   
ref|XP_010255468.1|  PREDICTED: uncharacterized protein LOC104596...  52.4    9e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010255467.1|  PREDICTED: uncharacterized protein LOC104596...  52.0    1e-04   Nelumbo nucifera [Indian lotus]
ref|XP_007016410.1|  Methyl-CPG-binding domain protein 5, putativ...  51.2    1e-04   Theobroma cacao [chocolate]
ref|XP_010934847.1|  PREDICTED: uncharacterized protein LOC105054...  52.0    1e-04   
ref|XP_006369523.1|  hypothetical protein POPTR_0001s24690g           50.1    1e-04   
ref|XP_007016409.1|  Methyl-CPG-binding domain protein 5, putativ...  51.2    1e-04   
ref|XP_004294545.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    1e-04   Fragaria vesca subsp. vesca
ref|XP_009353664.1|  PREDICTED: methyl-CpG-binding domain-contain...  50.8    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_006369524.1|  hypothetical protein POPTR_0001s24690g           49.7    2e-04   
ref|XP_010521339.1|  PREDICTED: methyl-CpG-binding domain-contain...  51.6    2e-04   Tarenaya hassleriana [spider flower]
gb|KHN31504.1|  Methyl-CpG-binding domain-containing protein 13       51.2    2e-04   Glycine soja [wild soybean]
ref|XP_002299872.1|  methyl-CpG-binding domain-containing family ...  50.1    2e-04   Populus trichocarpa [western balsam poplar]
gb|AFW80350.1|  hypothetical protein ZEAMMB73_827373                  47.8    6e-04   
ref|XP_010255469.1|  PREDICTED: uncharacterized protein LOC104596...  49.7    7e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009345985.1|  PREDICTED: methyl-CpG-binding domain-contain...  48.5    0.001   Pyrus x bretschneideri [bai li]



>ref|XP_007158477.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30471.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=1004

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 94/170 (55%), Gaps = 14/170 (8%)
 Frame = +1

Query  115  VSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGD  294
            + P  V+     +LP GW  E K R+ G G RKD +Y DPVSGYVFRSKKDA RY+++GD
Sbjct  126  IDPDTVEKSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGD  185

Query  295  ISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAK  474
            IS CA+KP  R+        + D  K S  ++ S  +          K +K  +GKR   
Sbjct  186  ISACAIKPFKRQ--------NQDEDKVSNAVEKSIIEDLPPGHLTKVKIRKGSNGKR---  234

Query  475  VVSNAEGQTESVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
             +     +   V+ LPPGW  E + RK GT  K D  Y+DPVSG+ FRSK
Sbjct  235  -IDPDSDKKSQVEDLPPGWITEAKVRKGGTGKKKDLLYLDPVSGYVFRSK  283


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 15/115 (13%)
 Frame = +1

Query  28   VSPNEKSVEDNSQISKR-RKSVVDKRPAKIVSPVAVQNGSE--------------SELPA  162
            + P ++  +D  ++S    KS+++  P   ++ V ++ GS                +LP 
Sbjct  191  IKPFKRQNQDEDKVSNAVEKSIIEDLPPGHLTKVKIRKGSNGKRIDPDSDKKSQVEDLPP  250

Query  163  GWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            GWI E K R+ G G +KD  Y DPVSGYVFRSKKDA RY+ +GDI  C +KP  R
Sbjct  251  GWITEAKVRKGGTGKKKDLLYLDPVSGYVFRSKKDALRYVNSGDIDTCVLKPYKR  305


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 78/169 (46%), Gaps = 43/169 (25%)
 Frame = +1

Query  154  LPAGWIKEYKTRR----LGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET-GDISKCAMKP  318
            LP GWI E KTR+    +G G +    Y DP +G  F SK +  RY+ET    S  + K 
Sbjct  35   LPDGWIVESKTRKSGANMGCGYK---CYIDP-TGCKFYSKPEVLRYLETVNSNSHSSKKE  90

Query  319  TLREPG-----PTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKR--PAKV  477
             +R+        T+ DL  D                        K +KS +G R  P  V
Sbjct  91   KMRKSNDAVEKSTAEDLPPDQIAD-------------------VKMKKSSNGYRIDPDTV  131

Query  478  VSNAEGQTESVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
                  +   V+ LPPGWT E + RK GT  + D FY+DPVSG+ FRSK
Sbjct  132  ------EKSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSK  174



>ref|XP_007158478.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30472.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=972

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 87/170 (51%), Gaps = 46/170 (27%)
 Frame = +1

Query  115  VSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGD  294
            + P  V+     +LP GW  E K R+ G G RKD +Y DPVSGYVFRSKKDA RY+++GD
Sbjct  126  IDPDTVEKSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGD  185

Query  295  ISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAK  474
            IS CA+KP                                       K+Q     K    
Sbjct  186  ISACAIKP--------------------------------------FKRQNQDEDK----  203

Query  475  VVSNAEGQTESVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
             VS+++ +++ V+ LPPGW  E + RK GT  K D  Y+DPVSG+ FRSK
Sbjct  204  -VSDSDKKSQ-VEDLPPGWITEAKVRKGGTGKKKDLLYLDPVSGYVFRSK  251


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            +LP GWI E K R+ G G +KD  Y DPVSGYVFRSKKDA RY+ +GDI  C +KP  R
Sbjct  215  DLPPGWITEAKVRKGGTGKKKDLLYLDPVSGYVFRSKKDALRYVNSGDIDTCVLKPYKR  273


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 78/169 (46%), Gaps = 43/169 (25%)
 Frame = +1

Query  154  LPAGWIKEYKTRR----LGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET-GDISKCAMKP  318
            LP GWI E KTR+    +G G +    Y DP +G  F SK +  RY+ET    S  + K 
Sbjct  35   LPDGWIVESKTRKSGANMGCGYK---CYIDP-TGCKFYSKPEVLRYLETVNSNSHSSKKE  90

Query  319  TLREPG-----PTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKR--PAKV  477
             +R+        T+ DL  D                        K +KS +G R  P  V
Sbjct  91   KMRKSNDAVEKSTAEDLPPDQIAD-------------------VKMKKSSNGYRIDPDTV  131

Query  478  VSNAEGQTESVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
                  +   V+ LPPGWT E + RK GT  + D FY+DPVSG+ FRSK
Sbjct  132  ------EKSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSK  174



>ref|XP_009589209.1| PREDICTED: uncharacterized protein LOC104086600 isoform X2 [Nicotiana 
tomentosiformis]
Length=1739

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 71/113 (63%), Gaps = 6/113 (5%)
 Frame = +1

Query  10   HHNIEEVSPNEKSVEDN------SQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWI  171
            H   E+ S NEK+  D+      S +SKR+K   D   +K V  VAV   S  ELP GW 
Sbjct  257  HGAGEDFSLNEKASLDSKENGVQSPLSKRQKPGSDSPSSKTVCSVAVDCNSVDELPPGWK  316

Query  172  KEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            KE   R+   GIRKDP YTDPV GYVFRSKKD  RY++TGDISKCA+KP  R+
Sbjct  317  KEVIIRQTDRGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDISKCAIKPVKRD  369


 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  151   ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
             ELP GW KE + R+   GIRKDP+YTDPV GYVFRSKKD  RY++TGDIS+CAM+PT R+
Sbjct  1154  ELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAMRPTKRD  1213

Query  331   P  333
             P
Sbjct  1214  P  1214


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +1

Query  430  VAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGF  603
            ++K+QK GS    +K V +      SVD LPPGW +E   R+   G + DP Y DPV G+
Sbjct  282  LSKRQKPGSDSPSSKTVCSVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDPLYTDPVHGY  341

Query  604  GFRSK  618
             FRSK
Sbjct  342  VFRSK  346


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             SVD LPPGW +E R R+   G + DPFY DPV G+ FRSK
Sbjct  1151  SVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSK  1190



>ref|XP_009782392.1| PREDICTED: uncharacterized protein LOC104231139 isoform X3 [Nicotiana 
sylvestris]
Length=1613

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 70/119 (59%), Gaps = 7/119 (6%)
 Frame = +1

Query  22   EEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGH  201
            E+ S N K     S  SKR+K   D   A  V  VAV   S  ELP GW KE   R+   
Sbjct  267  EKASLNSKENGVQSPSSKRQKPGSDSPSAMTVCSVAVDCNSVDELPPGWKKEVIIRQTDR  326

Query  202  GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP-------TLREPGPTSTDLS  357
            GIRKDP YTDPV GYVFRSKKD  RY++TGDISKCA+KP       T++E  P + + S
Sbjct  327  GIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDISKCAIKPFKRDLDATMKESSPAAHNTS  385


 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  151   ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
             ELP GW KE + R+   GIRKDP+YTDPV GYVFRSKKD  RY++TGDIS+CAM+PT R+
Sbjct  1028  ELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAMRPTKRD  1087

Query  331   P  333
             P
Sbjct  1088  P  1088


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +1

Query  433  AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFG  606
            +K+QK GS    A  V +      SVD LPPGW +E   R+   G + DP Y DPV G+ 
Sbjct  283  SKRQKPGSDSPSAMTVCSVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDPLYTDPVHGYV  342

Query  607  FRSK  618
            FRSK
Sbjct  343  FRSK  346


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             SVD LPPGW +E R R+   G + DPFY DPV G+ FRSK
Sbjct  1025  SVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSK  1064



>ref|XP_009782391.1| PREDICTED: uncharacterized protein LOC104231139 isoform X2 [Nicotiana 
sylvestris]
Length=1881

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  151   ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
             ELP GW KE + R+   GIRKDP+YTDPV GYVFRSKKD  RY++TGDIS+CAM+PT R+
Sbjct  1296  ELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAMRPTKRD  1355

Query  331   P  333
             P
Sbjct  1356  P  1356


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 7/76 (9%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP----  318
            ELP GW KE K  +   GIRKDP YTDPV GYVFRSKKD  RY++TGDISKCA+KP    
Sbjct  578  ELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDISKCAIKPFKRD  637

Query  319  ---TLREPGPTSTDLS  357
               T++E  P + + S
Sbjct  638  LDATMKESSPAAHNTS  653


 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 67/115 (58%), Gaps = 3/115 (3%)
 Frame = +1

Query  22   EEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGH  201
            E+ S N K     S  SKR+K   D  P+ +   VAV   S  ELP GW KE   R+   
Sbjct  267  EKASLNSKENGVQSPSSKRQKPGSDS-PSAMT--VAVDCNSVDELPPGWKKEVIIRQTDR  323

Query  202  GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGPTSTDLSYDT  366
            GIRKDP YTDPV GY FRSKK+ FRY++TGD SKCA + + R    T  D S+ T
Sbjct  324  GIRKDPVYTDPVHGYKFRSKKEVFRYLQTGDTSKCARRHSKRNAASTMKDNSHTT  378


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             SVD LPPGW +E R R+   G + DPFY DPV G+ FRSK
Sbjct  1293  SVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSK  1332


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 5/64 (8%)
 Frame = +1

Query  433  AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFG  606
            +K+QK GS    A  V+       SVD LPPGW +E   R+   G + DP Y DPV G+ 
Sbjct  283  SKRQKPGSDSPSAMTVA---VDCNSVDELPPGWKKEVIIRQTDRGIRKDPVYTDPVHGYK  339

Query  607  FRSK  618
            FRSK
Sbjct  340  FRSK  343



>ref|XP_009782390.1| PREDICTED: uncharacterized protein LOC104231139 isoform X1 [Nicotiana 
sylvestris]
Length=1884

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  151   ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
             ELP GW KE + R+   GIRKDP+YTDPV GYVFRSKKD  RY++TGDIS+CAM+PT R+
Sbjct  1299  ELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAMRPTKRD  1358

Query  331   P  333
             P
Sbjct  1359  P  1359


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = +1

Query  22   EEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGH  201
            E+ S N K     S  SKR+K   D   A  V  VAV   S  ELP GW KE   R+   
Sbjct  267  EKASLNSKENGVQSPSSKRQKPGSDSPSAMTVCSVAVDCNSVDELPPGWKKEVIIRQTDR  326

Query  202  GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGPTSTDLSYDT  366
            GIRKDP YTDPV GY FRSKK+ FRY++TGD SKCA + + R    T  D S+ T
Sbjct  327  GIRKDPVYTDPVHGYKFRSKKEVFRYLQTGDTSKCARRHSKRNAASTMKDNSHTT  381


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 7/76 (9%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP----  318
            ELP GW KE K  +   GIRKDP YTDPV GYVFRSKKD  RY++TGDISKCA+KP    
Sbjct  581  ELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDISKCAIKPFKRD  640

Query  319  ---TLREPGPTSTDLS  357
               T++E  P + + S
Sbjct  641  LDATMKESSPAAHNTS  656


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +1

Query  433  AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFG  606
            +K+QK GS    A  V +      SVD LPPGW +E   R+   G + DP Y DPV G+ 
Sbjct  283  SKRQKPGSDSPSAMTVCSVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDPVYTDPVHGYK  342

Query  607  FRSK  618
            FRSK
Sbjct  343  FRSK  346


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             SVD LPPGW +E R R+   G + DPFY DPV G+ FRSK
Sbjct  1296  SVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSK  1335



>ref|XP_009589208.1| PREDICTED: uncharacterized protein LOC104086600 isoform X1 [Nicotiana 
tomentosiformis]
Length=2010

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  151   ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
             ELP GW KE + R+   GIRKDP+YTDPV GYVFRSKKD  RY++TGDIS+CAM+PT R+
Sbjct  1425  ELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSKKDVMRYLQTGDISRCAMRPTKRD  1484

Query  331   P  333
             P
Sbjct  1485  P  1485


 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 72/125 (58%), Gaps = 6/125 (5%)
 Frame = +1

Query  10   HHNIEEVSPNEKSVEDN------SQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWI  171
            H   E+ S NEK+  D+      S +SKR+K   D   +K V  VAV   S  ELP GW 
Sbjct  257  HGAGEDFSLNEKASLDSKENGVQSPLSKRQKPGSDSPSSKTVCSVAVDCNSVDELPPGWK  316

Query  172  KEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGPTSTD  351
            KE   R+   GIRKDP YTDPV GY FRSKK+ FRY+ TGD SKCA + + R    T  D
Sbjct  317  KEVIIRQTDRGIRKDPMYTDPVHGYKFRSKKEVFRYLHTGDTSKCARRHSKRNVASTMKD  376

Query  352  LSYDT  366
             S+ T
Sbjct  377  NSHTT  381


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            ELP GW KE K  +   GIRKDP YTDPV GYVFRSKKD  RY++TGDISKCA+KP  R+
Sbjct  581  ELPPGWKKEIKVTKKARGIRKDPLYTDPVHGYVFRSKKDVLRYLQTGDISKCAIKPVKRD  640


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +1

Query  430  VAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGF  603
            ++K+QK GS    +K V +      SVD LPPGW +E   R+   G + DP Y DPV G+
Sbjct  282  LSKRQKPGSDSPSSKTVCSVAVDCNSVDELPPGWKKEVIIRQTDRGIRKDPMYTDPVHGY  341

Query  604  GFRSK  618
             FRSK
Sbjct  342  KFRSK  346


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             SVD LPPGW +E R R+   G + DPFY DPV G+ FRSK
Sbjct  1422  SVDELPPGWKKEIRIRQNARGIRKDPFYTDPVHGYVFRSK  1461



>gb|KHN16846.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1122

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +1

Query  55   DNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDP  234
            DNS  SK++       P  +V    V+  +  +LP GW+KE K R+   GIRKDP+Y DP
Sbjct  219  DNSCSSKKKNCSNMDSPTDVV----VEKSTVEDLPPGWVKELKIRKNSKGIRKDPFYIDP  274

Query  235  VSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
             SGYVFRSKKD  RY+E+GDI  CA KP+ R+
Sbjct  275  ASGYVFRSKKDVLRYLESGDIRSCAFKPSRRQ  306


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 6/64 (9%)
 Frame = +1

Query  433  AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFG  606
            +KK+   +   P  VV     +  +V+ LPPGW +E + RK   G + DPFY+DP SG+ 
Sbjct  224  SKKKNCSNMDSPTDVVV----EKSTVEDLPPGWVKELKIRKNSKGIRKDPFYIDPASGYV  279

Query  607  FRSK  618
            FRSK
Sbjct  280  FRSK  283



>ref|XP_003532403.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Glycine max]
 ref|XP_006584707.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Glycine max]
Length=1122

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +1

Query  55   DNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDP  234
            DNS  SK++       P  +V    V+  +  +LP GW+KE K R+   GIRKDP+Y DP
Sbjct  219  DNSCSSKKKNCSNMDSPTDVV----VEKSTVEDLPPGWVKELKIRKNSKGIRKDPFYIDP  274

Query  235  VSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
             SGYVFRSKKD  RY+E+GDI  CA KP+ R+
Sbjct  275  ASGYVFRSKKDVLRYLESGDIRSCAFKPSRRQ  306


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 6/64 (9%)
 Frame = +1

Query  433  AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFG  606
            +KK+   +   P  VV     +  +V+ LPPGW +E + RK   G + DPFY+DP SG+ 
Sbjct  224  SKKKNCSNMDSPTDVVV----EKSTVEDLPPGWVKELKIRKNSKGIRKDPFYIDPASGYV  279

Query  607  FRSK  618
            FRSK
Sbjct  280  FRSK  283



>ref|XP_011072312.1| PREDICTED: uncharacterized protein LOC105157598 isoform X1 [Sesamum 
indicum]
Length=645

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            VAV++ +  +LP GWIKE  T + G+ IRKDPYYTDPVSGYVFRSK DA RY++T DI  
Sbjct  217  VAVESSAADDLPPGWIKEIITSKSGNRIRKDPYYTDPVSGYVFRSKMDALRYLKTNDIGS  276

Query  304  CAMKPTLRE  330
            CA +P  RE
Sbjct  277  CACRPKKRE  285


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 80/188 (43%), Gaps = 35/188 (19%)
 Frame = +1

Query  136  NGSESELPAGWIKEYKTRRLGHGIRKDPYY---TDPVSGYVFRSKKDAFRYIETGDISKC  306
            N S   LP+GW  E KTR+   G RK   Y   TD  SG  F S+    RY+ T D S  
Sbjct  83   NDSPGWLPSGWTMEEKTRQ--SGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDHSNT  140

Query  307  AM----KPTLREP---------GPTSTDLSYDTGkpspklkvsknkkpmkvkR-------  426
                     + EP           TSTD   +    S K   + ++    + R       
Sbjct  141  VTVQNKLDNVDEPVQNVSPQGISMTSTDHIPEKNNGSFKRLDNVDEPSPDMFREGISMTN  200

Query  427  --HVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTK--SDPFYVDPV  594
              HV +K+K  +      V S+A       D LPPGW +E    K G +   DP+Y DPV
Sbjct  201  TDHVPEKKKKSNSFETVAVESSA------ADDLPPGWIKEIITSKSGNRIRKDPYYTDPV  254

Query  595  SGFGFRSK  618
            SG+ FRSK
Sbjct  255  SGYVFRSK  262



>ref|XP_011072316.1| PREDICTED: uncharacterized protein LOC105157598 isoform X2 [Sesamum 
indicum]
Length=644

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            VAV++ +  +LP GWIKE  T + G+ IRKDPYYTDPVSGYVFRSK DA RY++T DI  
Sbjct  216  VAVESSAADDLPPGWIKEIITSKSGNRIRKDPYYTDPVSGYVFRSKMDALRYLKTNDIGS  275

Query  304  CAMKPTLRE  330
            CA +P  RE
Sbjct  276  CACRPKKRE  284


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 80/188 (43%), Gaps = 35/188 (19%)
 Frame = +1

Query  136  NGSESELPAGWIKEYKTRRLGHGIRKDPYY---TDPVSGYVFRSKKDAFRYIETGDISKC  306
            N S   LP+GW  E KTR+   G RK   Y   TD  SG  F S+    RY+ T D S  
Sbjct  82   NDSPGWLPSGWTMEEKTRQ--SGSRKGSVYKVYTDLSSGSRFYSRAAVTRYLNTVDHSNT  139

Query  307  AM----KPTLREP---------GPTSTDLSYDTGkpspklkvsknkkpmkvkR-------  426
                     + EP           TSTD   +    S K   + ++    + R       
Sbjct  140  VTVQNKLDNVDEPVQNVSPQGISMTSTDHIPEKNNGSFKRLDNVDEPSPDMFREGISMTN  199

Query  427  --HVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTK--SDPFYVDPV  594
              HV +K+K  +      V S+A       D LPPGW +E    K G +   DP+Y DPV
Sbjct  200  TDHVPEKKKKSNSFETVAVESSA------ADDLPPGWIKEIITSKSGNRIRKDPYYTDPV  253

Query  595  SGFGFRSK  618
            SG+ FRSK
Sbjct  254  SGYVFRSK  261



>ref|XP_006580605.1| PREDICTED: uncharacterized protein LOC100782433 [Glycine max]
Length=1209

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +1

Query  37   NEKSVEDNSQISKRRKSVVDKRPAKIVSP--VAVQNGSESELPAGWIKEYKTRRLGHGIR  210
            N  S  DNS   K+ K+      + + SP  V V+  +  +LP GW+KE K R+   GIR
Sbjct  194  NMDSPNDNSCTPKKEKNC-----SNMDSPTDVVVEKSTVEDLPPGWVKELKIRKNSKGIR  248

Query  211  KDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            KDP+Y DP SGYVFRSKKD  RY+E+GDI  CA +P+ R+
Sbjct  249  KDPFYIDPASGYVFRSKKDVLRYLESGDIRSCAFRPSRRQ  288


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
            +V+ LPPGW +E + RK   G + DPFY+DP SG+ FRSK
Sbjct  226  TVEDLPPGWVKELKIRKNSKGIRKDPFYIDPASGYVFRSK  265



>ref|XP_002276814.3| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X4 [Vitis vinifera]
Length=462

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +1

Query  43   KSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPY  222
            K+++ NS  S R+K V    P+  +  V ++  +   LPAGWIKE K R   +GIR+DPY
Sbjct  49   KTIKHNSCTS-RQKKVGPGMPS--LGKVVIERSTADGLPAGWIKEIKIRMNENGIRRDPY  105

Query  223  YTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            YTDPVSGYVFRS+KD FRY++TG+IS+ A KP
Sbjct  106  YTDPVSGYVFRSRKDVFRYLKTGEISRHAFKP  137


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 64/157 (41%), Gaps = 49/157 (31%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            +P GW  + K  + G  ++    Y DP +GY F SK D FRY++T   + C  +     P
Sbjct  9    IPEGWTVQVKLAKNGRNVK---CYLDPSTGYRFYSKPDVFRYLKTIKHNSCTSRQKKVGP  65

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
            G  S                                          KVV     +  + D
Sbjct  66   GMPSL----------------------------------------GKVVI----ERSTAD  81

Query  514  GLPPGWTREFRAR--KCGTKSDPFYVDPVSGFGFRSK  618
            GLP GW +E + R  + G + DP+Y DPVSG+ FRS+
Sbjct  82   GLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSR  118



>gb|KHN23667.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=1188

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +1

Query  37   NEKSVEDNSQISKRRKSVVDKRPAKIVSP--VAVQNGSESELPAGWIKEYKTRRLGHGIR  210
            N  S  DNS   K+ K+      + + SP  V V+  +  +LP GW+KE K R+   GIR
Sbjct  194  NMDSPNDNSCTPKKEKNC-----SNMDSPTDVVVEKSTVEDLPPGWVKELKIRKNSKGIR  248

Query  211  KDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            KDP+Y DP SGYVFRSKKD  RY+E+GDI  CA +P+ R+
Sbjct  249  KDPFYIDPASGYVFRSKKDVLRYLESGDIRSCAFRPSRRQ  288


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
            +V+ LPPGW +E + RK   G + DPFY+DP SG+ FRSK
Sbjct  226  TVEDLPPGWVKELKIRKNSKGIRKDPFYIDPASGYVFRSK  265



>ref|XP_010661063.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Vitis vinifera]
Length=482

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +1

Query  43   KSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPY  222
            K+++ NS  S R+K V    P+  +  V ++  +   LPAGWIKE K R   +GIR+DPY
Sbjct  69   KTIKHNSCTS-RQKKVGPGMPS--LGKVVIERSTADGLPAGWIKEIKIRMNENGIRRDPY  125

Query  223  YTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            YTDPVSGYVFRS+KD FRY++TG+IS+ A KP
Sbjct  126  YTDPVSGYVFRSRKDVFRYLKTGEISRHAFKP  157


 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 67/158 (42%), Gaps = 47/158 (30%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GWI E KT+R G  + K    Y DP +GY F SK D FRY++T   + C  +     
Sbjct  25   LPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKTIKHNSCTSRQKKVG  84

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
            PG  S                                          KVV     +  + 
Sbjct  85   PGMPSL----------------------------------------GKVVI----ERSTA  100

Query  511  DGLPPGWTREFRAR--KCGTKSDPFYVDPVSGFGFRSK  618
            DGLP GW +E + R  + G + DP+Y DPVSG+ FRS+
Sbjct  101  DGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSR  138



>ref|XP_010661055.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Vitis vinifera]
Length=496

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +1

Query  43   KSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPY  222
            K+++ NS  S R+K V    P+  +  V ++  +   LPAGWIKE K R   +GIR+DPY
Sbjct  83   KTIKHNSCTS-RQKKVGPGMPS--LGKVVIERSTADGLPAGWIKEIKIRMNENGIRRDPY  139

Query  223  YTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            YTDPVSGYVFRS+KD FRY++TG+IS+ A KP
Sbjct  140  YTDPVSGYVFRSRKDVFRYLKTGEISRHAFKP  171


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 67/158 (42%), Gaps = 47/158 (30%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GWI E KT+R G  + K    Y DP +GY F SK D FRY++T   + C  +     
Sbjct  39   LPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKTIKHNSCTSRQKKVG  98

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
            PG  S                                          KVV     +  + 
Sbjct  99   PGMPSL----------------------------------------GKVVI----ERSTA  114

Query  511  DGLPPGWTREFRAR--KCGTKSDPFYVDPVSGFGFRSK  618
            DGLP GW +E + R  + G + DP+Y DPVSG+ FRS+
Sbjct  115  DGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSR  152



>ref|XP_002509754.1| hypothetical protein RCOM_1685990 [Ricinus communis]
 gb|EEF51141.1| hypothetical protein RCOM_1685990 [Ricinus communis]
Length=978

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 63/96 (66%), Gaps = 6/96 (6%)
 Frame = +1

Query  61   SQISKRRKSVVDKRPAKIVS------PVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPY  222
            S  SK++++VV   P   VS       V ++  +  +LP GWIKE K +R  +GIRKDPY
Sbjct  64   SCTSKQKEAVVSMLPTNKVSLRYPDAKVKIEKSTVEDLPTGWIKEIKIQRKTNGIRKDPY  123

Query  223  YTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            Y DPVSGYVFRSK+D  RY+ETG+IS C + P  R+
Sbjct  124  YIDPVSGYVFRSKRDVQRYLETGEISTCKILPRRRD  159



>ref|XP_010661051.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Vitis vinifera]
Length=544

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +1

Query  43   KSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPY  222
            K+++ NS  S R+K V    P+  +  V ++  +   LPAGWIKE K R   +GIR+DPY
Sbjct  131  KTIKHNSCTS-RQKKVGPGMPS--LGKVVIERSTADGLPAGWIKEIKIRMNENGIRRDPY  187

Query  223  YTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            YTDPVSGYVFRS+KD FRY++TG+IS+ A KP
Sbjct  188  YTDPVSGYVFRSRKDVFRYLKTGEISRHAFKP  219


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 67/158 (42%), Gaps = 47/158 (30%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GWI E KT+R G  + K    Y DP +GY F SK D FRY++T   + C  +     
Sbjct  87   LPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKTIKHNSCTSRQKKVG  146

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
            PG  S                                          KVV     +  + 
Sbjct  147  PGMPSL----------------------------------------GKVVI----ERSTA  162

Query  511  DGLPPGWTREFRAR--KCGTKSDPFYVDPVSGFGFRSK  618
            DGLP GW +E + R  + G + DP+Y DPVSG+ FRS+
Sbjct  163  DGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSR  200



>ref|XP_010325420.1| PREDICTED: uncharacterized protein LOC101264354 isoform X2 [Solanum 
lycopersicum]
Length=1852

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  154   LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
             LP GW  E++ R+    I+KDPYYTDPV GYVFRSKKD  RY++TGDI  CA+KPT R+P
Sbjct  1195  LPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIRSCAVKPTKRDP  1254

Query  334   GPTSTDLSYDT  366
             G T  D S  T
Sbjct  1255  GSTMKDNSPST  1265


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query  94   DKRPAKIVSPVAVQNGSES--ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKD  267
            D  P    S  A  NG  S  +LP GW KE K  +  +GIRKDP Y DPV GYVFRSKKD
Sbjct  560  DPTPETGNSDQASLNGDPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKD  619

Query  268  AFRYIETGDISKCAMKPTLREPGPTSTDLS  357
             FRY++TGDIS CA++P  R+     TD S
Sbjct  620  VFRYLQTGDISSCAIRPVKRDLDAAMTDSS  649


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +1

Query  70   SKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYV  249
            SKR+K       AK VS VAV   S  ELP GW KE  +R+   G R    YTDPV GY 
Sbjct  284  SKRQKPGSGCPSAKSVSSVAVDCDSADELPPGWKKE--SRKNDRGTRNYLLYTDPVHGYK  341

Query  250  FRSKKDAFRYIETGDISKCAMKPTLREPGPTSTD  351
            F SKK+  RY++TGD + CA +PT R    T+ D
Sbjct  342  FHSKKEVLRYLQTGDATSCARRPTKRNVASTTKD  375


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
             SVDGLPPGW  EFR RK  +  K DP+Y DPV G+ FRSK
Sbjct  1191  SVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSK  1230


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +1

Query  433  AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSDPFYVDPVSGFGFR  612
            +K+QK GSG   AK VS+     +S D LPPGW +E R    GT++   Y DPV G+ F 
Sbjct  284  SKRQKPGSGCPSAKSVSSVAVDCDSADELPPGWKKESRKNDRGTRNYLLYTDPVHGYKFH  343

Query  613  SK  618
            SK
Sbjct  344  SK  345


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            S+D LPPGW +E +  K   G + DP Y+DPV G+ FRSK
Sbjct  578  SLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSK  617



>ref|XP_010325421.1| PREDICTED: uncharacterized protein LOC101264354 isoform X3 [Solanum 
lycopersicum]
Length=1846

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  154   LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
             LP GW  E++ R+    I+KDPYYTDPV GYVFRSKKD  RY++TGDI  CA+KPT R+P
Sbjct  1189  LPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIRSCAVKPTKRDP  1248

Query  334   GPTSTDLSYDT  366
             G T  D S  T
Sbjct  1249  GSTMKDNSPST  1259


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query  94   DKRPAKIVSPVAVQNGSES--ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKD  267
            D  P    S  A  NG  S  +LP GW KE K  +  +GIRKDP Y DPV GYVFRSKKD
Sbjct  520  DPTPETGNSDQASLNGDPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKD  579

Query  268  AFRYIETGDISKCAMKPTLREPGPTSTDLS  357
             FRY++TGDIS CA++P  R+     TD S
Sbjct  580  VFRYLQTGDISSCAIRPVKRDLDAAMTDSS  609


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +1

Query  70   SKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYV  249
            SKR+K       AK VS VAV   S  ELP GW KE  +R+   G R    YTDPV GY 
Sbjct  244  SKRQKPGSGCPSAKSVSSVAVDCDSADELPPGWKKE--SRKNDRGTRNYLLYTDPVHGYK  301

Query  250  FRSKKDAFRYIETGDISKCAMKPTLREPGPTSTD  351
            F SKK+  RY++TGD + CA +PT R    T+ D
Sbjct  302  FHSKKEVLRYLQTGDATSCARRPTKRNVASTTKD  335


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 78/195 (40%), Gaps = 34/195 (17%)
 Frame = +1

Query  136  NGSESELPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRY-----------  279
            N S   LP GWI E KTR+ G H       Y DP +G  F SK +  +Y           
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGLSYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNIAG  170

Query  280  ------IETGDISKCAMKPTLREPG---------------PTSTDLSYDTGkpspklkvs  396
                  IE G  SK        E G                T T  S+  G+     + +
Sbjct  171  EGQTPGIEEGSFSKLKASQDFEEVGEQSCTTKRKKSGITRTTKTYPSHGAGEVFILNEKT  230

Query  397  knkkpmkvkRH-VAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSD  573
                     +   +K+QK GSG   AK VS+     +S D LPPGW +E R    GT++ 
Sbjct  231  SLGSKENGAQSPQSKRQKPGSGCPSAKSVSSVAVDCDSADELPPGWKKESRKNDRGTRNY  290

Query  574  PFYVDPVSGFGFRSK  618
              Y DPV G+ F SK
Sbjct  291  LLYTDPVHGYKFHSK  305


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
             SVDGLPPGW  EFR RK  +  K DP+Y DPV G+ FRSK
Sbjct  1185  SVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSK  1224


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            S+D LPPGW +E +  K   G + DP Y+DPV G+ FRSK
Sbjct  538  SLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSK  577



>ref|XP_004245626.1| PREDICTED: uncharacterized protein LOC101264354 isoform X1 [Solanum 
lycopersicum]
Length=1886

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +1

Query  154   LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
             LP GW  E++ R+    I+KDPYYTDPV GYVFRSKKD  RY++TGDI  CA+KPT R+P
Sbjct  1229  LPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSKKDVMRYLQTGDIRSCAVKPTKRDP  1288

Query  334   GPTSTDLSYDT  366
             G T  D S  T
Sbjct  1289  GSTMKDNSPST  1299


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +1

Query  94   DKRPAKIVSPVAVQNGSES--ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKD  267
            D  P    S  A  NG  S  +LP GW KE K  +  +GIRKDP Y DPV GYVFRSKKD
Sbjct  560  DPTPETGNSDQASLNGDPSLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKD  619

Query  268  AFRYIETGDISKCAMKPTLREPGPTSTDLS  357
             FRY++TGDIS CA++P  R+     TD S
Sbjct  620  VFRYLQTGDISSCAIRPVKRDLDAAMTDSS  649


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +1

Query  70   SKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYV  249
            SKR+K       AK VS VAV   S  ELP GW KE  +R+   G R    YTDPV GY 
Sbjct  284  SKRQKPGSGCPSAKSVSSVAVDCDSADELPPGWKKE--SRKNDRGTRNYLLYTDPVHGYK  341

Query  250  FRSKKDAFRYIETGDISKCAMKPTLREPGPTSTD  351
            F SKK+  RY++TGD + CA +PT R    T+ D
Sbjct  342  FHSKKEVLRYLQTGDATSCARRPTKRNVASTTKD  375


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
             SVDGLPPGW  EFR RK  +  K DP+Y DPV G+ FRSK
Sbjct  1225  SVDGLPPGWKTEFRIRKNASVIKKDPYYTDPVHGYVFRSK  1264


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +1

Query  433  AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSDPFYVDPVSGFGFR  612
            +K+QK GSG   AK VS+     +S D LPPGW +E R    GT++   Y DPV G+ F 
Sbjct  284  SKRQKPGSGCPSAKSVSSVAVDCDSADELPPGWKKESRKNDRGTRNYLLYTDPVHGYKFH  343

Query  613  SK  618
            SK
Sbjct  344  SK  345


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            S+D LPPGW +E +  K   G + DP Y+DPV G+ FRSK
Sbjct  578  SLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSK  617



>ref|XP_006358896.1| PREDICTED: uncharacterized protein LOC102587100 isoform X3 [Solanum 
tuberosum]
Length=1801

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 7/74 (9%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP----  318
            +LP GW KE K  +  +GIRKDP Y DPV GYVFRSKKD FRY++TGDIS CA+KP    
Sbjct  532  DLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISNCAIKPVKRD  591

Query  319  ---TLREPGPTSTD  351
               T++E  PT+ D
Sbjct  592  LDATMKESSPTTVD  605


 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +1

Query  154   LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
             LP GW  E++ R+    I+KDPYY DPV GYVFRSKKD  RY++TGDI  CA+KPT R+P
Sbjct  1149  LPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIRSCAVKPTKRDP  1208

Query  334   GPTSTDLSYDT  366
             G T  D S  T
Sbjct  1209  GSTMKDSSPST  1219


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 60/107 (56%), Gaps = 3/107 (3%)
 Frame = +1

Query  49   VEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYT  228
            V + S  +KR+KS +  R  K    VAV   S  ELP GW KE  + +   G R+   YT
Sbjct  234  VGEQSCTTKRKKSGI-TRTTKTSPSVAVDCDSADELPHGWKKE--SSQNDRGTREYLLYT  290

Query  229  DPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGPTSTDLSYDTG  369
            DPV GY F SKK+  RY++TGD S+CA +P  R    T+ D S  TG
Sbjct  291  DPVHGYKFYSKKEVLRYLQTGDASRCARRPAKRNVASTTKDDSPTTG  337


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKCG--TKSDPFYVDPVSGFGFRSK  618
             SVDGLPPGW  EFR RK     K DP+Y+DPV G+ FRSK
Sbjct  1145  SVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSK  1184


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            S+D LPPGW +E +  K   G + DP Y+DPV G+ FRSK
Sbjct  529  SLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSK  568



>ref|XP_007158475.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30469.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=959

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 12/150 (8%)
 Frame = +1

Query  115  VSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGD  294
            + P  V+     +LP GW  E K R+ G G RKD +Y DPVSGYVFRSKKDA RY+++GD
Sbjct  126  IDPDTVEKSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGD  185

Query  295  ISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAK  474
            IS CA+KP  R+        + D  K S  ++ S  +          K +K  +GKR   
Sbjct  186  ISACAIKPFKRQ--------NQDEDKVSNAVEKSIIEDLPPGHLTKVKIRKGSNGKR---  234

Query  475  VVSNAEGQTESVDGLPPGWTREFRARKCGT  564
             +     +   V+ LPPGW  E + RK GT
Sbjct  235  -IDPDSDKKSQVEDLPPGWITEAKVRKGGT  263


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 78/169 (46%), Gaps = 43/169 (25%)
 Frame = +1

Query  154  LPAGWIKEYKTRR----LGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET-GDISKCAMKP  318
            LP GWI E KTR+    +G G +    Y DP +G  F SK +  RY+ET    S  + K 
Sbjct  35   LPDGWIVESKTRKSGANMGCGYK---CYIDP-TGCKFYSKPEVLRYLETVNSNSHSSKKE  90

Query  319  TLREPG-----PTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKR--PAKV  477
             +R+        T+ DL  D                        K +KS +G R  P  V
Sbjct  91   KMRKSNDAVEKSTAEDLPPDQIAD-------------------VKMKKSSNGYRIDPDTV  131

Query  478  VSNAEGQTESVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
                  +   V+ LPPGWT E + RK GT  + D FY+DPVSG+ FRSK
Sbjct  132  ------EKSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSK  174



>ref|XP_006358895.1| PREDICTED: uncharacterized protein LOC102587100 isoform X2 [Solanum 
tuberosum]
Length=1805

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 7/74 (9%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP----  318
            +LP GW KE K  +  +GIRKDP Y DPV GYVFRSKKD FRY++TGDIS CA+KP    
Sbjct  536  DLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISNCAIKPVKRD  595

Query  319  ---TLREPGPTSTD  351
               T++E  PT+ D
Sbjct  596  LDATMKESSPTTVD  609


 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +1

Query  154   LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
             LP GW  E++ R+    I+KDPYY DPV GYVFRSKKD  RY++TGDI  CA+KPT R+P
Sbjct  1153  LPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIRSCAVKPTKRDP  1212

Query  334   GPTSTDLSYDT  366
             G T  D S  T
Sbjct  1213  GSTMKDSSPST  1223


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 57/100 (57%), Gaps = 2/100 (2%)
 Frame = +1

Query  70   SKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYV  249
            SKR+K       AK VS VAV   S  ELP GW KE  + +   G R+   YTDPV GY 
Sbjct  244  SKRQKPGSGCLSAKSVSSVAVDCDSADELPHGWKKE--SSQNDRGTREYLLYTDPVHGYK  301

Query  250  FRSKKDAFRYIETGDISKCAMKPTLREPGPTSTDLSYDTG  369
            F SKK+  RY++TGD S+CA +P  R    T+ D S  TG
Sbjct  302  FYSKKEVLRYLQTGDASRCARRPAKRNVASTTKDDSPTTG  341


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 75/195 (38%), Gaps = 34/195 (17%)
 Frame = +1

Query  136  NGSESELPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRY-----------  279
            N S   LP GWI E KTR+ G H       Y DP +G  F SK +  +Y           
Sbjct  111  NNSHEWLPPGWIVELKTRKSGSHAGTPYKVYIDPSTGSKFYSKPEVSKYLKTMKQNNITG  170

Query  280  ------IETGDISKCAMKPTLREPG---------------PTSTDLSYDTGkpspklkvs  396
                  IE G  SK        E G                T T  S+  G+     + +
Sbjct  171  EGQIPGIEEGSFSKLKASQDFEEVGEQSCTTKRKKSGITRTTKTSPSHGAGEDFILNEKT  230

Query  397  knkkpmkvkRH-VAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSD  573
                     +   +K+QK GSG   AK VS+     +S D LP GW +E      GT+  
Sbjct  231  SLGSKENGAQSPQSKRQKPGSGCLSAKSVSSVAVDCDSADELPHGWKKESSQNDRGTREY  290

Query  574  PFYVDPVSGFGFRSK  618
              Y DPV G+ F SK
Sbjct  291  LLYTDPVHGYKFYSK  305


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKCG--TKSDPFYVDPVSGFGFRSK  618
             SVDGLPPGW  EFR RK     K DP+Y+DPV G+ FRSK
Sbjct  1149  SVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSK  1188


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            S+D LPPGW +E +  K   G + DP Y+DPV G+ FRSK
Sbjct  533  SLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSK  572



>ref|XP_006358894.1| PREDICTED: uncharacterized protein LOC102587100 isoform X1 [Solanum 
tuberosum]
Length=1845

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 52/74 (70%), Gaps = 7/74 (9%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP----  318
            +LP GW KE K  +  +GIRKDP Y DPV GYVFRSKKD FRY++TGDIS CA+KP    
Sbjct  576  DLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSKKDVFRYLQTGDISNCAIKPVKRD  635

Query  319  ---TLREPGPTSTD  351
               T++E  PT+ D
Sbjct  636  LDATMKESSPTTVD  649


 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +1

Query  154   LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
             LP GW  E++ R+    I+KDPYY DPV GYVFRSKKD  RY++TGDI  CA+KPT R+P
Sbjct  1193  LPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSKKDVMRYLQTGDIRSCAVKPTKRDP  1252

Query  334   GPTSTDLSYDT  366
             G T  D S  T
Sbjct  1253  GSTMKDSSPST  1263


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 57/100 (57%), Gaps = 2/100 (2%)
 Frame = +1

Query  70   SKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYV  249
            SKR+K       AK VS VAV   S  ELP GW KE  + +   G R+   YTDPV GY 
Sbjct  284  SKRQKPGSGCLSAKSVSSVAVDCDSADELPHGWKKE--SSQNDRGTREYLLYTDPVHGYK  341

Query  250  FRSKKDAFRYIETGDISKCAMKPTLREPGPTSTDLSYDTG  369
            F SKK+  RY++TGD S+CA +P  R    T+ D S  TG
Sbjct  342  FYSKKEVLRYLQTGDASRCARRPAKRNVASTTKDDSPTTG  381


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +1

Query  505   SVDGLPPGWTREFRARKCG--TKSDPFYVDPVSGFGFRSK  618
             SVDGLPPGW  EFR RK     K DP+Y+DPV G+ FRSK
Sbjct  1189  SVDGLPPGWKTEFRMRKNARVIKKDPYYMDPVLGYVFRSK  1228


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            S+D LPPGW +E +  K   G + DP Y+DPV G+ FRSK
Sbjct  573  SLDDLPPGWKKEIKITKKANGIRKDPLYIDPVDGYVFRSK  612



>emb|CBI34715.3| unnamed protein product [Vitis vinifera]
Length=1076

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +1

Query  43   KSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPY  222
            K+++ NS  S R+K V    P+  +  V ++  +   LPAGWIKE K R   +GIR+DPY
Sbjct  83   KTIKHNSCTS-RQKKVGPGMPS--LGKVVIERSTADGLPAGWIKEIKIRMNENGIRRDPY  139

Query  223  YTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            YTDPVSGYVFRS+KD FRY++TG+IS+ A KP
Sbjct  140  YTDPVSGYVFRSRKDVFRYLKTGEISRHAFKP  171


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 70/159 (44%), Gaps = 49/159 (31%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GWI E KT+R G  + K    Y DP +GY F SK D FRY++T   + C        
Sbjct  39   LPNGWILELKTQRSGSCVGKQYKCYLDPSTGYRFYSKPDVFRYLKTIKHNSCT-------  91

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGK-RPAKVVSNAEGQTES  507
                                              ++++K G G     KVV     +  +
Sbjct  92   ----------------------------------SRQKKVGPGMPSLGKVVI----ERST  113

Query  508  VDGLPPGWTREFRAR--KCGTKSDPFYVDPVSGFGFRSK  618
             DGLP GW +E + R  + G + DP+Y DPVSG+ FRS+
Sbjct  114  ADGLPAGWIKEIKIRMNENGIRRDPYYTDPVSGYVFRSR  152



>ref|XP_007160033.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
 gb|ESW32027.1| hypothetical protein PHAVU_002G287000g [Phaseolus vulgaris]
Length=1225

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 65/104 (63%), Gaps = 5/104 (5%)
 Frame = +1

Query  22   EEVSPNEKSVEDNSQISKRRKSVVDK-RPAKIVSPVAVQNGSESELPAGWIKEYKTRRLG  198
            E++  N  S +D+S   K+ K+  +   P  IV    ++     +LP GW+KE K  +  
Sbjct  188  EKIGTNMDSAKDSSCAPKKEKNCSNMDSPIDIV----IEKSIAEDLPPGWVKELKITKNS  243

Query  199  HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
             GIRKDP+Y DPVSGYVFRSKKD  RY+E+GD+  CA KP+ R+
Sbjct  244  KGIRKDPFYIDPVSGYVFRSKKDVLRYLESGDVRSCAFKPSRRQ  287


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +1

Query  508  VDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             + LPPGW +E +  K   G + DPFY+DPVSG+ FRSK
Sbjct  226  AEDLPPGWVKELKITKNSKGIRKDPFYIDPVSGYVFRSK  264



>ref|XP_004503754.1| PREDICTED: uncharacterized protein LOC101511357 [Cicer arietinum]
Length=1262

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPT  321
            +LP GWIKE K R+ G+GI+KD +YTDPVSGYVFRSK D  RY+E+GDI KCA+KP+
Sbjct  195  DLPLGWIKEVKIRKNGNGIKKDWFYTDPVSGYVFRSKMDVLRYLESGDIGKCAIKPS  251


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +1

Query  481  SNAEGQTESVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
            SNA G+  +V+ LP GW +E + RK G   K D FY DPVSG+ FRSK
Sbjct  184  SNAVGEKSTVEDLPLGWIKEVKIRKNGNGIKKDWFYTDPVSGYVFRSK  231



>gb|KDO55595.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=267

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +1

Query  82   KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            + V  KR  +    V V+  +  +LP  W KE K ++   GIRKD Y+TDPVSGYVF SK
Sbjct  173  RKVSTKRERETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  232

Query  262  KDAFRYIETGDISKCAMKPTLREPGPTSTDLSYD  363
            KD FRY+ETG+ISK A KP  R+ G  +++L  D
Sbjct  233  KDVFRYLETGEISKYAFKP--RKRGADASELVTD  264


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 73/171 (43%), Gaps = 36/171 (21%)
 Frame = +1

Query  121  PVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIET--G  291
            PV  +N     LP GW+ + KTR+ G  + R+   Y +P++G  F S  +  R++E+   
Sbjct  93   PVVDENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKN  152

Query  292  DISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPA  471
              S+C  K T     PT T     T                          +  S KR  
Sbjct  153  RNSECERKTT-----PTETSKYEGT--------------------------RKVSTKRER  181

Query  472  KVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
            +       +  +V  LPP WT+E + +K   G + D ++ DPVSG+ F SK
Sbjct  182  ETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  232



>gb|KDO55594.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=273

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +1

Query  82   KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            + V  KR  +    V V+  +  +LP  W KE K ++   GIRKD Y+TDPVSGYVF SK
Sbjct  179  RKVSTKRERETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  238

Query  262  KDAFRYIETGDISKCAMKPTLREPGPTSTDLSYD  363
            KD FRY+ETG+ISK A KP  R+ G  +++L  D
Sbjct  239  KDVFRYLETGEISKYAFKP--RKRGADASELVTD  270


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 87/203 (43%), Gaps = 39/203 (19%)
 Frame = +1

Query  25   EVSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHG  204
            E S ++   ++N Q + R K   + R  K   PV  +N     LP GW+ + KTR+ G  
Sbjct  70   ENSSSKLVAKENKQENSRSKRHSENRSMK---PVVDENNRPDWLPDGWVVDLKTRKSGSA  126

Query  205  I-RKDPYYTDPVSGYVFRSKKDAFRYIET--GDISKCAMKPTLREPGPTSTDLSYDTGkp  375
            + R+   Y +P++G  F S  +  R++E+     S+C  K T     PT T     T   
Sbjct  127  VGRQYKVYIEPITGCKFFSMPEVLRHLESVKNRNSECERKTT-----PTETSKYEGT---  178

Query  376  spklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARK  555
                                   +  S KR  +       +  +V  LPP WT+E + +K
Sbjct  179  -----------------------RKVSTKRERETTERVVVEKSTVVDLPPSWTKETKIKK  215

Query  556  C--GTKSDPFYVDPVSGFGFRSK  618
               G + D ++ DPVSG+ F SK
Sbjct  216  TARGIRKDRYFTDPVSGYVFCSK  238


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 72/162 (44%), Gaps = 25/162 (15%)
 Frame = +1

Query  142  SESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPT  321
            SE  LP  W  ++K  + G   RK  YY +  +G  F SK+D  RY++        MK T
Sbjct  5    SEERLPTDWTAKFKVEKNG---RKTKYYMNVRTGQKFFSKEDLLRYVK--------MKRT  53

Query  322  -LREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQ  498
             L EP PTS+            L+ S +K   K  +    + K  S  R  K V +   +
Sbjct  54   QLDEPSPTSSH-------GKRHLENSSSKLVAKENKQENSRSKRHSENRSMKPVVDENNR  106

Query  499  TESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRS  615
                D LP GW  + + RK G+   +    Y++P++G  F S
Sbjct  107  P---DWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFS  145



>gb|KDO55591.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55592.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
 gb|KDO55593.1| hypothetical protein CISIN_1g0013392mg, partial [Citrus sinensis]
Length=296

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +1

Query  82   KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            + V  KR  +    V V+  +  +LP  W KE K ++   GIRKD Y+TDPVSGYVF SK
Sbjct  202  RKVSTKRERETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  261

Query  262  KDAFRYIETGDISKCAMKPTLREPGPTSTDLSYD  363
            KD FRY+ETG+ISK A KP  R+ G  +++L  D
Sbjct  262  KDVFRYLETGEISKYAFKP--RKRGADASELVTD  293


 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 73/171 (43%), Gaps = 36/171 (21%)
 Frame = +1

Query  121  PVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIET--G  291
            PV  +N     LP GW+ + KTR+ G  + R+   Y +P++G  F S  +  R++E+   
Sbjct  122  PVVDENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKN  181

Query  292  DISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPA  471
              S+C  K T     PT T     T                          +  S KR  
Sbjct  182  RNSECERKTT-----PTETSKYEGT--------------------------RKVSTKRER  210

Query  472  KVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
            +       +  +V  LPP WT+E + +K   G + D ++ DPVSG+ F SK
Sbjct  211  ETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  261



>ref|XP_007040167.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
 gb|EOY24668.1| Uncharacterized protein TCM_016211 [Theobroma cacao]
Length=1028

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = +1

Query  73   KRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVF  252
            K  KS   KR     S V  +  +  +LPAGWIKE K +R  +G+R+DPYYTDP SGYVF
Sbjct  214  KSTKSKPKKRALCSTSKVVTRKSTVDDLPAGWIKEVKIKRHANGVRRDPYYTDPASGYVF  273

Query  253  RSKKDAFRYIETGDISKCAMKP  318
            RSKKD  RY+ETG+I + A  P
Sbjct  274  RSKKDILRYLETGEIGRYAFLP  295


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 62/158 (39%), Gaps = 49/158 (31%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP  W  E KT + G    K    Y DP +G  F S+ + FR+++ G+      KP  R 
Sbjct  165  LPKNWFTELKTYKSGAKFGKSYKIYVDPSTGLRFHSRPEVFRFLDKGEQKSTKSKPKKRA  224

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
               TS                                          KVV+    +  +V
Sbjct  225  LCSTS------------------------------------------KVVT----RKSTV  238

Query  511  DGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            D LP GW +E + ++   G + DP+Y DP SG+ FRSK
Sbjct  239  DDLPAGWIKEVKIKRHANGVRRDPYYTDPASGYVFRSK  276



>ref|XP_007038659.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23160.1| Methyl-CPG-binding domain protein 13, putative isoform 2 [Theobroma 
cacao]
Length=621

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+  +   LP GWIKE +  +  H +RKDP+YTDPVSGYVFRS KDA RY+ETG++ K
Sbjct  71   VTVEKAAAEGLPPGWIKEIRITKRAHRVRKDPFYTDPVSGYVFRSMKDALRYVETGELGK  130

Query  304  CAMKPTLREPGPTSTDLSYDT  366
             A KP  ++ G    DL  D 
Sbjct  131  LAFKP--KDKGSNDEDLEEDN  149


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 65/156 (42%), Gaps = 52/156 (33%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW  E + RR G   +KD  Y  P     F S+ +  RY++     KC  K      
Sbjct  10   LPPGWKVEVRQRRNG---KKDKCYYAPCGELRFISRAEVSRYLD-----KCGCK------  55

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
                                              +++++GSGK+ +K   N   +  + +
Sbjct  56   ---------------------------------TEEKENGSGKQSSK---NVTVEKAAAE  79

Query  514  GLPPGWTREFRARKCG--TKSDPFYVDPVSGFGFRS  615
            GLPPGW +E R  K     + DPFY DPVSG+ FRS
Sbjct  80   GLPPGWIKEIRITKRAHRVRKDPFYTDPVSGYVFRS  115



>ref|XP_007038658.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23159.1| Methyl-CPG-binding domain protein 13, putative isoform 1 [Theobroma 
cacao]
Length=625

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+  +   LP GWIKE +  +  H +RKDP+YTDPVSGYVFRS KDA RY+ETG++ K
Sbjct  75   VTVEKAAAEGLPPGWIKEIRITKRAHRVRKDPFYTDPVSGYVFRSMKDALRYVETGELGK  134

Query  304  CAMKPTLREPGPTSTDLSYDT  366
             A KP  ++ G    DL  D 
Sbjct  135  LAFKP--KDKGSNDEDLEEDN  153


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 65/158 (41%), Gaps = 52/158 (33%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG--HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP GW  E + RR G    +R   YY  P     F S+ +  RY++     KC  K    
Sbjct  10   LPPGWKVEVRQRRNGKKDKLRVMCYYA-PCGELRFISRAEVSRYLD-----KCGCK----  59

Query  328  EPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTES  507
                                                +++++GSGK+ +K   N   +  +
Sbjct  60   -----------------------------------TEEKENGSGKQSSK---NVTVEKAA  81

Query  508  VDGLPPGWTREFRARKCG--TKSDPFYVDPVSGFGFRS  615
             +GLPPGW +E R  K     + DPFY DPVSG+ FRS
Sbjct  82   AEGLPPGWIKEIRITKRAHRVRKDPFYTDPVSGYVFRS  119



>gb|KJB39638.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=880

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  73   KRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVF  252
            + RK+   K+ A     V ++  +  +LPAGWIKE K +R  +G+RKDPYYTDPVSGYVF
Sbjct  107  RNRKTNKKKQAAYSRKKVVIEKSTVDDLPAGWIKEIKIQRNANGVRKDPYYTDPVSGYVF  166

Query  253  RSKKDAFRYIETGDISKCAMKP  318
            RSKK    Y+ETG+I++ A  P
Sbjct  167  RSKKAVLHYLETGEIARSAFLP  188


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 75/167 (45%), Gaps = 19/167 (11%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETG--------DISKCA  309
            LPAGW +E++ ++ G   R+  +Y +  +G  F +K D  RY +T         D     
Sbjct  10   LPAGWTQEFRFQKTG---RRITHYVNLATGQKFFTKDDLIRYTKTETKTESKQYDDRLLT  66

Query  310  MKPTLREPGPTSTDLSYD--TGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVS  483
            +K   +    +  ++  D  TG                 +R+    +K  +     KVV 
Sbjct  67   LKQITKPSTNSQVNIYVDPSTGLRFYSKPAVFRFLKQAEQRNRKTNKKKQAAYSRKKVVI  126

Query  484  NAEGQTESVDGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
                +  +VD LP GW +E + ++   G + DP+Y DPVSG+ FRSK
Sbjct  127  ----EKSTVDDLPAGWIKEIKIQRNANGVRKDPYYTDPVSGYVFRSK  169



>gb|KJB39637.1| hypothetical protein B456_007G022700 [Gossypium raimondii]
Length=914

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +1

Query  73   KRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVF  252
            + RK+   K+ A     V ++  +  +LPAGWIKE K +R  +G+RKDPYYTDPVSGYVF
Sbjct  141  RNRKTNKKKQAAYSRKKVVIEKSTVDDLPAGWIKEIKIQRNANGVRKDPYYTDPVSGYVF  200

Query  253  RSKKDAFRYIETGDISKCAMKP  318
            RSKK    Y+ETG+I++ A  P
Sbjct  201  RSKKAVLHYLETGEIARSAFLP  222


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 66/158 (42%), Gaps = 49/158 (31%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP  W  E KT + G  I ++   Y DP +G  F SK   FR+++  +            
Sbjct  92   LPKNWFVEVKTHKSGEFIGKRVKIYVDPSTGLRFYSKPAVFRFLKQAE------------  139

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
                                        +  R   KK+++   ++  KVV     +  +V
Sbjct  140  ----------------------------QRNRKTNKKKQAAYSRK--KVVI----EKSTV  165

Query  511  DGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
            D LP GW +E + ++   G + DP+Y DPVSG+ FRSK
Sbjct  166  DDLPAGWIKEIKIQRNANGVRKDPYYTDPVSGYVFRSK  203



>gb|EPS58890.1| hypothetical protein M569_15921, partial [Genlisea aurea]
Length=77

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            +AV+     ELP GWIKE KT++ G+  RKD ++TDP SGY F SK DA RY++T DISK
Sbjct  2    IAVETFPADELPPGWIKEIKTKKRGNMTRKDLFFTDPKSGYTFYSKLDALRYLKTDDISK  61

Query  304  CAMKP  318
            CA++P
Sbjct  62   CAIRP  66



>ref|XP_002510809.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51411.1| conserved hypothetical protein [Ricinus communis]
Length=644

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 61/110 (55%), Gaps = 18/110 (16%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW KE K  + GH IR+DPYYTDPVSGYVFRS KDA RY+ETG++ + A KP  ++ 
Sbjct  122  LPLGWTKEIKVTKRGHKIRRDPYYTDPVSGYVFRSMKDALRYLETGEVGRLAFKP--KDT  179

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVS  483
            G  + +L  D                       AKKQK  + + P  ++S
Sbjct  180  GNDNVELEDD----------------KTCTSATAKKQKLAANETPTSLIS  213



>ref|XP_007158476.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
 gb|ESW30470.1| hypothetical protein PHAVU_002G155600g [Phaseolus vulgaris]
Length=927

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 73/150 (49%), Gaps = 44/150 (29%)
 Frame = +1

Query  115  VSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGD  294
            + P  V+     +LP GW  E K R+ G G RKD +Y DPVSGYVFRSKKDA RY+++GD
Sbjct  126  IDPDTVEKSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSKKDALRYVKSGD  185

Query  295  ISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAK  474
            IS CA+KP                                       K+Q     K    
Sbjct  186  ISACAIKP--------------------------------------FKRQNQDEDK----  203

Query  475  VVSNAEGQTESVDGLPPGWTREFRARKCGT  564
             VS+++ +++ V+ LPPGW  E + RK GT
Sbjct  204  -VSDSDKKSQ-VEDLPPGWITEAKVRKGGT  231


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 78/169 (46%), Gaps = 43/169 (25%)
 Frame = +1

Query  154  LPAGWIKEYKTRR----LGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET-GDISKCAMKP  318
            LP GWI E KTR+    +G G +    Y DP +G  F SK +  RY+ET    S  + K 
Sbjct  35   LPDGWIVESKTRKSGANMGCGYK---CYIDP-TGCKFYSKPEVLRYLETVNSNSHSSKKE  90

Query  319  TLREPG-----PTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKR--PAKV  477
             +R+        T+ DL  D                        K +KS +G R  P  V
Sbjct  91   KMRKSNDAVEKSTAEDLPPDQIAD-------------------VKMKKSSNGYRIDPDTV  131

Query  478  VSNAEGQTESVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSK  618
                  +   V+ LPPGWT E + RK GT  + D FY+DPVSG+ FRSK
Sbjct  132  ------EKSPVEDLPPGWTIEAKVRKGGTGNRKDLFYIDPVSGYVFRSK  174



>ref|XP_006590528.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Glycine max]
Length=163

 Score = 84.7 bits (208),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +1

Query  115  VSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGD  294
            V P  V+     +LP GWI E K R+   G RKD +Y DPVSGYVFRSKKDA RY+++GD
Sbjct  77   VDPDVVEKSPVEDLPPGWITEAKVRKGDTGNRKDMFYIDPVSGYVFRSKKDALRYVKSGD  136

Query  295  ISKCAMKP  318
            IS C +KP
Sbjct  137  ISTCVLKP  144


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = +1

Query  508  VDGLPPGWTREFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            V+ LPPGW  E + RK   G + D FY+DPVSG+ FRSK
Sbjct  87   VEDLPPGWITEAKVRKGDTGNRKDMFYIDPVSGYVFRSK  125



>emb|CDP09782.1| unnamed protein product [Coffea canephora]
Length=819

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 63/96 (66%), Gaps = 5/96 (5%)
 Frame = +1

Query  43   KSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPY  222
            +S +  S IS++ ++ +DK   +I      ++    ELP GWIKE + R+   G RKDPY
Sbjct  250  ESTKSKSHISEKEENRMDKPFLEIA---VDESKVLDELPPGWIKEIRARK--QGTRKDPY  304

Query  223  YTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            Y DPVSGY FRSKKDA RY+E GDIS+CA+ P  R+
Sbjct  305  YIDPVSGYEFRSKKDALRYLEFGDISRCAITPKKRD  340


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = +1

Query  427  HVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSDPFYVDPVSGFG  606
            H+++K+++   K   ++   A  +++ +D LPPGW +E RARK GT+ DP+Y+DPVSG+ 
Sbjct  257  HISEKEENRMDKPFLEI---AVDESKVLDELPPGWIKEIRARKQGTRKDPYYIDPVSGYE  313

Query  607  FRSK  618
            FRSK
Sbjct  314  FRSK  317



>gb|EYU38370.1| hypothetical protein MIMGU_mgv1a007205mg [Erythranthe guttata]
Length=415

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +1

Query  97   KRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFR  276
            KR       VA +  +  +LP GWIKE  T + G+ IRKDPYYTDPVSGYVFRSK D  R
Sbjct  11   KRKGSAYKTVACETVAADDLPPGWIKEIVTSKFGNKIRKDPYYTDPVSGYVFRSKLDVER  70

Query  277  YIETGDISKCAMKP  318
            Y+ T +I+ CA +P
Sbjct  71   YLTTNNINSCACRP  84


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 28/43 (65%), Gaps = 2/43 (5%)
 Frame = +1

Query  496  QTESVDGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRSK  618
            +T + D LPPGW +E    K G K   DP+Y DPVSG+ FRSK
Sbjct  23   ETVAADDLPPGWIKEIVTSKFGNKIRKDPYYTDPVSGYVFRSK  65



>ref|XP_008437229.1| PREDICTED: transcriptional regulator ATRX homolog isoform X3 
[Cucumis melo]
Length=628

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  118  SPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            S V +++  + +LP GWIKE K +    GIRKDP+Y DP SGY+FRSKK+ FRY+ETG+I
Sbjct  152  SRVVIEHYKDEDLPPGWIKEIKIKEKADGIRKDPFYIDPKSGYIFRSKKEVFRYLETGEI  211

Query  298  SKCAMKP  318
            S+ A KP
Sbjct  212  SRHAFKP  218



>ref|XP_004143925.1| PREDICTED: uncharacterized protein LOC101223188 [Cucumis sativus]
 ref|XP_004159962.1| PREDICTED: uncharacterized protein LOC101226976 [Cucumis sativus]
 gb|KGN50128.1| hypothetical protein Csa_5G154900 [Cucumis sativus]
Length=853

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +1

Query  118  SPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            S V +++  + +LP GWIKE K +    GIRKDP+Y DP SGYVFRSKK+ FRY+ETG+I
Sbjct  152  SRVVIEHYKDEDLPPGWIKEIKIKEKADGIRKDPFYIDPKSGYVFRSKKEVFRYLETGEI  211

Query  298  SKCAMKP  318
            S+ A KP
Sbjct  212  SRHAFKP  218


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 64/158 (41%), Gaps = 47/158 (30%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW  E +TR  G  +      Y DPV+   F SK + FR++ T     C +K     
Sbjct  86   LPAGWKVESRTRMSGSNVGAVYKCYIDPVTDSRFYSKPEVFRHLRTVKNKLCTLK-----  140

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
                                               ++  +G   R   V+ + + +    
Sbjct  141  ----------------------------------ERRTSNGKKSRSRVVIEHYKDE----  162

Query  511  DGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
              LPPGW +E + ++   G + DPFY+DP SG+ FRSK
Sbjct  163  -DLPPGWIKEIKIKEKADGIRKDPFYIDPKSGYVFRSK  199



>ref|XP_006477436.1| PREDICTED: uncharacterized protein LOC102622266 [Citrus sinensis]
Length=1096

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +1

Query  82   KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            + V  KR  +    V V+  +  +LP  W KE K ++   GIRKD Y+TDPVSGYVF SK
Sbjct  202  RKVSTKRERETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  261

Query  262  KDAFRYIETGDISKCAMKPTLREPGPTSTDLSYD  363
            KD FRY+ETG+ISK A KP  R+ G  +++L  D
Sbjct  262  KDVFRYLETGEISKYAFKP--RKRGADASELVTD  293


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 79/171 (46%), Gaps = 36/171 (21%)
 Frame = +1

Query  121  PVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIET--G  291
            PV  +N     LP GW+ + KTR+ G  + R+   Y +P++G  F S  +  R++E+   
Sbjct  122  PVVDENNRPDWLPDGWVVDLKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKN  181

Query  292  DISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPA  471
              S+C  K T     PT T     T                   R V+ K++  + +R  
Sbjct  182  RNSECERKTT-----PTETSKYEGT-------------------RKVSTKRERETTER--  215

Query  472  KVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             VV     +  +V  LPP WT+E + +K   G + D ++ DPVSG+ F SK
Sbjct  216  -VVV----EKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  261



>ref|XP_008351681.1| PREDICTED: uncharacterized protein LOC103415104 [Malus domestica]
Length=746

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  106  AKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIE  285
             ++   V V+     +LP GWIKE K  +  +  R+DPYYTDP SGYVFRSKKD FRY+E
Sbjct  161  VQLAKNVYVEKHHVEDLPPGWIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVFRYLE  220

Query  286  TGDISKCAMKP  318
            TG+ISK A KP
Sbjct  221  TGEISKYAFKP  231



>gb|KEH21030.1| methyl-CpG-binding domain protein [Medicago truncatula]
Length=1325

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +1

Query  118  SPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            S VA +N    +LP GWIKE K R+   GI+KD +Y DPVSGYVF SKKD  R++++GDI
Sbjct  173  SNVAGENSIVEDLPPGWIKEVKIRKHRSGIKKDWFYIDPVSGYVFHSKKDVQRFLKSGDI  232

Query  298  SKCAMKPTLRE  330
            +KCA+KP+ R+
Sbjct  233  AKCAIKPSRRQ  243


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 91/210 (43%), Gaps = 28/210 (13%)
 Frame = +1

Query  70   SKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGY  246
            + +R   V KR +K  +P       E  LP GW  E +TR+ G  +      Y DP + Y
Sbjct  12   TNKRIDNVTKRNSKQQTPEKADEHPEW-LPNGWDIEVRTRQSGPAMGSAYKCYIDPSNTY  70

Query  247  VFRSKKDAFRYIETGDISKCAMK---------PTLREPGPTS-------------TDLSY  360
             F SK +  R++ET    KC+           P+  E   T              T  + 
Sbjct  71   KFYSKPEVLRHLETIRDRKCSSNKKKGTSKHSPSKEEGEHTKSKQHSPSKEEEKKTKSNQ  130

Query  361  DTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVS--NAEGQTESVDGLPPGWT  534
             +     +  ++ +      ++H++    S  G++   + S  N  G+   V+ LPPGW 
Sbjct  131  HSPSKEEEKCINMHSPNKGEEKHISMHSPSKDGEKCTNMHSPSNVAGENSIVEDLPPGWI  190

Query  535  REFRARK--CGTKSDPFYVDPVSGFGFRSK  618
            +E + RK   G K D FY+DPVSG+ F SK
Sbjct  191  KEVKIRKHRSGIKKDWFYIDPVSGYVFHSK  220



>ref|XP_006440582.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53822.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1094

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query  82   KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            + V  KR  +    V V+  +  +LP  W KE K ++   GIRKD Y+TDPVSGYVF SK
Sbjct  202  RKVSTKRERETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  261

Query  262  KDAFRYIETGDISKCAMKPTLREPGPTSTDL  354
            KD FRY+ETG+ISK A KP  R+ G  +++L
Sbjct  262  KDVFRYLETGEISKYAFKP--RKRGADASEL  290


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 79/171 (46%), Gaps = 36/171 (21%)
 Frame = +1

Query  121  PVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIET--G  291
            PV  +N     LP GW+ E KTR+ G  + R+   Y +P++G  F S  +  R++E+   
Sbjct  122  PVVDENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKN  181

Query  292  DISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPA  471
              S+C  K T     PT T     T                   R V+ K++  + +R  
Sbjct  182  RNSECERKTT-----PTETSKYEGT-------------------RKVSTKRERETTER--  215

Query  472  KVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             VV     +  +V  LPP WT+E + +K   G + D ++ DPVSG+ F SK
Sbjct  216  -VVV----EKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  261



>ref|XP_008392616.1| PREDICTED: uncharacterized protein LOC103454798 [Malus domestica]
Length=1228

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  106  AKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIE  285
             ++   V V+     +LP GWIKE K  +  +  R+DPYYTDP SGYVFRSKKD FRY+E
Sbjct  161  VQLAKNVYVEKHHVEDLPPGWIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVFRYLE  220

Query  286  TGDISKCAMKP  318
            TG+ISK A KP
Sbjct  221  TGEISKYAFKP  231



>ref|XP_006440581.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53821.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query  82   KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            + V  KR  +    V V+  +  +LP  W KE K ++   GIRKD Y+TDPVSGYVF SK
Sbjct  173  RKVSTKRERETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  232

Query  262  KDAFRYIETGDISKCAMKPTLREPGPTSTDL  354
            KD FRY+ETG+ISK A KP  R+ G  +++L
Sbjct  233  KDVFRYLETGEISKYAFKP--RKRGADASEL  261


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 79/171 (46%), Gaps = 36/171 (21%)
 Frame = +1

Query  121  PVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIET--G  291
            PV  +N     LP GW+ E KTR+ G  + R+   Y +P++G  F S  +  R++E+   
Sbjct  93   PVVDENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKN  152

Query  292  DISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPA  471
              S+C  K T     PT T     T                   R V+ K++  + +R  
Sbjct  153  RNSECERKTT-----PTETSKYEGT-------------------RKVSTKRERETTER--  186

Query  472  KVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             VV     +  +V  LPP WT+E + +K   G + D ++ DPVSG+ F SK
Sbjct  187  -VVV----EKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  232



>ref|XP_009401689.1| PREDICTED: uncharacterized protein LOC103985652 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=504

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            ELP GWIKE + R  G  I+KDP+Y DPVSGY FRS KD FRY+ETGDI  C  KP  R
Sbjct  30   ELPHGWIKEIRLRNSGTKIKKDPFYFDPVSGYEFRSLKDVFRYLETGDIHSCVNKPKKR  88


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +1

Query  517  LPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            LP GW +E R R  GTK   DPFY DPVSG+ FRS
Sbjct  31   LPHGWIKEIRLRNSGTKIKKDPFYFDPVSGYEFRS  65



>ref|XP_006440583.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
 gb|ESR53823.1| hypothetical protein CICLE_v10018609mg [Citrus clementina]
Length=1065

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query  82   KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            + V  KR  +    V V+  +  +LP  W KE K ++   GIRKD Y+TDPVSGYVF SK
Sbjct  202  RKVSTKRERETTERVVVEKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  261

Query  262  KDAFRYIETGDISKCAMKPTLREPGPTSTDL  354
            KD FRY+ETG+ISK A KP  R+ G  +++L
Sbjct  262  KDVFRYLETGEISKYAFKP--RKRGADASEL  290


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 79/171 (46%), Gaps = 36/171 (21%)
 Frame = +1

Query  121  PVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIET--G  291
            PV  +N     LP GW+ E KTR+ G  + R+   Y +P++G  F S  +  R++E+   
Sbjct  122  PVVDENNRPDWLPDGWVVELKTRKSGSAVGRQYKVYIEPITGCKFFSMPEVLRHLESVKN  181

Query  292  DISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPA  471
              S+C  K T     PT T     T                   R V+ K++  + +R  
Sbjct  182  RNSECERKTT-----PTETSKYEGT-------------------RKVSTKRERETTER--  215

Query  472  KVVSNAEGQTESVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSK  618
             VV     +  +V  LPP WT+E + +K   G + D ++ DPVSG+ F SK
Sbjct  216  -VVV----EKSTVVDLPPSWTKETKIKKTARGIRKDRYFTDPVSGYVFCSK  261



>ref|XP_009401688.1| PREDICTED: uncharacterized protein LOC103985652 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=573

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            ELP GWIKE + R  G  I+KDP+Y DPVSGY FRS KD FRY+ETGDI  C  KP  R
Sbjct  99   ELPHGWIKEIRLRNSGTKIKKDPFYFDPVSGYEFRSLKDVFRYLETGDIHSCVNKPKKR  157


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 64/157 (41%), Gaps = 35/157 (22%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW    KT R G  +     + DP +G  F SKK+  +++++G              
Sbjct  10   LPEGWTAVAKTTRSGAVLW---CFHDPYTGSRFCSKKEVLQHLKSGKFRG----------  56

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
             PT    S  T                   R + K   S + +   K  S    Q E+  
Sbjct  57   SPTKQTRSITT-------------------RSMEKLCASTNLEEENKTNSAKNDQIENTP  97

Query  514  -GLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
              LP GW +E R R  GTK   DPFY DPVSG+ FRS
Sbjct  98   YELPHGWIKEIRLRNSGTKIKKDPFYFDPVSGYEFRS  134



>ref|XP_011463824.1| PREDICTED: uncharacterized protein LOC101312827 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1030

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  118  SPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            S V V+  +  +LP GWI E K R++ + IR+DPYYTDPV GY+FRSKKD  RY++TG+ 
Sbjct  164  SKVVVEKHNVEDLPPGWILEIKVRKVANRIRRDPYYTDPVHGYIFRSKKDVIRYLQTGET  223

Query  298  SKCAMKP  318
            SK  +KP
Sbjct  224  SKHTIKP  230


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 69/158 (44%), Gaps = 35/158 (22%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GW  E +TR+ G  + K+   Y DP     F SK + FR++ T              
Sbjct  86   LPDGWKVELRTRKSGVQVGKEYKCYIDPSRECTFYSKPEVFRHLRT--------------  131

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
                             K   S++ K +  KR + K +   +   P+KVV     +  +V
Sbjct  132  --------------VKRKSYKSRSHKTVNRKRCIIKTKTVTAMHFPSKVVV----EKHNV  173

Query  511  DGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRSK  618
            + LPPGW  E + RK   +   DP+Y DPV G+ FRSK
Sbjct  174  EDLPPGWILEIKVRKVANRIRRDPYYTDPVHGYIFRSK  211



>gb|KJB52811.1| hypothetical protein B456_008G278300 [Gossypium raimondii]
Length=600

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+      LP GW KE K  + G+ +R+DP+YTDPVSGYVFRS KDA RY+ETG + K
Sbjct  71   VTVEKAEAEGLPPGWTKEVKITKKGNKVRRDPFYTDPVSGYVFRSMKDALRYVETGKLGK  130

Query  304  CAMKPTLREPGPTSTDLSYD  363
             A KP  +E      DL  D
Sbjct  131  LAFKP--KENESNEEDLEED  148


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 63/156 (40%), Gaps = 52/156 (33%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW  E + RR G   +KD  Y  P     F S+ +  RY++      C  K   +E 
Sbjct  10   LPPGWKVEVRQRRNG---KKDKCYYAPCGELRFISRAEVVRYLKN-----CGSKTEEKEK  61

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
             P+                                       K+ +K V+  + + E   
Sbjct  62   VPS---------------------------------------KQSSKNVTVEKAEAE---  79

Query  514  GLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            GLPPGWT+E +  K G K   DPFY DPVSG+ FRS
Sbjct  80   GLPPGWTKEVKITKKGNKVRRDPFYTDPVSGYVFRS  115



>ref|XP_011463825.1| PREDICTED: uncharacterized protein LOC101312827 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1009

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+  +  +LP GWI E K R++ + IR+DPYYTDPV GY+FRSKKD  RY++TG+ SK
Sbjct  145  VVVEKHNVEDLPPGWILEIKVRKVANRIRRDPYYTDPVHGYIFRSKKDVIRYLQTGETSK  204

Query  304  CAMKP  318
              +KP
Sbjct  205  HTIKP  209



>gb|KHG28622.1| Methyl-CpG-binding domain-containing 13 -like protein [Gossypium 
arboreum]
Length=598

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            + V+      LP GW KE K  + G+ +R+DP+YTDPVSGYVFRS KDA RY+ETG + K
Sbjct  71   ITVEKAEAEGLPPGWTKEVKITKKGNKVRRDPFYTDPVSGYVFRSMKDALRYVETGKLGK  130

Query  304  CAMKPTLREPGPTSTDLSYD  363
             A KP  +E      DL  D
Sbjct  131  LAFKP--KENESNEEDLEED  148


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 64/156 (41%), Gaps = 52/156 (33%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW  E + RR G   +KD  Y  P     F S+ +  RY+E     KC  K   +E 
Sbjct  10   LPPGWKVEVRQRRNG---KKDKCYYTPCGELRFISRAEVVRYLE-----KCGSKTEEKEK  61

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
             P+                                       K+ +K ++  + + E   
Sbjct  62   VPS---------------------------------------KQSSKNITVEKAEAE---  79

Query  514  GLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            GLPPGWT+E +  K G K   DPFY DPVSG+ FRS
Sbjct  80   GLPPGWTKEVKITKKGNKVRRDPFYTDPVSGYVFRS  115



>ref|XP_007211158.1| hypothetical protein PRUPE_ppa027142mg, partial [Prunus persica]
 gb|EMJ12357.1| hypothetical protein PRUPE_ppa027142mg, partial [Prunus persica]
Length=747

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+  +  +LP+GW KE K +R+ + +R+DPYYTDPVSGYVFRSK     Y+ETG+IS+
Sbjct  1    VDVEKHNVEDLPSGWTKEIKVKRVANRLRRDPYYTDPVSGYVFRSKNAVMHYLETGEISR  60

Query  304  CAMKP  318
             A KP
Sbjct  61   HAFKP  65



>ref|XP_008238911.1| PREDICTED: uncharacterized protein LOC103337528 [Prunus mume]
Length=623

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+     +LP+GW KE K +R+ + +R+DPYYTDPVSGYVFRSK     Y+ETG+IS+
Sbjct  147  VDVEKHDVEDLPSGWTKEIKVKRVANRLRRDPYYTDPVSGYVFRSKNAVMHYLETGEISR  206

Query  304  CAMKP  318
             A KP
Sbjct  207  HAFKP  211



>gb|KDP25474.1| hypothetical protein JCGZ_20630 [Jatropha curcas]
Length=1044

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  115  VSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGD  294
             S V  +  +  +LP GWIKE K     +GIRKDPYY DP+ GYVFRSK+D  RY+ETG 
Sbjct  151  TSEVKFEKSTVDDLPPGWIKEIKITANANGIRKDPYYIDPIKGYVFRSKRDVERYLETGK  210

Query  295  ISKCAMKPTLREPG  336
            ISK A  P  R  G
Sbjct  211  ISKHAFLPKKRHTG  224


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 67/162 (41%), Gaps = 55/162 (34%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP----  318
            LP GW+ E KTR+ G    K    Y DP +G  F SK    RY+ET  I + +  P    
Sbjct  86   LPNGWVVELKTRKSGDASGKVYKCYVDPSTGCKFYSKPAVVRYLET--IKQRSYTPKQKE  143

Query  319  TLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQ  498
            TL+   PTS                              K +KS                
Sbjct  144  TLKSALPTSE----------------------------VKFEKS----------------  159

Query  499  TESVDGLPPGWTREFR--ARKCGTKSDPFYVDPVSGFGFRSK  618
              +VD LPPGW +E +  A   G + DP+Y+DP+ G+ FRSK
Sbjct  160  --TVDDLPPGWIKEIKITANANGIRKDPYYIDPIKGYVFRSK  199



>ref|XP_009375788.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Pyrus x bretschneideri]
Length=1172

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  109  KIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET  288
            ++   V V+     +LP GWIKE K  +  +  R+DPYYTDP SGYVFRSKKD  RY+ET
Sbjct  162  QLAKNVYVEKHHVEDLPPGWIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVIRYLET  221

Query  289  GDISKCAMKP  318
            G++SK A KP
Sbjct  222  GEMSKYAFKP  231



>ref|XP_009375787.1| PREDICTED: uncharacterized protein LOC103964564 isoform X1 [Pyrus 
x bretschneideri]
Length=1224

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  109  KIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET  288
            ++   V V+     +LP GWIKE K  +  +  R+DPYYTDP SGYVFRSKKD  RY+ET
Sbjct  162  QLAKNVYVEKHHVEDLPPGWIKEIKVTKYANRFRRDPYYTDPDSGYVFRSKKDVIRYLET  221

Query  289  GDISKCAMKP  318
            G++SK A KP
Sbjct  222  GEMSKYAFKP  231



>ref|XP_009369054.1| PREDICTED: uncharacterized protein LOC103958513 [Pyrus x bretschneideri]
Length=1208

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 58/101 (57%), Gaps = 9/101 (9%)
 Frame = +1

Query  43   KSVEDNSQISKRRKSVVDKR---------PAKIVSPVAVQNGSESELPAGWIKEYKTRRL  195
            K+V+  S  S   KS+  KR           ++   V V+     +LP GWIKE K  + 
Sbjct  132  KTVKRKSSKSGNLKSISSKRCITEGKDVTTMQLTKNVYVEKHHVEDLPPGWIKEIKVTKY  191

Query  196  GHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
             +  RKDPYYTDP SGYVFRSKKD   Y+ETG+ISK A KP
Sbjct  192  ANRFRKDPYYTDPDSGYVFRSKKDVICYLETGEISKHAFKP  232



>ref|XP_008367419.1| PREDICTED: uncharacterized protein LOC103431052 [Malus domestica]
Length=1123

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +1

Query  109  KIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET  288
            ++   V V+     +LP GWIKE K  +  +  RKDPYYTDP SGYVFRSKKD   Y+ET
Sbjct  81   QLTKNVYVEKHHVEDLPPGWIKEIKVTKYANRFRKDPYYTDPDSGYVFRSKKDVICYLET  140

Query  289  GDISKCAMKP  318
            G+ISK A KP
Sbjct  141  GEISKHAFKP  150



>gb|EMT07793.1| hypothetical protein F775_13908 [Aegilops tauschii]
Length=1078

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +1

Query  79   RKSVVDKRPAKIVSPVAVQNG--SESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVF  252
            RK V  ++      PV +++G  S+ +LP GW KE + R+   G + DPYYTDPVSGY F
Sbjct  284  RKEVRPRKDGTKSDPVQIKDGLLSKGQLPDGWRKEVRPRK--DGTKSDPYYTDPVSGYEF  341

Query  253  RSKKDAFRYIETGDISKCAMKPTLR  327
            RS KD  RYIE+GDISKC ++P  R
Sbjct  342  RSLKDVQRYIESGDISKCNVRPKKR  366


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  517  LPPGWTREFRARKCGTKSDPFYVDPVSGFGFRS  615
            LP GW +E R RK GTKSDP+Y DPVSG+ FRS
Sbjct  311  LPDGWRKEVRPRKDGTKSDPYYTDPVSGYEFRS  343



>ref|XP_008796741.1| PREDICTED: uncharacterized protein LOC103712110 isoform X6 [Phoenix 
dactylifera]
Length=651

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 76/161 (47%), Gaps = 33/161 (20%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E+KTR+ G H  R+   Y DPV+G+ F SK +  RYI+ G     +  P  + 
Sbjct  40   LPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG----MSCNPRAKR  95

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTE-S  507
                 T ++ +                       +  Q+ G  +     + N   Q E +
Sbjct  96   KRSVVTKVTENACS--------------------STSQRKGIKR---STMENVRSQIEYT  132

Query  508  VDGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK  618
             DGLP GW +E R RK    CG K D +Y DPV+GF FRS+
Sbjct  133  PDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSR  173


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGH--GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP+GWIKE + R+     G ++D YYTDPV+G+VFRS+KDA +YIETG++SK A+KP  R
Sbjct  136  LPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNR  195



>gb|EMS57086.1| Methyl-CpG-binding domain-containing protein 13 [Triticum urartu]
Length=946

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = +1

Query  121  PVAVQNG--SESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGD  294
            PV +++G  S+ +LP GW KE + R+   G + DPYYTDPVSGY FRS KD  RYIE+GD
Sbjct  166  PVQIKDGLLSKGQLPDGWRKEVRPRK--DGTKSDPYYTDPVSGYEFRSLKDVQRYIESGD  223

Query  295  ISKCAMKPTLR  327
            ISKC ++P  R
Sbjct  224  ISKCNVRPKKR  234


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  517  LPPGWTREFRARKCGTKSDPFYVDPVSGFGFRS  615
            LP GW +E R RK GTKSDP+Y DPVSG+ FRS
Sbjct  179  LPDGWRKEVRPRKDGTKSDPYYTDPVSGYEFRS  211



>ref|XP_008796736.1| PREDICTED: uncharacterized protein LOC103712110 isoform X2 [Phoenix 
dactylifera]
Length=694

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 76/161 (47%), Gaps = 33/161 (20%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E+KTR+ G H  R+   Y DPV+G+ F SK +  RYI+ G     +  P  + 
Sbjct  83   LPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG----MSCNPRAKR  138

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTE-S  507
                 T ++ +                       +  Q+ G  +     + N   Q E +
Sbjct  139  KRSVVTKVTENACS--------------------STSQRKGIKR---STMENVRSQIEYT  175

Query  508  VDGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK  618
             DGLP GW +E R RK    CG K D +Y DPV+GF FRS+
Sbjct  176  PDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSR  216


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGH--GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP+GWIKE + R+     G ++D YYTDPV+G+VFRS+KDA +YIETG++SK A+KP  R
Sbjct  179  LPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNR  238



>ref|XP_008796738.1| PREDICTED: uncharacterized protein LOC103712110 isoform X4 [Phoenix 
dactylifera]
Length=692

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 76/161 (47%), Gaps = 33/161 (20%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E+KTR+ G H  R+   Y DPV+G+ F SK +  RYI+ G     +  P  + 
Sbjct  83   LPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG----MSCNPRAKR  138

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTE-S  507
                 T ++ +                       +  Q+ G  +     + N   Q E +
Sbjct  139  KRSVVTKVTENACS--------------------STSQRKGIKR---STMENVRSQIEYT  175

Query  508  VDGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK  618
             DGLP GW +E R RK    CG K D +Y DPV+GF FRS+
Sbjct  176  PDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSR  216


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGH--GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP+GWIKE + R+     G ++D YYTDPV+G+VFRS+KDA +YIETG++SK A+KP  R
Sbjct  179  LPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNR  238



>ref|XP_008437227.1| PREDICTED: uncharacterized protein LOC103482721 isoform X1 [Cucumis 
melo]
Length=635

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 7/74 (9%)
 Frame = +1

Query  118  SPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDP-------YYTDPVSGYVFRSKKDAFR  276
            S V +++  + +LP GWIKE K +    GIRKDP       +Y DP SGY+FRSKK+ FR
Sbjct  152  SRVVIEHYKDEDLPPGWIKEIKIKEKADGIRKDPLYPTFLQFYIDPKSGYIFRSKKEVFR  211

Query  277  YIETGDISKCAMKP  318
            Y+ETG+IS+ A KP
Sbjct  212  YLETGEISRHAFKP  225



>gb|KDO60033.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=537

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KE K  + G  +R+DPYY DP SGY+FRS KDA RY+ETG+I + A KP
Sbjct  13   LPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEIGRLAYKP  67


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = +1

Query  511  DGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            DGLPPGWT+E +  K G K   DP+Y+DP SG+ FRS
Sbjct  11   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRS  47



>ref|XP_008437228.1| PREDICTED: uncharacterized protein LOC103482721 isoform X2 [Cucumis 
melo]
Length=634

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 50/74 (68%), Gaps = 7/74 (9%)
 Frame = +1

Query  118  SPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDP-------YYTDPVSGYVFRSKKDAFR  276
            S V +++  + +LP GWIKE K +    GIRKDP       +Y DP SGY+FRSKK+ FR
Sbjct  151  SRVVIEHYKDEDLPPGWIKEIKIKEKADGIRKDPLYPTFLQFYIDPKSGYIFRSKKEVFR  210

Query  277  YIETGDISKCAMKP  318
            Y+ETG+IS+ A KP
Sbjct  211  YLETGEISRHAFKP  224



>ref|XP_006490367.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Citrus sinensis]
 gb|KDO60031.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=564

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KE K  + G  +R+DPYY DP SGY+FRS KDA RY+ETG+I + A KP
Sbjct  40   LPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEIGRLAYKP  94


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = +1

Query  511  DGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            DGLPPGWT+E +  K G K   DP+Y+DP SG+ FRS
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRS  74



>ref|XP_006421896.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
 gb|ESR35136.1| hypothetical protein CICLE_v10004647mg [Citrus clementina]
Length=564

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KE K  + G  +R+DPYY DP SGY+FRS KDA RY+ETG+I + A KP
Sbjct  40   LPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEIGRLAYKP  94


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = +1

Query  511  DGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            DGLPPGWT+E +  K G K   DP+Y+DP SG+ FRS
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRS  74



>gb|KDO60032.1| hypothetical protein CISIN_1g008463mg [Citrus sinensis]
Length=549

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KE K  + G  +R+DPYY DP SGY+FRS KDA RY+ETG+I + A KP
Sbjct  40   LPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRSMKDAVRYVETGEIGRLAYKP  94


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = +1

Query  511  DGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            DGLPPGWT+E +  K G K   DP+Y+DP SG+ FRS
Sbjct  38   DGLPPGWTKEIKVTKTGRKVRRDPYYIDPASGYIFRS  74



>ref|XP_008796740.1| PREDICTED: uncharacterized protein LOC103712110 isoform X5 [Phoenix 
dactylifera]
Length=652

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 73/165 (44%), Gaps = 40/165 (24%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E+KTR+ G H  R+   Y DPV+G+ F SK +  RYI+ G     +  P  + 
Sbjct  40   LPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG----MSCNPRAKR  95

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
                 T                           V +   S + +R     S  E Q  S 
Sbjct  96   KRSVVT--------------------------KVTENACSSTSQRKGIKRSTMENQVRSQ  129

Query  511  -----DGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK  618
                 DGLP GW +E R RK    CG K D +Y DPV+GF FRS+
Sbjct  130  IEYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSR  174


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGH--GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP+GWIKE + R+     G ++D YYTDPV+G+VFRS+KDA +YIETG++SK A+KP  R
Sbjct  137  LPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNR  196



>ref|XP_008796735.1| PREDICTED: uncharacterized protein LOC103712110 isoform X1 [Phoenix 
dactylifera]
Length=695

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 73/165 (44%), Gaps = 40/165 (24%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E+KTR+ G H  R+   Y DPV+G+ F SK +  RYI+ G     +  P  + 
Sbjct  83   LPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG----MSCNPRAKR  138

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
                 T                           V +   S + +R     S  E Q  S 
Sbjct  139  KRSVVT--------------------------KVTENACSSTSQRKGIKRSTMENQVRSQ  172

Query  511  -----DGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK  618
                 DGLP GW +E R RK    CG K D +Y DPV+GF FRS+
Sbjct  173  IEYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSR  217


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGH--GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP+GWIKE + R+     G ++D YYTDPV+G+VFRS+KDA +YIETG++SK A+KP  R
Sbjct  180  LPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNR  239



>ref|XP_008796737.1| PREDICTED: uncharacterized protein LOC103712110 isoform X3 [Phoenix 
dactylifera]
Length=693

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 73/165 (44%), Gaps = 40/165 (24%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E+KTR+ G H  R+   Y DPV+G+ F SK +  RYI+ G     +  P  + 
Sbjct  83   LPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG----MSCNPRAKR  138

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
                 T                           V +   S + +R     S  E Q  S 
Sbjct  139  KRSVVT--------------------------KVTENACSSTSQRKGIKRSTMENQVRSQ  172

Query  511  -----DGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK  618
                 DGLP GW +E R RK    CG K D +Y DPV+GF FRS+
Sbjct  173  IEYTPDGLPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSR  217


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGH--GIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP+GWIKE + R+     G ++D YYTDPV+G+VFRS+KDA +YIETG++SK A+KP  R
Sbjct  180  LPSGWIKEIRYRKTSSRCGAKRDQYYTDPVNGFVFRSRKDAIQYIETGEVSKYAIKPKNR  239



>ref|XP_010035117.1| PREDICTED: uncharacterized protein LOC104424406 isoform X1 [Eucalyptus 
grandis]
 gb|KCW46411.1| hypothetical protein EUGRSUZ_K00243 [Eucalyptus grandis]
Length=818

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRL-GHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KE K +R  G  IR+DPYYTDPVSGYVFRS KD  RY++TGDI + A KP
Sbjct  262  LPEGWTKEIKVKRKNGTIIRRDPYYTDPVSGYVFRSMKDVRRYLDTGDIGRLAYKP  317



>ref|XP_010035118.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Eucalyptus grandis]
Length=812

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRL-GHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KE K +R  G  IR+DPYYTDPVSGYVFRS KD  RY++TGDI + A KP
Sbjct  262  LPEGWTKEIKVKRKNGTIIRRDPYYTDPVSGYVFRSMKDVRRYLDTGDIGRLAYKP  317



>ref|XP_004972592.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Setaria italica]
 ref|XP_004972593.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Setaria italica]
Length=954

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KEY+ R+ G    +DP+Y DPVSGY FRS KD  RY+ETGDI++C M+P
Sbjct  284  LPDGWLKEYRPRKTGS--FQDPFYIDPVSGYEFRSLKDVHRYLETGDINQCIMRP  336


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +1

Query  508  VDGLPPGWTREFRARKCGTKSDPFYVDPVSGFGFRS  615
            ++GLP GW +E+R RK G+  DPFY+DPVSG+ FRS
Sbjct  281  IEGLPDGWLKEYRPRKTGSFQDPFYIDPVSGYEFRS  316



>emb|CBI31785.3| unnamed protein product [Vitis vinifera]
Length=560

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 17/110 (15%)
 Frame = +1

Query  58   NSQISKRRKSVVDKRPAKIVSP-----------------VAVQNGSESELPAGWIKEYKT  186
            N + S ++KS+  K P K ++P                 V  +  +   LP GWIKE K 
Sbjct  55   NDRESIQKKSIERKTPIKTMAPAGKKKSMEKKKHCIAKKVVFERVTAEGLPPGWIKEIKI  114

Query  187  RRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPG  336
            ++    +R+D YYTDPV+GY+FRS KD  RY++TGD  + A KP  R+ G
Sbjct  115  QKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTGDPGRLAFKPKPRDSG  164



>ref|XP_010662494.1| PREDICTED: uncharacterized protein LOC100263513 isoform X1 [Vitis 
vinifera]
Length=637

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 17/110 (15%)
 Frame = +1

Query  58   NSQISKRRKSVVDKRPAKIVSP-----------------VAVQNGSESELPAGWIKEYKT  186
            N + S ++KS+  K P K ++P                 V  +  +   LP GWIKE K 
Sbjct  55   NDRESIQKKSIERKTPIKTMAPAGKKKSMEKKKHCIAKKVVFERVTAEGLPPGWIKEIKI  114

Query  187  RRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPG  336
            ++    +R+D YYTDPV+GY+FRS KD  RY++TGD  + A KP  R+ G
Sbjct  115  QKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTGDPGRLAFKPKPRDSG  164



>ref|XP_010273135.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
 ref|XP_010273136.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nelumbo 
nucifera]
Length=553

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            ELP GWIKE + RR     +K D YY DPV+GY FRSKKD FRY+ TGD+  CA+KP  R
Sbjct  103  ELPPGWIKEIRVRRKTCKTKKSDTYYIDPVNGYEFRSKKDVFRYLGTGDLENCAIKPKKR  162


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 65/159 (41%), Gaps = 53/159 (33%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E KTR  G    +K   Y  P +G    SKK+  RY+       C M P ++ 
Sbjct  31   LPAGWVVEIKTRMSGSSAGQKYKCYIAPSTGCKLYSKKEVQRYL------SCYM-PEVK-  82

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
                                           R   K  +S        VV       +  
Sbjct  83   -------------------------------RKECKNMQSA-----CNVVLK-----DVT  101

Query  511  DGLPPGWTREFRARK--CGTK-SDPFYVDPVSGFGFRSK  618
            + LPPGW +E R R+  C TK SD +Y+DPV+G+ FRSK
Sbjct  102  EELPPGWIKEIRVRRKTCKTKKSDTYYIDPVNGYEFRSK  140



>ref|XP_011030071.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GW KE K  + G  IR+DP YTDPVSGYVFRS KDA RYIE+G + + A K   RE
Sbjct  81   LPLGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE  139



>ref|XP_011030070.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GW KE K  + G  IR+DP YTDPVSGYVFRS KDA RYIE+G + + A K   RE
Sbjct  81   LPLGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE  139



>ref|XP_011012359.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Populus euphratica]
Length=773

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GW KE K  + G  IR+DP YTDPVSGYVFRS KDA RYIE+G + + A K   RE
Sbjct  81   LPLGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE  139



>ref|XP_011030072.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GW KE K  + G  IR+DP YTDPVSGYVFRS KDA RYIE+G + + A K   RE
Sbjct  70   LPLGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE  128



>ref|XP_011012358.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Populus euphratica]
Length=775

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GW KE K  + G  IR+DP YTDPVSGYVFRS KDA RYIE+G + + A K   RE
Sbjct  81   LPLGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE  139



>ref|XP_011012360.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Populus euphratica]
Length=764

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GW KE K  + G  IR+DP YTDPVSGYVFRS KDA RYIE+G + + A K   RE
Sbjct  70   LPLGWTKEIKVTKRGGRIRRDPLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE  128



>ref|XP_010918514.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Elaeis guineensis]
Length=488

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRL--GHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP+GWIKE + R+     G ++D YYTDPV+GYVFRS+KDA +YIETG +SK A+KP
Sbjct  153  LPSGWIKEIRYRKSTSSCGAKRDQYYTDPVNGYVFRSRKDAIQYIETGQVSKYAIKP  209


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 75/161 (47%), Gaps = 33/161 (20%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW  E+KTR+ G +  R+   Y DPV+GY F SK +  RYI+ G        P  + 
Sbjct  57   LPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDG----IPRNPRAKR  112

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTE-S  507
                 T ++  T                      +  Q+ G  KR  +   N   Q E +
Sbjct  113  KRSVVTRITEHT--------------------RSSTNQRKGI-KRSTR--ENLRSQIEYT  149

Query  508  VDGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK  618
             DGLP GW +E R RK    CG K D +Y DPV+G+ FRS+
Sbjct  150  PDGLPSGWIKEIRYRKSTSSCGAKRDQYYTDPVNGYVFRSR  190



>ref|XP_009595657.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 [Nicotiana 
tomentosiformis]
Length=541

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 49/81 (60%), Gaps = 4/81 (5%)
 Frame = +1

Query  46   SVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYY  225
            SV  N   S   K +  K   K+V+  A   G    LP GWIKE + RR GH I+KDPYY
Sbjct  49   SVGSNCFKSSSTKEIEKKDTGKVVTEKATSEG----LPPGWIKEVRVRRKGHKIKKDPYY  104

Query  226  TDPVSGYVFRSKKDAFRYIET  288
            TDPVSG+ FRS K+  R++ET
Sbjct  105  TDPVSGHTFRSMKEVSRFLET  125


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 66/156 (42%), Gaps = 53/156 (34%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LPAGW  E++  +      K+ +Y+DP  G  F SK D   Y+ +   S C    + +E 
Sbjct  11   LPAGWKVEFRKGK------KEKWYSDPSKGLKFCSKADVLHYLSSVG-SNCFKSSSTKE-  62

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
                                              +K+ +G      KVV+    +  + +
Sbjct  63   ---------------------------------IEKKDTG------KVVT----EKATSE  79

Query  514  GLPPGWTREFRARKCG--TKSDPFYVDPVSGFGFRS  615
            GLPPGW +E R R+ G   K DP+Y DPVSG  FRS
Sbjct  80   GLPPGWIKEVRVRRKGHKIKKDPYYTDPVSGHTFRS  115



>ref|XP_010918513.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Elaeis guineensis]
Length=514

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRL--GHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP+GWIKE + R+     G ++D YYTDPV+GYVFRS+KDA +YIETG +SK A+KP
Sbjct  179  LPSGWIKEIRYRKSTSSCGAKRDQYYTDPVNGYVFRSRKDAIQYIETGQVSKYAIKP  235


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 75/161 (47%), Gaps = 33/161 (20%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW  E+KTR+ G +  R+   Y DPV+GY F SK +  RYI+ G        P  + 
Sbjct  83   LPAGWGLEFKTRKSGTNAGRQYKCYIDPVTGYKFYSKNEVLRYIKDG----IPRNPRAKR  138

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTE-S  507
                 T ++  T                      +  Q+ G  KR  +   N   Q E +
Sbjct  139  KRSVVTRITEHT--------------------RSSTNQRKGI-KRSTR--ENLRSQIEYT  175

Query  508  VDGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK  618
             DGLP GW +E R RK    CG K D +Y DPV+G+ FRS+
Sbjct  176  PDGLPSGWIKEIRYRKSTSSCGAKRDQYYTDPVNGYVFRSR  216



>ref|XP_010662495.1| PREDICTED: uncharacterized protein LOC100263513 isoform X2 [Vitis 
vinifera]
Length=564

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GWIKE K ++    +R+D YYTDPV+GY+FRS KD  RY++TGD  + A KP  R+ 
Sbjct  31   LPPGWIKEIKIQKKCGTVRRDAYYTDPVNGYIFRSMKDTLRYLKTGDPGRLAFKPKPRDS  90

Query  334  G  336
            G
Sbjct  91   G  91



>ref|XP_010934846.1| PREDICTED: uncharacterized protein LOC105054908 isoform X1 [Elaeis 
guineensis]
Length=687

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KE + ++   GIRKDPYY DPVSGYVFR+ KD  RY ETG+IS+ A +P
Sbjct  161  LPDGWYKETRIKKNRSGIRKDPYYADPVSGYVFRTLKDVQRYTETGEISRHAFRP  215



>ref|XP_008662741.1| PREDICTED: uncharacterized protein LOC103641148 isoform X1 [Zea 
mays]
Length=942

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KEY+ R+  +G   DPYY DPVSGY FRS KD   Y+ETGDIS+CA+ P
Sbjct  267  LPDGWQKEYRPRK--NGPCSDPYYIDPVSGYEFRSLKDVHNYLETGDISQCAVTP  319


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +1

Query  424  RHVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSDPFYVDPVSGF  603
            +  A +   G  +  AK VS  +     V+GLP GW +E+R RK G  SDP+Y+DPVSG+
Sbjct  239  KAAAMRSDHGGRRLAAKTVSEDK---RGVEGLPDGWQKEYRPRKNGPCSDPYYIDPVSGY  295

Query  604  GFRS  615
             FRS
Sbjct  296  EFRS  299



>ref|XP_008662742.1| PREDICTED: uncharacterized protein LOC103641148 isoform X2 [Zea 
mays]
Length=934

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KEY+ R+  +G   DPYY DPVSGY FRS KD   Y+ETGDIS+CA+ P
Sbjct  259  LPDGWQKEYRPRK--NGPCSDPYYIDPVSGYEFRSLKDVHNYLETGDISQCAVTP  311


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +1

Query  424  RHVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSDPFYVDPVSGF  603
            +  A +   G  +  AK VS  +     V+GLP GW +E+R RK G  SDP+Y+DPVSG+
Sbjct  231  KAAAMRSDHGGRRLAAKTVSEDK---RGVEGLPDGWQKEYRPRKNGPCSDPYYIDPVSGY  287

Query  604  GFRS  615
             FRS
Sbjct  288  EFRS  291



>ref|XP_011041595.1| PREDICTED: uncharacterized protein LOC105137520 isoform X6 [Populus 
euphratica]
Length=802

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  162  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|NP_001061241.1| Os08g0206700 [Oryza sativa Japonica Group]
 dbj|BAD11558.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD12843.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23155.1| Os08g0206700 [Oryza sativa Japonica Group]
 dbj|BAG92499.1| unnamed protein product [Oryza sativa Japonica Group]
Length=422

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 58/101 (57%), Gaps = 15/101 (15%)
 Frame = +1

Query  40   EKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDP  219
            E S E N  +S  +  +V ++   IV            LP GW KE + R+ G  ++ DP
Sbjct  317  ENSAEKN--VSNHKNELVQRKDDLIVDG----------LPDGWWKEDRPRKNGSNLKTDP  364

Query  220  YYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP---TLREP  333
            YY DPVSGY FRS KD  R++++GDI KC ++P   T+++P
Sbjct  365  YYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVRPRKRTIQDP  405


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = +1

Query  508  VDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRS  615
            VDGLP GW +E R RK G+  K+DP+Y+DPVSG+ FRS
Sbjct  340  VDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRS  377



>ref|XP_011048654.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X3 [Populus euphratica]
Length=828

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  162  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_011041590.1| PREDICTED: uncharacterized protein LOC105137520 isoform X1 [Populus 
euphratica]
Length=857

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  162  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_011041593.1| PREDICTED: uncharacterized protein LOC105137520 isoform X4 [Populus 
euphratica]
Length=807

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  162  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_011041592.1| PREDICTED: uncharacterized protein LOC105137520 isoform X3 [Populus 
euphratica]
Length=830

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  162  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_011048657.1| PREDICTED: uncharacterized protein LOC105142633 isoform X5 [Populus 
euphratica]
Length=800

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  162  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_011048652.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Populus euphratica]
Length=855

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  162  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  215



>ref|XP_011048653.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Populus euphratica]
Length=844

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  151  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  204



>ref|XP_011041591.1| PREDICTED: uncharacterized protein LOC105137520 isoform X2 [Populus 
euphratica]
Length=846

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSGYVFRS K A RYIE+G + + A K
Sbjct  151  LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGYVFRSMKGAHRYIESGGVGRLAFK  204



>ref|XP_009760427.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Nicotiana sylvestris]
Length=522

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 51/97 (53%), Gaps = 4/97 (4%)
 Frame = +1

Query  46   SVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYY  225
            SV  N   S   K +  K   K  +  A   G    LP GWIKE + RR GH IRKDPYY
Sbjct  49   SVGSNCSKSSNTKEMEKKDTGKFSTGKAASEG----LPPGWIKEMRVRRKGHKIRKDPYY  104

Query  226  TDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPG  336
             DPVSG  FRS K+  R +ET +  +   KP  + PG
Sbjct  105  IDPVSGQTFRSMKEVSRLLETRESGRIESKPGDQCPG  141


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 64/156 (41%), Gaps = 53/156 (34%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LPAGW  E++  +      K+ +Y+DP     F SK D  RY+ +   S C+     +E 
Sbjct  11   LPAGWKVEFRKGK------KEKWYSDPSKELKFNSKTDVLRYLSSVG-SNCSKSSNTKE-  62

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
                                                +K  +GK      S  +  +E   
Sbjct  63   -----------------------------------MEKKDTGK-----FSTGKAASE---  79

Query  514  GLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            GLPPGW +E R R+ G K   DP+Y+DPVSG  FRS
Sbjct  80   GLPPGWIKEMRVRRKGHKIRKDPYYIDPVSGQTFRS  115



>dbj|BAK01530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1091

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            +LP GW +E + R+   G + D YYTDPVSGY FRS KD  RYIE+GDISKC ++P  R
Sbjct  317  QLPDGWRREDRLRK--DGTKSDTYYTDPVSGYEFRSLKDVQRYIESGDISKCNIRPKKR  373


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  517  LPPGWTREFRARKCGTKSDPFYVDPVSGFGFRS  615
            LP GW RE R RK GTKSD +Y DPVSG+ FRS
Sbjct  318  LPDGWRREDRLRKDGTKSDTYYTDPVSGYEFRS  350



>ref|XP_010234460.1| PREDICTED: uncharacterized protein LOC100834821 isoform X2 [Brachypodium 
distachyon]
Length=1092

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            +LP GW +E + RR G   + DPYY DPV+GY FRS KD  RYI++GDI +C+ +P  R
Sbjct  316  QLPDGWRREDRPRRNGSTNKTDPYYIDPVNGYEFRSMKDVHRYIKSGDIKQCSFRPKKR  374



>ref|XP_010234457.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234458.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010234459.1| PREDICTED: uncharacterized protein LOC100834821 isoform X1 [Brachypodium 
distachyon]
Length=1096

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  151  ELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            +LP GW +E + RR G   + DPYY DPV+GY FRS KD  RYI++GDI +C+ +P  R
Sbjct  320  QLPDGWRREDRPRRNGSTNKTDPYYIDPVNGYEFRSMKDVHRYIKSGDIKQCSFRPKKR  378



>ref|NP_001170014.1| hypothetical protein [Zea mays]
 gb|ACN35529.1| unknown [Zea mays]
 gb|AFW59433.1| hypothetical protein ZEAMMB73_114433 [Zea mays]
Length=432

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 65/113 (58%), Gaps = 10/113 (9%)
 Frame = +1

Query  46   SVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESE-LPAGWIKEYKTR--RLGHGIRKD  216
            S E +  I++R+  VV   PAK ++ V  +N    E LP GW+KE + R  R G  ++ D
Sbjct  3    SFEGSDHITQRK--VV---PAKHIALVDGKNEPAVEGLPNGWLKECRPRKNRYGSRVKSD  57

Query  217  PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR--EPGPTSTDLSYDTG  369
             +Y DP++GY F S KD  RY+E+GDISKC   P  R  E   T  D S+ TG
Sbjct  58   TFYIDPINGYEFHSLKDVHRYLESGDISKCIRLPNKRKIEDLHTKEDQSHHTG  110


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 5/55 (9%)
 Frame = +1

Query  466  PAKVVSNAEGQTE-SVDGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRS  615
            PAK ++  +G+ E +V+GLP GW +E R RK       KSD FY+DP++G+ F S
Sbjct  17   PAKHIALVDGKNEPAVEGLPNGWLKECRPRKNRYGSRVKSDTFYIDPINGYEFHS  71



>gb|EMT22364.1| hypothetical protein F775_06449 [Aegilops tauschii]
Length=566

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS  +FR+ K A  Y++TG+ISK A  P
Sbjct  218  LPKGWVKELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSAISYLQTGEISKHAYLP  272



>ref|XP_006653226.1| PREDICTED: uncharacterized protein LOC102699500 [Oryza brachyantha]
Length=520

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS +VFR+ K    Y+ETG+I+K A  P
Sbjct  186  LPEGWVKEMIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGEITKHAYIP  240



>ref|XP_002318826.1| hypothetical protein POPTR_0012s13490g [Populus trichocarpa]
 gb|EEE97046.1| hypothetical protein POPTR_0012s13490g [Populus trichocarpa]
Length=762

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LP GW +E K  + G  IR+D  YTDPVSGYVFRS KDA RYIE+G + + A K   RE
Sbjct  70   LPLGWTQEIKVTKKGGRIRRDSLYTDPVSGYVFRSMKDACRYIESGVVGRLAFKRNDRE  128



>ref|XP_006659212.1| PREDICTED: uncharacterized protein LOC102718198 [Oryza brachyantha]
Length=1007

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 3/63 (5%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP---TL  324
            LP GW KE + R+ G   + DPYY DPVSGY FRS KD  R++++GDI KC ++P   T+
Sbjct  299  LPDGWWKEDRPRKNGSNQKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYKCTIRPRKRTV  358

Query  325  REP  333
            ++P
Sbjct  359  QDP  361


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +1

Query  505  SVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRS  615
            +++GLP GW +E R RK G+  K+DP+Y+DPVSG+ FRS
Sbjct  295  TINGLPDGWWKEDRPRKNGSNQKTDPYYIDPVSGYEFRS  333



>ref|XP_008791903.1| PREDICTED: uncharacterized protein LOC103708650 [Phoenix dactylifera]
Length=569

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP GW KE + ++   G R+DPYY DP SGYVFR+ KD  RY ETG+ISK A +P  R
Sbjct  161  LPHGWYKEIRIKKNRSGFRRDPYYADPESGYVFRTLKDVQRYTETGEISKHAFRPRKR  218



>ref|NP_001052334.1| Os04g0266400 [Oryza sativa Japonica Group]
 dbj|BAF14248.1| Os04g0266400 [Oryza sativa Japonica Group]
Length=313

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS +VFR+ K    Y+ETG I+K A  P
Sbjct  243  LPEGWVKEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIP  297



>emb|CAD39968.2| OSJNBa0072D08.3 [Oryza sativa Japonica Group]
Length=505

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS +VFR+ K    Y+ETG I+K A  P
Sbjct  180  LPEGWVKEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIP  234



>emb|CAH66253.1| OSIGBa0139I12.2 [Oryza sativa Indica Group]
Length=505

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS +VFR+ K    Y+ETG I+K A  P
Sbjct  180  LPEGWVKEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIP  234



>dbj|BAG89597.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97335.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS +VFR+ K    Y+ETG I+K A  P
Sbjct  243  LPEGWVKEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIP  297



>gb|EEC76899.1| hypothetical protein OsI_15124 [Oryza sativa Indica Group]
 gb|EEE53269.1| hypothetical protein OsJ_36209 [Oryza sativa Japonica Group]
Length=371

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS +VFR+ K    Y+ETG I+K A  P
Sbjct  243  LPEGWVKEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIP  297



>ref|XP_008678194.1| PREDICTED: uncharacterized protein LOC103652994 [Zea mays]
 ref|XP_008678195.1| PREDICTED: uncharacterized protein LOC103652994 [Zea mays]
Length=912

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KEY+ R+ G  +  D YY DPVSGY FRS KD  RY+ETGDI +CA++P
Sbjct  236  LPDGWRKEYRPRKNGSFL--DVYYIDPVSGYEFRSFKDVHRYLETGDIRQCAVRP  288


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +1

Query  451  GSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSDPFYVDPVSGFGFRS  615
            G G+  AK VS  +    +V+GLP GW +E+R RK G+  D +Y+DPVSG+ FRS
Sbjct  217  GGGRLVAKTVSKDK---RAVEGLPDGWRKEYRPRKNGSFLDVYYIDPVSGYEFRS  268



>ref|XP_002444023.1| hypothetical protein SORBIDRAFT_07g006030 [Sorghum bicolor]
 gb|EES13518.1| hypothetical protein SORBIDRAFT_07g006030 [Sorghum bicolor]
Length=961

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
             P GW KEY+ R+ G    +DPYY DPVSGY FRS KD  RY++TGDI +CA++P
Sbjct  268  FPDGWRKEYRPRKSGS--FQDPYYIDPVSGYEFRSLKDVHRYLKTGDIRQCAVRP  320


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 3/55 (5%)
 Frame = +1

Query  451  GSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSDPFYVDPVSGFGFRS  615
            G  +   K VS  E     V+G P GW +E+R RK G+  DP+Y+DPVSG+ FRS
Sbjct  249  GGARLSTKTVSQDE---RVVEGFPDGWRKEYRPRKSGSFQDPYYIDPVSGYEFRS  300



>gb|AFW61002.1| hypothetical protein ZEAMMB73_269384 [Zea mays]
Length=921

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW KEY+ R+ G  +  D YY DPVSGY FRS KD  RY+ETGDI +CA++P
Sbjct  245  LPDGWRKEYRPRKNGSFL--DVYYIDPVSGYEFRSFKDVHRYLETGDIRQCAVRP  297


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = +1

Query  451  GSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGTKSDPFYVDPVSGFGFRS  615
            G G+  AK VS  +    +V+GLP GW +E+R RK G+  D +Y+DPVSG+ FRS
Sbjct  226  GGGRLVAKTVSKDK---RAVEGLPDGWRKEYRPRKNGSFLDVYYIDPVSGYEFRS  277



>ref|XP_002321896.2| hypothetical protein POPTR_0015s13470g [Populus trichocarpa]
 gb|EEF06023.2| hypothetical protein POPTR_0015s13470g [Populus trichocarpa]
Length=774

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK  315
            LP GW KE K  + G  IR+DP+YTDPVSG VFRS K+A RYIE+G + + A K
Sbjct  81   LPLGWTKEIKVTKKGGRIRRDPFYTDPVSGCVFRSMKEAHRYIESGVVGRLAFK  134



>dbj|BAA89308.1| AHM2 [Triticum aestivum]
Length=353

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS  +FR+ K    Y++TG+IS+ A  P
Sbjct  5    LPKGWVKELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEISRHAYLP  59



>emb|CDP05220.1| unnamed protein product [Coffea canephora]
Length=480

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCA  309
            LPAGWIKE +  + G+ IR+DPYY DP SG++FRS K+ FRY++TG +   A
Sbjct  86   LPAGWIKETRVTQKGNKIRRDPYYIDPESGHLFRSMKEVFRYLDTGKMGGLA  137



>gb|EMT11132.1| hypothetical protein F775_24324 [Aegilops tauschii]
Length=387

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+   GIRKDPYYTDPV+ YVFR+   A RY+ETG ++K A 
Sbjct  215  LPHGWVKEIVYRKTSEGIRKDPYYTDPVNQYVFRTLTSAVRYLETGKVTKRAF  267



>ref|XP_003581103.2| PREDICTED: uncharacterized protein LOC100844950 isoform X1 [Brachypodium 
distachyon]
Length=533

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDP+S  VFR+ K    Y+ETG+ISK A  P
Sbjct  262  LPNGWVKEVIFRKCNDGIRKDPYYTDPISHLVFRTLKSVTNYLETGEISKHAYIP  316



>ref|XP_004976791.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Setaria italica]
 ref|XP_004976792.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Setaria italica]
 ref|XP_004976793.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Setaria italica]
 ref|XP_004976794.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X4 [Setaria italica]
 ref|XP_004976795.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X5 [Setaria italica]
Length=389

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +1

Query  154  LPAGWIKEYKTR--RLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP GW+KE + R  R G  I+ D +Y DPV+GY FRS KD +RY+E+GDIS+C   P  R
Sbjct  13   LPDGWLKECRPRKNRNGSRIKGDMFYIDPVNGYEFRSLKDVYRYLESGDISQCVTLPNKR  72

Query  328  --EPGPTSTDLSYDTG  369
              E   T+ D S  TG
Sbjct  73   KIEDLHTAGDQSDHTG  88



>gb|AGT16604.1| hypothetical protein SHCRBa_016_K03_R_160 [Saccharum hybrid cultivar 
R570]
Length=431

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 56/94 (60%), Gaps = 5/94 (5%)
 Frame = +1

Query  103  PAKIVSPVAVQNGSESE-LPAGWIKEYKTRRLGHG--IRKDPYYTDPVSGYVFRSKKDAF  273
            PAK  + V  +N    E LP GW+KEY+ R+  +G  ++ D +Y DPV+GY F S KD  
Sbjct  18   PAKSAALVDGKNEPAGEGLPDGWLKEYRPRKNQYGSRVKGDTFYIDPVNGYKFHSLKDVH  77

Query  274  RYIETGDISKCAMKPTLREPGPTST--DLSYDTG  369
             Y+E+GDIS+C   P  R+ G   T  D S+ TG
Sbjct  78   FYLESGDISQCFRLPNKRKIGDLHTEGDQSHHTG  111



>ref|XP_002448522.1| hypothetical protein SORBIDRAFT_06g028360 [Sorghum bicolor]
 gb|EES12850.1| hypothetical protein SORBIDRAFT_06g028360 [Sorghum bicolor]
Length=431

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG--IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP GW+KEY+ R+  +G  ++ D +Y DP++GY F S KD  RY+E+GDI++C   P  R
Sbjct  36   LPDGWLKEYRPRKNLYGSRVKGDTFYIDPINGYKFHSLKDVHRYLESGDINQCFRLPNKR  95

Query  328  EPGPTST--DLSYDTG  369
            + G   T  D S+ TG
Sbjct  96   KIGDLHTEGDQSHHTG  111



>gb|EEC83090.1| hypothetical protein OsI_28224 [Oryza sativa Indica Group]
Length=676

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/101 (40%), Positives = 58/101 (57%), Gaps = 15/101 (15%)
 Frame = +1

Query  40   EKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDP  219
            E S E N  +S  +  +V ++   IV            LP GW KE + R+ G  ++ DP
Sbjct  85   ENSAEKN--VSNHKNELVQRKDDLIVDG----------LPDGWWKEDRPRKNGSNLKTDP  132

Query  220  YYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP---TLREP  333
            YY DPVSGY FRS KD  R++++GDI KC ++P   T+++P
Sbjct  133  YYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVRPRKRTIQDP  173


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = +1

Query  508  VDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRS  615
            VDGLP GW +E R RK G+  K+DP+Y+DPVSG+ FRS
Sbjct  108  VDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRS  145



>gb|EMS68477.1| hypothetical protein TRIUR3_20569 [Triticum urartu]
Length=619

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS  +FR+ K    Y++TG+IS+ A  P
Sbjct  241  LPKGWVKELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEISRHAYLP  295



>ref|XP_006664919.1| PREDICTED: uncharacterized protein LOC102722078, partial [Oryza 
brachyantha]
Length=249

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+  +G+RKDPYYTDPVS Y FR+++ A  Y++TG I K A 
Sbjct  179  LPKGWVKELVFRKTENGVRKDPYYTDPVSNYSFRTRRSAMLYVQTGKIPKRAF  231



>ref|XP_009390518.1| PREDICTED: uncharacterized protein LOC103976890 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=589

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTL  324
            +ELP GWIKE + R+   G    +  Y DP   Y FRS KDAFRYIETGD++KCA KP  
Sbjct  128  NELPHGWIKEIRFRKYKRGKPVNETLYIDPDGEYAFRSLKDAFRYIETGDVNKCASKPQK  187

Query  325  R  327
            R
Sbjct  188  R  188



>ref|XP_009390512.1| PREDICTED: uncharacterized protein LOC103976890 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=593

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +1

Query  70   SKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGY  246
            + + KS+ +     + S      GS +ELP GWIKE + R+   G    +  Y DP   Y
Sbjct  107  TSQEKSIKESSSNNVCSYAPTGYGS-NELPHGWIKEIRFRKYKRGKPVNETLYIDPDGEY  165

Query  247  VFRSKKDAFRYIETGDISKCAMKPTLR  327
             FRS KDAFRYIETGD++KCA KP  R
Sbjct  166  AFRSLKDAFRYIETGDVNKCASKPQKR  192



>ref|XP_009390529.1| PREDICTED: uncharacterized protein LOC103976890 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +1

Query  70   SKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGY  246
            + + KS+ +     + S      GS +ELP GWIKE + R+   G    +  Y DP   Y
Sbjct  107  TSQEKSIKESSSNNVCSYAPTGYGS-NELPHGWIKEIRFRKYKRGKPVNETLYIDPDGEY  165

Query  247  VFRSKKDAFRYIETGDISKCAMKPTLR  327
             FRS KDAFRYIETGD++KCA KP  R
Sbjct  166  AFRSLKDAFRYIETGDVNKCASKPQKR  192



>gb|EEE68228.1| hypothetical protein OsJ_26412 [Oryza sativa Japonica Group]
Length=899

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 12/96 (13%)
 Frame = +1

Query  40   EKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDP  219
            E S E N  +S  +  +V ++   IV            LP GW KE + R+ G  ++ DP
Sbjct  85   ENSAEKN--VSNHKNELVQRKDDLIVD----------GLPDGWWKEDRPRKNGSNLKTDP  132

Query  220  YYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            YY DPVSGY FRS KD  R++++GDI KC ++P  R
Sbjct  133  YYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVRPRKR  168


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = +1

Query  508  VDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRS  615
            VDGLP GW +E R RK G+  K+DP+Y+DPVSG+ FRS
Sbjct  108  VDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRS  145



>ref|XP_006353332.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006353333.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Solanum tuberosum]
Length=594

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +1

Query  46   SVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYY  225
            SV+ N   S   K +  K   K  +      G    LP GWIKE K RR G  IRKDPYY
Sbjct  52   SVDSNCSKSSNTKEMEKKGTEKCFTEKTASEG----LPPGWIKELKVRRKGRKIRKDPYY  107

Query  226  TDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
             DPVSG  FRS K   R++ET +  +    P  R P
Sbjct  108  IDPVSGQTFRSMKQVSRFLETREPGRFESTPDNRCP  143


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 65/156 (42%), Gaps = 50/156 (32%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            +P GW  E +TR+ G   +K+ +Y DP  G  F SK D   Y+ + D S C+     +E 
Sbjct  11   VPNGWKVEVRTRKKG---KKEKWYIDPSKGLKFCSKADVLHYLSSVD-SNCSKSSNTKEM  66

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
                T+  +                           +K+ S                  +
Sbjct  67   EKKGTEKCF--------------------------TEKTAS------------------E  82

Query  514  GLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            GLPPGW +E + R+ G K   DP+Y+DPVSG  FRS
Sbjct  83   GLPPGWIKELKVRRKGRKIRKDPYYIDPVSGQTFRS  118



>ref|XP_010521336.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010521337.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010521338.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Tarenaya hassleriana]
Length=713

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V ++  +   LP GWIKE   RR    +RKDP + DP SGY+F S KDA RY+ TG I  
Sbjct  29   VIIERSAAEGLPEGWIKELMIRRKARKLRKDPLFIDPKSGYIFLSFKDASRYVRTGVIGN  88

Query  304  CAMKP  318
             A KP
Sbjct  89   HARKP  93



>ref|XP_002447565.1| hypothetical protein SORBIDRAFT_06g004050 [Sorghum bicolor]
 gb|EES11893.1| hypothetical protein SORBIDRAFT_06g004050 [Sorghum bicolor]
Length=295

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R+   GIRKDPYYTDPVS  VFR+ K    Y+ TG+ISK +  P
Sbjct  30   LPDGWVKETIFRKCNDGIRKDPYYTDPVSRRVFRTLKSVLSYLGTGEISKHSYLP  84



>ref|XP_010444604.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Camelina sativa]
Length=697

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+ + T R G  IR+DP++ DP SGY+F+S KDA RY++TGDI 
Sbjct  25   VIVEKSAAKGLPEGWIKKLEITNRSGRKIRRDPFFIDPKSGYIFQSFKDASRYVKTGDIG  84

Query  301  KCAMK  315
              A K
Sbjct  85   HYARK  89



>ref|XP_004234378.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Solanum lycopersicum]
Length=587

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 69/158 (44%), Gaps = 6/158 (4%)
 Frame = +1

Query  46   SVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYY  225
            SV+ N   S   K + +K   K      ++  +   LP GWIKE K R+ G  IRKDPYY
Sbjct  51   SVDSNCSKSSNTKEMENKGTNKCF----IEKTASEGLPPGWIKELKVRKKGRKIRKDPYY  106

Query  226  TDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknk  405
             DPVSG  FRS K   R++ET +  +   KP   +  P + +L   +     +     + 
Sbjct  107  IDPVSGQTFRSLKQVSRFLETREPGRFESKPD--DKCPDTLELEEPSSLFPAEADEQISL  164

Query  406  kpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVDGL  519
                  + V   QK   G       S  EG   S +GL
Sbjct  165  DCDASCKEVNSNQKLKLGAEHMAHSSCVEGSMSSCEGL  202


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 64/156 (41%), Gaps = 51/156 (33%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            +P GW  E +TR+     +K+ +Y DP  G  F SK D   Y+ + D S C+     +E 
Sbjct  11   VPDGWKVEVRTRKG----KKEKWYIDPSKGLKFCSKADVLHYLSSVD-SNCSKSSNTKEM  65

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
                T+  +                           +K+ S                  +
Sbjct  66   ENKGTNKCF--------------------------IEKTAS------------------E  81

Query  514  GLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            GLPPGW +E + RK G K   DP+Y+DPVSG  FRS
Sbjct  82   GLPPGWIKELKVRKKGRKIRKDPYYIDPVSGQTFRS  117



>ref|XP_010444597.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Camelina sativa]
Length=701

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+ + T R G  IR+DP++ DP SGY+F+S KDA RY++TGDI 
Sbjct  25   VIVEKSAAKGLPEGWIKKLEITNRSGRKIRRDPFFIDPKSGYIFQSFKDASRYVKTGDIG  84

Query  301  KCAMK  315
              A K
Sbjct  85   HYARK  89



>ref|XP_010317585.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010317586.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010317587.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Solanum lycopersicum]
Length=523

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 56/122 (46%), Gaps = 2/122 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GWIKE K R+ G  IRKDPYY DPVSG  FRS K   R++ET +  +   KP   + 
Sbjct  19   LPPGWIKELKVRKKGRKIRKDPYYIDPVSGQTFRSLKQVSRFLETREPGRFESKPD--DK  76

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
             P + +L   +     +     +       + V   QK   G       S  EG   S +
Sbjct  77   CPDTLELEEPSSLFPAEADEQISLDCDASCKEVNSNQKLKLGAEHMAHSSCVEGSMSSCE  136

Query  514  GL  519
            GL
Sbjct  137  GL  138


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = +1

Query  511  DGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
            +GLPPGW +E + RK G K   DP+Y+DPVSG  FRS
Sbjct  17   EGLPPGWIKELKVRKKGRKIRKDPYYIDPVSGQTFRS  53



>ref|XP_011076193.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Sesamum indicum]
 ref|XP_011076194.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Sesamum indicum]
Length=654

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  97   KRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFR  276
            ++P  + + V ++     +LP GWIKE +T + G   R+DPYY DPV+G  FRS ++ FR
Sbjct  55   RKPRALNNKVEIRKTVADKLPPGWIKEIRTTKKGRKTRRDPYYIDPVTGRYFRSMQEVFR  114

Query  277  YIETGDISKCAMK  315
            Y+E+ D  K   K
Sbjct  115  YLESKDSGKAEFK  127


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 59/156 (38%), Gaps = 58/156 (37%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW    K R  G   RKD YY +P +G  F SK +  RY                  
Sbjct  9    LPVGWRVSVKVRSCG---RKDKYYVNPSNGLKFNSKPEVLRY------------------  47

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
                  L Y                             S  G++P  + +  E +    D
Sbjct  48   ------LKY-----------------------------SAKGRKPRALNNKVEIRKTVAD  72

Query  514  GLPPGWTREFRARKCG--TKSDPFYVDPVSGFGFRS  615
             LPPGW +E R  K G  T+ DP+Y+DPV+G  FRS
Sbjct  73   KLPPGWIKEIRTTKKGRKTRRDPYYIDPVTGRYFRS  108



>gb|EYU25079.1| hypothetical protein MIMGU_mgv11b021680mg [Erythranthe guttata]
Length=330

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +1

Query  118  SPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            S + ++      LP GWIKE +T++ G   R+DP Y DPVSG  FRS ++ FRY+E+ D+
Sbjct  122  SKIKIEKTVTENLPPGWIKEIRTKKKGGRTRRDPCYIDPVSGRHFRSMQEVFRYLESKDV  181

Query  298  SKCAMKP  318
             K   KP
Sbjct  182  RKAESKP  188


 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/168 (29%), Positives = 68/168 (40%), Gaps = 61/168 (36%)
 Frame = +1

Query  124  VAVQNGSESE--LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            + ++ G ES   LP GW    K R  G   +KD YY +P +G  F SK +  RY+     
Sbjct  58   IFIEMGGESLDWLPVGWRVSVKVRNSG---KKDKYYVNPSNGRRFNSKPEVLRYV-----  109

Query  298  SKCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKV  477
                 K +++ P P                                        K P+K+
Sbjct  110  -----KSSVKNPNP----------------------------------------KEPSKI  124

Query  478  VSNAEGQTESVDGLPPGWTREFRARKCG--TKSDPFYVDPVSGFGFRS  615
                + +    + LPPGW +E R +K G  T+ DP Y+DPVSG  FRS
Sbjct  125  ----KIEKTVTENLPPGWIKEIRTKKKGGRTRRDPCYIDPVSGRHFRS  168



>ref|XP_010676506.1| PREDICTED: uncharacterized protein LOC104892309 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1022

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 8/88 (9%)
 Frame = +1

Query  61   SQISKRR--KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTD  231
            SQISK R  KS+  ++P      V  +  ++ ELP+GWIKE + + L + + R+D +Y+D
Sbjct  173  SQISKSRVRKSISSEKPK-----VVTERTADEELPSGWIKETRIKMLDNKVVRRDSFYSD  227

Query  232  PVSGYVFRSKKDAFRYIETGDISKCAMK  315
            P S  VF SK +  RY+ETG++S+ A +
Sbjct  228  PASRLVFCSKLEVLRYVETGEVSRHAFR  255



>ref|XP_010676507.1| PREDICTED: uncharacterized protein LOC104892309 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1021

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 8/88 (9%)
 Frame = +1

Query  61   SQISKRR--KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTD  231
            SQISK R  KS+  ++P      V  +  ++ ELP+GWIKE + + L + + R+D +Y+D
Sbjct  172  SQISKSRVRKSISSEKPK-----VVTERTADEELPSGWIKETRIKMLDNKVVRRDSFYSD  226

Query  232  PVSGYVFRSKKDAFRYIETGDISKCAMK  315
            P S  VF SK +  RY+ETG++S+ A +
Sbjct  227  PASRLVFCSKLEVLRYVETGEVSRHAFR  254



>ref|XP_010676508.1| PREDICTED: uncharacterized protein LOC104892309 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=942

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 8/88 (9%)
 Frame = +1

Query  61   SQISKRR--KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTD  231
            SQISK R  KS+  ++P      V  +  ++ ELP+GWIKE + + L + + R+D +Y+D
Sbjct  173  SQISKSRVRKSISSEKPK-----VVTERTADEELPSGWIKETRIKMLDNKVVRRDSFYSD  227

Query  232  PVSGYVFRSKKDAFRYIETGDISKCAMK  315
            P S  VF SK +  RY+ETG++S+ A +
Sbjct  228  PASRLVFCSKLEVLRYVETGEVSRHAFR  255



>ref|XP_010482573.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Camelina sativa]
Length=804

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+ + T R    IR+DP++ DP SGY+F+S KDA RY+ETGDI 
Sbjct  25   VIVEKSAAKGLPEGWIKKLEITNRSSRKIRRDPFFIDPKSGYIFQSFKDASRYVETGDIG  84

Query  301  KCAMK  315
              A K
Sbjct  85   HYARK  89



>ref|XP_010482572.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Camelina sativa]
Length=808

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+ + T R    IR+DP++ DP SGY+F+S KDA RY+ETGDI 
Sbjct  25   VIVEKSAAKGLPEGWIKKLEITNRSSRKIRRDPFFIDPKSGYIFQSFKDASRYVETGDIG  84

Query  301  KCAMK  315
              A K
Sbjct  85   HYARK  89



>ref|XP_011084407.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
[Sesamum indicum]
Length=523

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  109  KIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET  288
            K ++ + ++     +LP GWIKE +T+R G   R+DPYY DPVSG  FRS ++ FR++E+
Sbjct  58   KQLNEIGIKKTVAEKLPPGWIKEIRTKRKGGKTRRDPYYIDPVSGRHFRSMQEVFRFLES  117

Query  289  GDISK  303
             D  K
Sbjct  118  TDSGK  122



>ref|XP_004977782.1| PREDICTED: uncharacterized protein LOC101761695 [Setaria italica]
Length=511

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE   R    GIRKDPYYTDP+S  VFR+ K    Y+ TG+ISK A  P
Sbjct  238  LPDGWVKETIFRNCNDGIRKDPYYTDPISRRVFRTLKSVLSYLGTGEISKHAYLP  292



>ref|XP_006279588.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
 gb|EOA12486.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
Length=659

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            V V+  +   LP GWIK+ + + R G  +R+DP++ DP SGY+F S KDA RY+ETGDI
Sbjct  24   VIVEKSAAKGLPEGWIKKLEISNRSGRKLRRDPFFIDPKSGYIFHSFKDASRYVETGDI  82



>ref|XP_006279589.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
 gb|EOA12487.1| hypothetical protein CARUB_v10026033mg [Capsella rubella]
Length=667

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            V V+  +   LP GWIK+ + + R G  +R+DP++ DP SGY+F S KDA RY+ETGDI
Sbjct  24   VIVEKSAAKGLPEGWIKKLEISNRSGRKLRRDPFFIDPKSGYIFHSFKDASRYVETGDI  82



>gb|KFK26832.1| hypothetical protein AALP_AA8G299600 [Arabis alpina]
Length=702

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+ + T R G  IR+DP++ DP SGY+F+S +DA RY+ETG I 
Sbjct  24   VIVEQSAAEGLPEGWIKKLELTIRTGRKIRRDPFFIDPKSGYIFQSFRDASRYVETGRIG  83

Query  301  KCAMK  315
              A K
Sbjct  84   NYARK  88



>ref|NP_001105290.1| LOC542207 [Zea mays]
 gb|AAW56446.1| methyl-binding domain protein MBD113 [Zea mays]
 gb|AFW57949.1| methyl-binding domain MBD113 protein [Zea mays]
Length=292

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE  +R+   GIRKD YYTDPVS  VFR+ K    Y+ TG+IS+ +  P
Sbjct  30   LPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLP  84



>ref|XP_006652812.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006652813.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X2 [Oryza brachyantha]
Length=393

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG--IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPT  321
            LP GW+K Y+ R+   G  I+ D +Y DP + Y FRS KD  RY+E+GD+S C M P 
Sbjct  35   LPPGWLKAYRPRKSQSGSKIKGDTFYIDPTNMYEFRSLKDVHRYLESGDVSNCVMIPN  92



>ref|XP_006652814.1| PREDICTED: methyl-CpG-binding domain-containing protein 13-like 
isoform X3 [Oryza brachyantha]
Length=365

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG--IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPT  321
            LP GW+K Y+ R+   G  I+ D +Y DP + Y FRS KD  RY+E+GD+S C M P 
Sbjct  35   LPPGWLKAYRPRKSQSGSKIKGDTFYIDPTNMYEFRSLKDVHRYLESGDVSNCVMIPN  92



>ref|XP_003572272.2| PREDICTED: uncharacterized protein LOC100826562 [Brachypodium 
distachyon]
Length=328

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            LP GW+KE   R+   GIRKDPY+TDPV+ YVFR+ K A  Y+ TG I+
Sbjct  183  LPEGWVKEIVYRKTKEGIRKDPYFTDPVNHYVFRTLKAAMTYLSTGKIT  231



>emb|CBI34714.3| unnamed protein product [Vitis vinifera]
Length=936

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +1

Query  199  HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            +GIR+DPYYTDPVSGYVFRS+KD FRY++TG+IS+
Sbjct  4    NGIRRDPYYTDPVSGYVFRSRKDVFRYLKTGEISR  38



>ref|XP_008234128.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X1 [Prunus mume]
Length=547

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = +1

Query  55   DNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDP  234
            + SQIS   K  V++   +  + V V+      LP GWIKE +  +  H IR+D YY DP
Sbjct  50   NTSQISDEVKQKVEETLKRSANDVVVEKTIAGGLPQGWIKEIRMTKKDHKIRRDSYYIDP  109

Query  235  VSGYVFRSKKDAFRYIETGDISKCAMKPT  321
            VS  +FRS KD  RY+E     +  ++P+
Sbjct  110  VSEKLFRSMKDVNRYLENEKPRRLILEPS  138


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 65/163 (40%), Gaps = 56/163 (34%)
 Frame = +1

Query  142  SESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS---KCAM  312
            SE  LP GW  E K R  G   ++D YY D  SG+ F SK +  RY+ T  IS   K  +
Sbjct  6    SEDWLPTGWTVEVKVRNNG---KRDKYYYDSASGHKFNSKAEVSRYLNTSQISDEVKQKV  62

Query  313  KPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAE  492
            + TL+    ++ D+                         V +K  +G             
Sbjct  63   EETLKR---SANDV-------------------------VVEKTIAG-------------  81

Query  493  GQTESVDGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
                   GLP GW +E R  K   K   D +Y+DPVS   FRS
Sbjct  82   -------GLPQGWIKEIRMTKKDHKIRRDSYYIDPVSEKLFRS  117



>gb|AFW57951.1| methyl-binding domain MBD113 protein [Zea mays]
Length=482

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE  +R+   GIRKD YYTDPVS  VFR+ K    Y+ TG+IS+ +  P
Sbjct  220  LPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLP  274



>gb|EEC77988.1| hypothetical protein OsI_17375 [Oryza sativa Indica Group]
Length=394

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG--IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KEY+ R+   G  ++ D +Y DP + Y FRS+KD  RY+E+GD++ C M
Sbjct  35   LPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYLESGDVTNCVM  89



>ref|XP_004982529.1| PREDICTED: uncharacterized protein LOC101763097 [Setaria italica]
Length=338

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            +A+ +   S LP GW+KE   R+   G IR+DPYYTDP S Y FR+ K A  ++ETG IS
Sbjct  160  LAIVDFHPSGLPEGWVKELVFRKTKEGLIRRDPYYTDPASSYTFRTLKSALCFVETGKIS  219

Query  301  KCAM  312
            K A 
Sbjct  220  KRAF  223



>ref|XP_008662320.1| PREDICTED: LOC542207 isoform X3 [Zea mays]
 gb|AFW57952.1| methyl-binding domain MBD113 protein isoform 1 [Zea mays]
 gb|AFW57953.1| methyl-binding domain MBD113 protein isoform 2 [Zea mays]
Length=491

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE  +R+   GIRKD YYTDPVS  VFR+ K    Y+ TG+IS+ +  P
Sbjct  229  LPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLP  283



>gb|AFW57954.1| methyl-binding domain MBD113 protein [Zea mays]
Length=485

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE  +R+   GIRKD YYTDPVS  VFR+ K    Y+ TG+IS+ +  P
Sbjct  223  LPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLP  277



>ref|NP_001053858.1| Os04g0613800 [Oryza sativa Japonica Group]
 dbj|BAF15772.1| Os04g0613800 [Oryza sativa Japonica Group]
 dbj|BAG91729.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92796.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67422.1| hypothetical protein OsJ_24762 [Oryza sativa Japonica Group]
Length=394

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG--IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KEY+ R+   G  ++ D +Y DP + Y FRS+KD  RY+E+GD++ C M
Sbjct  35   LPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYLESGDVTNCVM  89



>ref|XP_008662316.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
 ref|XP_008662317.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
 ref|XP_008662318.1| PREDICTED: LOC542207 isoform X1 [Zea mays]
Length=506

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE  +R+   GIRKD YYTDPVS  VFR+ K    Y+ TG+IS+ +  P
Sbjct  244  LPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLP  298



>ref|NP_001159179.1| uncharacterized protein LOC100304264 [Zea mays]
 gb|ACN25334.1| unknown [Zea mays]
Length=397

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE  +R+   GIRKD YYTDPVS  VFR+ K    Y+ TG+IS+ +  P
Sbjct  135  LPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLP  189



>ref|XP_008662319.1| PREDICTED: LOC542207 isoform X2 [Zea mays]
Length=497

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KE  +R+   GIRKD YYTDPVS  VFR+ K    Y+ TG+IS+ +  P
Sbjct  235  LPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLP  289



>gb|EMT21477.1| hypothetical protein F775_23896 [Aegilops tauschii]
Length=424

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            S LP GW+KE   R+   G RKDPYYTDPVS Y FR+     R+++TG+I+K
Sbjct  252  SGLPDGWVKEMVYRKTLKGTRKDPYYTDPVSSYAFRTLTSVVRFLQTGNITK  303


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 67/178 (38%), Gaps = 27/178 (15%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAF---------RYIETGDISKC  306
            LP GWI E +    G   +   Y+  PVSG  FR K +            Y+E  D    
Sbjct  114  LPDGWIMEVQRGDNGTLYK---YFISPVSGAKFRMKSEVLNYLFSEMDEHYLEAKDSVDH  170

Query  307  AMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKK------------QKS  450
             M P   E  P    L    G  +          P    R  +K+            +  
Sbjct  171  KMLPKSHEWLPKGWLLEIRAGGENMDKMYKFYVYPALGIRAFSKEDVLLYVNEMKIPECD  230

Query  451  GSGKRPAKVVSNAEGQTE-SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRS  615
             +GK       N   + E +  GLP GW +E   RK   GT+ DP+Y DPVS + FR+
Sbjct  231  TNGKCDTSSRDNILAEVEFNPSGLPDGWVKEMVYRKTLKGTRKDPYYTDPVSSYAFRT  288



>emb|CAE05215.3| OSJNBa0070C17.22 [Oryza sativa Japonica Group]
Length=438

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG--IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KEY+ R+   G  ++ D +Y DP + Y FRS+KD  RY+E+GD++ C M
Sbjct  35   LPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYLESGDVTNCVM  89



>ref|XP_009418271.1| PREDICTED: uncharacterized protein LOC103998509 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=223

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG---IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTL  324
            LP GWIKE K RR        ++D YYTDP SGYVFR+ KD   YIE G +SK A KP +
Sbjct  117  LPDGWIKEIKFRRNKDKKSPTKQDAYYTDPESGYVFRTLKDCICYIEHGVLSKHAFKPNI  176



>ref|NP_200036.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 ref|NP_001190520.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 sp|Q9LTJ8.1|MBD13_ARATH RecName: Full=Methyl-CpG-binding domain-containing protein 13; 
Short=AtMBD13; Short=MBD13; AltName: Full=Methyl-CpG-binding 
protein MBD13 [Arabidopsis thaliana]
 dbj|BAA97466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96188.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
 gb|AED96189.1| methyl-CPG-binding domain protein 13 [Arabidopsis thaliana]
Length=746

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+ + T R G   R+DP++ DP S Y+F+S KDA RY+ETG+I 
Sbjct  29   VIVEKSAAQGLPEGWIKKLEITNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNIG  88

Query  301  KCAMK  315
              A K
Sbjct  89   HYARK  93



>gb|AAM97069.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15545.1| unknown protein [Arabidopsis thaliana]
Length=746

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+ + T R G   R+DP++ DP S Y+F+S KDA RY+ETG+I 
Sbjct  29   VIVEKSAAQGLPEGWIKKLEITNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNIG  88

Query  301  KCAMK  315
              A K
Sbjct  89   HYARK  93



>ref|XP_010107428.1| Methyl-CpG-binding domain-containing protein 13 [Morus notabilis]
 gb|EXC15966.1| Methyl-CpG-binding domain-containing protein 13 [Morus notabilis]
Length=574

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            V V+ G    LP GWIKE + R+ G  IRKDP+Y DPVS  VFRS K   R+++T ++
Sbjct  29   VVVEKGEAEGLPPGWIKEIRVRKRGDSIRKDPFYFDPVSKNVFRSLKAVNRHLKTEEL  86



>ref|XP_009418270.1| PREDICTED: uncharacterized protein LOC103998509 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=268

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 3/60 (5%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG---IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTL  324
            LP GWIKE K RR        ++D YYTDP SGYVFR+ KD   YIE G +SK A KP +
Sbjct  162  LPDGWIKEIKFRRNKDKKSPTKQDAYYTDPESGYVFRTLKDCICYIEHGVLSKHAFKPNI  221



>ref|XP_008665005.1| PREDICTED: uncharacterized protein LOC103643620 [Zea mays]
Length=343

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+   G IR+DPYYTDP S Y FR+ K A  ++ETG +S+ A 
Sbjct  177  LPEGWVKELVYRKTKEGLIRRDPYYTDPASSYTFRTLKSALSFLETGKVSERAF  230



>ref|XP_007152298.1| hypothetical protein PHAVU_004G117900g [Phaseolus vulgaris]
 gb|ESW24292.1| hypothetical protein PHAVU_004G117900g [Phaseolus vulgaris]
Length=579

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = +1

Query  109  KIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET  288
            KI   V V+      LP GW+K+ +    G  +R+D YY DPVSGY F S +D   Y+E+
Sbjct  60   KISPNVVVEKAIAEGLPPGWVKKTRIATKGDTVRRDTYYIDPVSGYAFHSIEDVDHYLES  119

Query  289  GDISKCAMKP  318
            G++ +  +KP
Sbjct  120  GEVGRNTLKP  129



>ref|XP_006653233.1| PREDICTED: uncharacterized protein LOC102703961 [Oryza brachyantha]
Length=280

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+    +RKDPYYTDPVS Y FR+++ A  +++TG + + A 
Sbjct  179  LPKGWVKELVFRKTKDAVRKDPYYTDPVSNYSFRTRRSAMLFVQTGKVPRRAF  231



>tpg|DAA59672.1| TPA: hypothetical protein ZEAMMB73_581852 [Zea mays]
Length=393

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            S LP GW+KE   R+   G I++DPYYTDP S Y FR+ K A  ++ETG +S+ A 
Sbjct  245  SGLPEGWVKELVYRKTMEGLIKRDPYYTDPASSYTFRTLKSALSFLETGKVSERAF  300



>ref|XP_002865903.1| hypothetical protein ARALYDRAFT_495292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42162.1| hypothetical protein ARALYDRAFT_495292 [Arabidopsis lyrata subsp. 
lyrata]
Length=680

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+ + T R G   R+DP++ DP S Y+F+S KDA RY+ETG++ 
Sbjct  31   VIVEKSAAQGLPEGWIKKLEITSRSGRKNRRDPFFIDPKSEYIFQSFKDASRYVETGNVG  90

Query  301  KCAMK  315
              A K
Sbjct  91   HYARK  95



>gb|AFW80349.1| hypothetical protein ZEAMMB73_827373 [Zea mays]
Length=407

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            S LP GW+KE   R+   G I++DPYYTDP S Y FR+ K A  ++ETG +S+ A 
Sbjct  259  SGLPEGWVKELVYRKTMEGLIKRDPYYTDPASSYTFRTLKSALSFLETGKVSERAF  314



>gb|EAZ30036.1| hypothetical protein OsJ_14093 [Oryza sativa Japonica Group]
Length=319

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+   G IRKDPY+TDPV+ Y FR++K A  Y++TG + K A 
Sbjct  133  LPEGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPKRAF  186



>ref|XP_008439211.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X4 [Cucumis melo]
Length=165

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+     +LP GWI E +  +  + IR+D  Y DP++G+  RS +D  RY+ +G +S+
Sbjct  83   VEVKKTIAKDLPTGWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSR  142

Query  304  CAMKPTLREPGPTSTDLSYD  363
             A K   R    ++ DL +D
Sbjct  143  LAHKS--RNQRDSTIDLQHD  160


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/167 (26%), Positives = 64/167 (38%), Gaps = 44/167 (26%)
 Frame = +1

Query  127  AVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS--  300
             +   S+  LP GW  + K R+ G   +KD YY +P S   F S+ + FRY++T  I   
Sbjct  1    MMNQNSKDLLPPGWTVKVKVRKSG---KKDKYYFEPSSQMRFNSRAEVFRYLKTAAICHP  57

Query  301  KCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVV  480
            +     T++EPG                              +V +K    +        
Sbjct  58   ESEESRTIKEPG-----------------------------NNVCQKNLPST--------  80

Query  481  SNAEGQTESVDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRS  615
             N E +      LP GW  E R  K     + D  Y+DP++G   RS
Sbjct  81   YNVEVKKTIAKDLPTGWIGEIRETKTANRIRRDSSYIDPINGHALRS  127



>ref|XP_008674081.1| PREDICTED: uncharacterized protein LOC103650258 [Zea mays]
Length=182

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            S LP GW+KE   R+   G I++DPYYTDP S Y FR+ K A  ++ETG +S+
Sbjct  67   SGLPEGWVKELVYRKTKEGLIKRDPYYTDPASFYTFRTLKSALSFLETGKVSE  119



>ref|XP_010089149.1| hypothetical protein L484_024324 [Morus notabilis]
 gb|EXB37396.1| hypothetical protein L484_024324 [Morus notabilis]
Length=676

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = +1

Query  220  YYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGPTSTDLSYD  363
            +Y DPVSGYVFRSK+DA RYIETG+IS+ A++P  +E G  + +L  D
Sbjct  5    FYKDPVSGYVFRSKRDALRYIETGEISRSAIRP--KESGSNAPELVKD  50



>emb|CAD39866.2| OSJNBb0058J09.3 [Oryza sativa Japonica Group]
Length=385

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+   G IRKDPY+TDPV+ Y FR++K A  Y++TG + K A 
Sbjct  199  LPEGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPKRAF  252



>ref|XP_003580540.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240414.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240415.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240416.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
 ref|XP_010240417.1| PREDICTED: uncharacterized protein LOC100838054 [Brachypodium 
distachyon]
Length=400

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +1

Query  154  LPAGWIKEYKTR--RLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLR  327
            LP GW K  + R  R G  IR D +Y DP + Y FRS KD +RYIE+ DIS C + P  R
Sbjct  32   LPDGWSKGCRPRKSRPGSRIRGDKFYIDPTNSYEFRSLKDVYRYIESQDISNCVVTPIKR  91

Query  328  E  330
            +
Sbjct  92   K  92



>emb|CAH67925.1| OSIGBa0138E08-OSIGBa0161L23.6 [Oryza sativa Indica Group]
Length=383

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+   G IRKDPY+TDPV+ Y FR++K A  Y++TG + K A 
Sbjct  199  LPEGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPKRAF  252



>gb|EAY93364.1| hypothetical protein OsI_15161 [Oryza sativa Indica Group]
Length=316

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+   G IRKDPY+TDPV+ Y FR++K A  Y++TG + K A 
Sbjct  199  LPEGWVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPKRAF  252



>ref|XP_008439210.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X3 [Cucumis melo]
Length=201

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+     +LP GWI E +  +  + IR+D  Y DP++G+  RS +D  RY+ +G +S+
Sbjct  72   VEVKKTIAKDLPTGWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSR  131

Query  304  CAMKPTLREPGPTSTDLSYD  363
             A K   R    ++ DL +D
Sbjct  132  LAHKS--RNQRDSTIDLQHD  149



>ref|XP_008439209.1| PREDICTED: methyl-CpG-binding domain-containing protein 7 isoform 
X2 [Cucumis melo]
Length=212

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+     +LP GWI E +  +  + IR+D  Y DP++G+  RS +D  RY+ +G +S+
Sbjct  83   VEVKKTIAKDLPTGWIGEIRETKTANRIRRDSSYIDPINGHALRSIRDVHRYLTSGKVSR  142

Query  304  CAMKPTLREPGPTSTDLSYD  363
             A K   R    ++ DL +D
Sbjct  143  LAHKS--RNQRDSTIDLQHD  160



>tpg|DAA50117.1| TPA: hypothetical protein ZEAMMB73_042225 [Zea mays]
Length=320

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETG  291
            S LP GW+KE   R+   G IR+DPYYTDP S Y FR+ K A  ++ETG
Sbjct  176  SGLPEGWVKELVYRKTKEGLIRRDPYYTDPASSYTFRTLKSALSFLETG  224



>ref|XP_002461981.1| hypothetical protein SORBIDRAFT_02g011480 [Sorghum bicolor]
 gb|EER98502.1| hypothetical protein SORBIDRAFT_02g011480 [Sorghum bicolor]
Length=249

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETG  291
            S LP GWIKE   R+   G+ R+DPYYTDP S Y FR+ K A  ++ETG
Sbjct  135  SGLPEGWIKEIVYRKTKEGLTRRDPYYTDPASSYTFRTLKSALSFLETG  183



>ref|XP_006401848.1| hypothetical protein EUTSA_v10012954mg [Eutrema salsugineum]
 gb|ESQ43301.1| hypothetical protein EUTSA_v10012954mg [Eutrema salsugineum]
Length=633

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            V V+  +   LP GWIK+   + R G   R+DP++ DP S Y+F+S KDA RY ETGD+ 
Sbjct  29   VIVEKSTAEGLPEGWIKKLVISNRPGRKSRRDPFFIDPKSEYIFQSFKDASRYAETGDLG  88

Query  301  KCAMK  315
              A K
Sbjct  89   NYARK  93



>ref|XP_008796743.1| PREDICTED: uncharacterized protein LOC103712110 isoform X8 [Phoenix 
dactylifera]
Length=600

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 64/146 (44%), Gaps = 33/146 (23%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E+KTR+ G H  R+   Y DPV+G+ F SK +  RYI+ G     +  P  + 
Sbjct  40   LPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG----MSCNPRAKR  95

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTE-S  507
                 T ++ +                       +  Q+ G  +     + N   Q E +
Sbjct  96   KRSVVTKVTENACS--------------------STSQRKGIKR---STMENVRSQIEYT  132

Query  508  VDGLPPGWTREFRARK----CGTKSD  573
             DGLP GW +E R RK    CG K D
Sbjct  133  PDGLPSGWIKEIRYRKTSSRCGAKRD  158



>ref|XP_002466891.1| hypothetical protein SORBIDRAFT_01g015940 [Sorghum bicolor]
 gb|EER93889.1| hypothetical protein SORBIDRAFT_01g015940 [Sorghum bicolor]
Length=219

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 4/63 (6%)
 Frame = +1

Query  106  AKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYI  282
            AKI++ V ++    S LP GW+ E   R+   G+ R+DPYYTDP S Y FR+ K A  ++
Sbjct  104  AKILAKVDIR---PSGLPEGWVNEIVYRKTKEGLTRRDPYYTDPASSYTFRTLKSALSFL  160

Query  283  ETG  291
            ETG
Sbjct  161  ETG  163



>gb|ABO69709.1| MBD3 [Triticum aestivum]
Length=180

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +1

Query  154  LPAGWIKEYKTR--RLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LP GW+KEY+ R  R G   R+D +Y DP + Y FRS K+A  Y+E+ D S   + P
Sbjct  13   LPDGWLKEYRPRKPRPGSRFRRDKFYIDPTNSYEFRSLKEAHHYLESQDTSDSVVTP  69



>ref|XP_002444304.1| hypothetical protein SORBIDRAFT_07g019900 [Sorghum bicolor]
 gb|EES13799.1| hypothetical protein SORBIDRAFT_07g019900 [Sorghum bicolor]
Length=317

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            S LP GW+KE   R+   G IRKD YYTDP S Y FR+ K A  ++ETG I + A 
Sbjct  174  SGLPEGWVKELVYRKTKEGLIRKDRYYTDPASSYTFRTLKSALSFLETGKIPRRAF  229



>ref|XP_008796742.1| PREDICTED: uncharacterized protein LOC103712110 isoform X7 [Phoenix 
dactylifera]
Length=644

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 61/150 (41%), Gaps = 40/150 (27%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLG-HGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLRE  330
            LPAGW+ E+KTR+ G H  R+   Y DPV+G+ F SK +  RYI+ G     +  P  + 
Sbjct  83   LPAGWVLEFKTRKSGTHAGRQYKCYIDPVTGFRFYSKNEVLRYIKDG----MSCNPRAKR  138

Query  331  PGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESV  510
                 T                           V +   S + +R     S  E Q  S 
Sbjct  139  KRSVVT--------------------------KVTENACSSTSQRKGIKRSTMENQVRSQ  172

Query  511  -----DGLPPGWTREFRARK----CGTKSD  573
                 DGLP GW +E R RK    CG K D
Sbjct  173  IEYTPDGLPSGWIKEIRYRKTSSRCGAKRD  202



>ref|XP_002466890.1| hypothetical protein SORBIDRAFT_01g015930 [Sorghum bicolor]
 gb|EER93888.1| hypothetical protein SORBIDRAFT_01g015930 [Sorghum bicolor]
Length=278

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETG  291
            S LP GW+KE   R+   G+ R+DPYYTDP S Y FR+ K A  ++ETG
Sbjct  174  SGLPEGWVKEIVYRKTKDGLTRRDPYYTDPASSYTFRTLKSALSFLETG  222



>ref|XP_002448792.1| hypothetical protein SORBIDRAFT_06g033275 [Sorghum bicolor]
 gb|EES13120.1| hypothetical protein SORBIDRAFT_06g033275 [Sorghum bicolor]
Length=301

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            +A  + + S LP GW+KE   ++  +GIR D Y+TDPV+  VFRS K A +Y +  +I  
Sbjct  198  IAQLDFNVSSLPPGWVKETTFKKCSYGIRTDRYFTDPVTKKVFRSMKAAEQYFKYKEIMD  257

Query  304  CAMKPTL  324
            C  KPT+
Sbjct  258  C-YKPTM  263



>gb|EMT08445.1| hypothetical protein F775_07512 [Aegilops tauschii]
Length=247

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            LP GW+KE   R+    IRKD Y+TDPVS  VFRS   A  YI TG++ K A+
Sbjct  171  LPQGWVKEVVYRKSEERIRKDSYFTDPVSHKVFRSLNYATHYINTGEVKKHAL  223



>ref|XP_010693525.1| PREDICTED: uncharacterized protein LOC104906467 [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = +1

Query  142  SESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            SE  LP GW  E + R+ G   +KD YYTDPV+GY+FRS KD  RY+ +G + K
Sbjct  7    SEEWLPEGWKIEIRVRKSG---KKDRYYTDPVNGYIFRSLKDIDRYLLSGKLGK  57



>emb|CAH67758.1| H0124E07.5 [Oryza sativa Indica Group]
Length=332

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            +A+   +   LP GW+KE   R+   G IR+D +YTDP+  YVFR+K+ A  Y+ETG ++
Sbjct  161  LAILEFNPEGLPQGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFRTKRSAALYVETGKVT  220



>ref|XP_002444202.1| hypothetical protein SORBIDRAFT_07g014920 [Sorghum bicolor]
 gb|EES13697.1| hypothetical protein SORBIDRAFT_07g014920 [Sorghum bicolor]
Length=317

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +1

Query  148  SELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            S LP GW+KE   R+   G+ RKD Y+TDP S Y FR+ K A  ++ETG I + A 
Sbjct  174  SGLPEGWVKELVFRKTKEGLMRKDRYFTDPASSYTFRTLKSALSFLETGKIPRRAF  229



>emb|CAE04540.2| OSJNBa0040D17.8 [Oryza sativa Japonica Group]
Length=377

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            +A+   +   LP GW+KE   R+   G IR+D +YTDP+  YVFR+K+ A  Y+ETG ++
Sbjct  138  LAILEFNPEGLPQGWVKEVVFRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKVT  197



>gb|EAZ29862.1| hypothetical protein OsJ_13921 [Oryza sativa Japonica Group]
Length=411

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 1/60 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            +A+   +   LP GW+KE   R+   G IR+D +YTDP+  YVFR+K+ A  Y+ETG ++
Sbjct  172  LAILEFNPEGLPQGWVKEVVFRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKVT  231



>gb|KHN28399.1| Methyl-CpG-binding domain-containing protein 13, partial [Glycine 
soja]
Length=612

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +1

Query  85   SVVDKRPAKIVSP-VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            +V +K   + +SP + V+      LP GW+K+ +    G  +R+D +Y DPV+GY F S 
Sbjct  88   NVQNKVSIQKISPNIIVEKAIVEGLPPGWVKKTRITTNGDSVRRDTFYIDPVNGYTFCSI  147

Query  262  KDAFRYIETGDISK  303
            +D   Y+ETG I +
Sbjct  148  EDVDHYLETGKIGR  161



>gb|EEE60561.1| hypothetical protein OsJ_13923 [Oryza sativa Japonica Group]
Length=325

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            LP GW+KE   R+   G IR+D +YTDP+  YVFR+ + A  Y+ETG ++
Sbjct  182  LPQGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKVT  231



>emb|CAE01997.2| OSJNBb0033G08.13 [Oryza sativa Japonica Group]
 emb|CAE04535.2| OSJNBa0040D17.1 [Oryza sativa Japonica Group]
Length=336

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            LP GW+KE   R+   G IR+D +YTDP+  YVFR+ + A  Y+ETG ++
Sbjct  171  LPQGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKVT  220



>emb|CAN74037.1| hypothetical protein VITISV_023406 [Vitis vinifera]
Length=730

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 15/93 (16%)
 Frame = +1

Query  58   NSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPV  237
            N + S ++KS+  K P K ++P   +   E +               H I K  YYTDPV
Sbjct  55   NDRESIQKKSIERKTPIKTMAPAGKKKSMEKK--------------KHCIAKK-YYTDPV  99

Query  238  SGYVFRSKKDAFRYIETGDISKCAMKPTLREPG  336
            +GY+FRS KD  RY++TGD  + A KP  R+ G
Sbjct  100  NGYIFRSMKDTLRYLKTGDPGRLAFKPKPRDSG  132



>emb|CAE01991.2| OSJNBb0033G08.7 [Oryza sativa Japonica Group]
Length=418

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            +A+   +   LP GW+KE   R+   G IR+D +YTDP+  YVF +K+ A  Y+ETG ++
Sbjct  161  LAILEFNPEGLPQGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFHTKRSAALYVETGKVT  220



>gb|EEE60563.1| hypothetical protein OsJ_13925 [Oryza sativa Japonica Group]
Length=337

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            +A+   +   LP GW+KE   R+   G IR+D +YTDP+  YVF +K+ A  Y+ETG ++
Sbjct  172  LAILEFNPEGLPQGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFHTKRSAALYVETGKVT  231



>dbj|BAJ99501.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +1

Query  151  ELPAGWIKEYKTR--RLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTL  324
            ELP GW+ EY+ R  R G  +R+D +Y DP + Y FRS ++   Y+E+ D +   + P  
Sbjct  12   ELPDGWLVEYRPRKTRPGSRVRRDKFYIDPTNSYEFRSLREVHHYLESQDTNDSVVTPNK  71

Query  325  R  327
            R
Sbjct  72   R  72



>gb|EEC76836.1| hypothetical protein OsI_14986 [Oryza sativa Indica Group]
Length=247

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS  300
            LP GW+KE   R+   G IR+D +YTDP+  YVFR  + A  Y+ETG ++
Sbjct  110  LPQGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRIMRSAALYVETGKVT  159



>ref|XP_011015295.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like, 
partial [Populus euphratica]
Length=182

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 50/104 (48%), Gaps = 8/104 (8%)
 Frame = +1

Query  7    IHHNIEEVSPNEKSVEDNSQISKRRKS----VVDKRPAKIVSPVAVQNGSESELPAGWIK  174
            +  N   + PN+ S  D + I    K     V   R  + +S  AV     S LP GWI 
Sbjct  12   LLQNGSSIDPNKLSTADETLIRTNDKGNQQPVTPVREKRRLSETAVDT---SWLPPGWIV  68

Query  175  EYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            E + R  G     +D YY +PVSG  FRSKKD   Y+ETG + K
Sbjct  69   EDRVRSSGATAGTRDKYYFEPVSGRRFRSKKDVQYYLETGTLKK  112



>emb|CDY31911.1| BnaC09g28330D [Brassica napus]
Length=617

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+  +   LP GWIK+          R+DP++ DP S Y+F S + A RY+ETGDI  
Sbjct  27   VIVEKSAAEGLPEGWIKKLVISNRSGRKRRDPFFIDPQSEYIFPSFRAASRYVETGDIGH  86

Query  304  CAMK  315
             A K
Sbjct  87   YARK  90



>gb|KGN57363.1| hypothetical protein Csa_3G181990 [Cucumis sativus]
Length=561

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+     +LP GWI E +  +  + IR+D  Y DPV+G   RS +D  RY+ +G +S+
Sbjct  36   VEVKKTIAKDLPTGWIGEIRETKTANRIRRDSSYIDPVNGNALRSIRDVHRYLTSGKVSR  95

Query  304  CAMK  315
               K
Sbjct  96   LTHK  99



>ref|XP_009106826.1| PREDICTED: LOW QUALITY PROTEIN: methyl-CpG-binding domain-containing 
protein 13 [Brassica rapa]
Length=628

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+  +   LP GWIK+          R+DP++ DP S Y+F S + A RY+ETGDI  
Sbjct  27   VIVEKSAAEGLPEGWIKKLVISNRSGRKRRDPFFIDPQSEYIFPSFRAASRYVETGDIGH  86

Query  304  CAMK  315
             A K
Sbjct  87   YARK  90



>ref|XP_006846186.1| hypothetical protein AMTR_s00012p00212320 [Amborella trichopoda]
 gb|ERN07861.1| hypothetical protein AMTR_s00012p00212320 [Amborella trichopoda]
Length=425

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            LPAGWI E K R  G     KD Y+ DPVS   FRSKK+ F ++ETG + +   KP
Sbjct  128  LPAGWITEIKVRANGLTAGTKDKYFYDPVSKRKFRSKKEVFSFLETGKLGRYKPKP  183



>dbj|BAK04695.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = +1

Query  151  ELPAGWIKEYKTR--RLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTL  324
            ELP GW+ EY+ R  R G  +R+D +Y DP + Y FRS ++   Y+E+ D +   + P  
Sbjct  55   ELPDGWLIEYRPRKTRPGSRVRRDKFYIDPTNSYEFRSLREVHHYLESQDTNDSVVTPNK  114

Query  325  RE  330
            R+
Sbjct  115  RK  116



>ref|XP_002961436.1| hypothetical protein SELMODRAFT_437797 [Selaginella moellendorffii]
 gb|EFJ36696.1| hypothetical protein SELMODRAFT_437797 [Selaginella moellendorffii]
Length=769

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 5/70 (7%)
 Frame = +1

Query  82   KSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSK  261
            K++  +RPA  V+    +  + S LP GWI E +TR  GH   +D YY +  SG  FRSK
Sbjct  80   KNLEHQRPA--VAVTITEAPAPSWLPEGWISECRTRADGH---RDKYYIESYSGRRFRSK  134

Query  262  KDAFRYIETG  291
             + F+Y+ETG
Sbjct  135  VEVFKYLETG  144



>ref|XP_008378256.1| PREDICTED: uncharacterized protein LOC103441353 [Malus domestica]
Length=863

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = +1

Query  61   SQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVS  240
            S+ S+  K  +++   +    V V+      LP GWIKE +  +    IR+D +Y  PVS
Sbjct  220  SKTSREDKQKIEETLKRPSDDVVVEKTVAERLPPGWIKEIRMTKKARKIRRDTHYIAPVS  279

Query  241  GYVFRSKKDAFRYIETGDISKCAMKPT  321
              VFRS +D  RY+E  +  +  ++P+
Sbjct  280  EKVFRSLRDVHRYLENEEPGRLNVEPS  306


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 67/171 (39%), Gaps = 56/171 (33%)
 Frame = +1

Query  118  SPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDI  297
            SP      SE  LPAGW  E K R+ G   R+D YY +  SG+ F S+ +  RY+ T   
Sbjct  166  SPAMADQNSEEWLPAGWTVEVKVRKNG---RRDKYYYESSSGHRFSSRAEVSRYLSTSKT  222

Query  298  S---KCAMKPTLREPGPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRP  468
            S   K  ++ TL+ P   S D+  +                    + VA++         
Sbjct  223  SREDKQKIEETLKRP---SDDVVVE--------------------KTVAER---------  250

Query  469  AKVVSNAEGQTESVDGLPPGWTREFRARKCGTK--SDPFYVDPVSGFGFRS  615
                            LPPGW +E R  K   K   D  Y+ PVS   FRS
Sbjct  251  ----------------LPPGWIKEIRMTKKARKIRRDTHYIAPVSEKVFRS  285



>ref|XP_006827729.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
 gb|ERM95145.1| hypothetical protein AMTR_s00009p00261370 [Amborella trichopoda]
Length=1239

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 100/220 (45%), Gaps = 22/220 (10%)
 Frame = +1

Query  4    DIHHNIEEVSPNEKSVEDNS--QISKRRKSVVDKRPAKIVSPVAVQNGSESEL-----PA  162
            +I  N+EE     +++++++  + ++++ S+ +  P+K    V V      EL     P 
Sbjct  399  NIDLNMEESDALIENLKESTVMKTTQKKGSLPEFSPSKSSGNVGVSTVCAGELTPEWLPP  458

Query  163  GWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGP  339
            GW      R+ G    R++ +Y +  +G  F S+    RY+E G+ S   +K   +E G 
Sbjct  459  GWTMVVTVRKAGKTAGRREKFYIELATGQRFASRLAVVRYLENGNASLERLKS--QEHGA  516

Query  340  TSTDLSYDTGkpspklkvsknkkpmkvkR----HVAKKQKSGSGKRPAKVVSNAEGQTES  507
            +  D   +      + +        K K+     +     SG+    A VV++   +   
Sbjct  517  SKIDFIAEESNSPFQKRKESTVIKTKEKKDPLPEICPTNSSGN----ATVVTSGAEELRP  572

Query  508  VDGLPPGWTREFRARKCGTKS---DPFYVDPVSGFGFRSK  618
             + LPPGWT + + RK G  +   + +Y+DP +G  FRS+
Sbjct  573  -EWLPPGWTMQIKVRKSGKTAGMREKYYIDPATGCSFRSR  611



>ref|XP_002990266.1| hypothetical protein SELMODRAFT_428715 [Selaginella moellendorffii]
 gb|EFJ08681.1| hypothetical protein SELMODRAFT_428715 [Selaginella moellendorffii]
Length=776

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = +1

Query  34   PNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRK  213
            P  +S+E+  +   + +++  +RPA  V+    +  + S LP GWI E +TR  GH   +
Sbjct  70   PRAESLEEQEE---QDRNLEHQRPALAVT--ITEAPAPSWLPEGWISECRTRADGH---R  121

Query  214  DPYYTDPVSGYVFRSKKDAFRYIETG  291
            D YY +  SG  FRSK + F+Y+ETG
Sbjct  122  DKYYIESYSGRRFRSKVEVFKYLETG  147



>emb|CDY00521.1| BnaA10g07520D [Brassica napus]
Length=595

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +1

Query  124  VAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            V V+  +   LP GWIK+          R+DP++ DP S Y+F S + A RY+ETG+I  
Sbjct  27   VIVEKSAAEGLPEGWIKKLVISNRSGRKRRDPFFIDPQSEYIFPSFRAASRYVETGNIGH  86

Query  304  CAMK  315
             A K
Sbjct  87   YARK  90



>ref|XP_010255468.1| PREDICTED: uncharacterized protein LOC104596134 isoform X2 [Nelumbo 
nucifera]
Length=572

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 63/158 (40%), Gaps = 26/158 (16%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW+ + K R+ G    KD YY    +G  FRSK    RYIETG+   C      R+ 
Sbjct  10   LPDGWVMDVKVRKTGQ---KDKYYIHLKTGRKFRSKDGVLRYIETGESHNCMPLQIERQA  66

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
               S+D             V       K   +   + K    + P +         +S D
Sbjct  67   NTCSSD-----------KDVPNTCSSDKDMPNTCSRDKDMPLEMPME---------DSPD  106

Query  514  GLPPGWTREFRARKCGTKSDP---FYVDPVSGFGFRSK  618
             LP GW  E + R+ G+K       Y+ P++G    SK
Sbjct  107  WLPAGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSK  144



>ref|XP_010255467.1| PREDICTED: uncharacterized protein LOC104596134 isoform X1 [Nelumbo 
nucifera]
Length=577

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 63/158 (40%), Gaps = 26/158 (16%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW+ + K R+ G    KD YY    +G  FRSK    RYIETG+   C      R+ 
Sbjct  10   LPDGWVMDVKVRKTGQ---KDKYYIHLKTGRKFRSKDGVLRYIETGESHNCMPLQIERQA  66

Query  334  GPTSTDLSYDTGkpspklkvsknkkpmkvkRHVAKKQKSGSGKRPAKVVSNAEGQTESVD  513
               S+D             V       K   +   + K    + P +         +S D
Sbjct  67   NTCSSD-----------KDVPNTCSSDKDMPNTCSRDKDMPLEMPME---------DSPD  106

Query  514  GLPPGWTREFRARKCGTKSDP---FYVDPVSGFGFRSK  618
             LP GW  E + R+ G+K       Y+ P++G    SK
Sbjct  107  WLPAGWVVEIKTRRGGSKVGQKYKCYIAPITGCRLYSK  144



>ref|XP_007016410.1| Methyl-CPG-binding domain protein 5, putative isoform 2 [Theobroma 
cacao]
 gb|EOY34029.1| Methyl-CPG-binding domain protein 5, putative isoform 2 [Theobroma 
cacao]
Length=212

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 48/97 (49%), Gaps = 13/97 (13%)
 Frame = +1

Query  100  RPAKIVSPVAVQNGS------ESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRS  258
            +P    SP+AV  G       E+ LPAGW+ E + R  G      D YY DP SG  FRS
Sbjct  48   QPEARSSPLAVAKGKRRVVPPETWLPAGWLVEDRVRTSGATAGTVDKYYVDPSSGRKFRS  107

Query  259  KKDAFRYIETGDISKCAMKPTLREPGPTSTDLSYDTG  369
            KK+   +IETG      + PT R+ G  ++     TG
Sbjct  108  KKEVLYFIETG------ITPTKRKKGMETSGTEESTG  138



>ref|XP_010934847.1| PREDICTED: uncharacterized protein LOC105054908 isoform X2 [Elaeis 
guineensis]
Length=654

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 44/111 (40%), Gaps = 45/111 (41%)
 Frame = +1

Query  121  PVAVQNGSESELPAGWIKEYKTRRLGHGIRK------DP---------------------  219
            PV     S   LP GW+ E +T+R G   R+      DP                     
Sbjct  72   PVQQVKNSFKWLPPGWLLEIRTQRCGSKARQIYKSYFDPSTRSRFYSKGDVLQFVKSGKI  131

Query  220  ------------------YYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
                              YY DPVSGYVFR+ KD  RY ETG+IS+ A +P
Sbjct  132  YSPTSDQKRHCESESPEHYYADPVSGYVFRTLKDVQRYTETGEISRHAFRP  182



>ref|XP_006369523.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66092.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=162

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 49/104 (47%), Gaps = 8/104 (8%)
 Frame = +1

Query  7    IHHNIEEVSPNEKSVEDNSQISKRRKS----VVDKRPAKIVSPVAVQNGSESELPAGWIK  174
            +  N   + PN+ S  D +      K     V   R  + +S  AV     S LP GW+ 
Sbjct  24   LLQNGSSIDPNKHSTADETLNRTNDKGNQQPVTPVREKRRLSETAVDT---SWLPPGWVV  80

Query  175  EYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            E + R  G     +D YY +PVSG  FRSKKD   Y+ETG + K
Sbjct  81   EDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124



>ref|XP_007016409.1| Methyl-CPG-binding domain protein 5, putative isoform 1 [Theobroma 
cacao]
 gb|EOY34028.1| Methyl-CPG-binding domain protein 5, putative isoform 1 [Theobroma 
cacao]
Length=232

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 48/97 (49%), Gaps = 20/97 (21%)
 Frame = +1

Query  118  SPVAVQNGS------ESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFR  276
            SP+AV  G       E+ LPAGW+ E + R  G      D YY DP SG  FRSKK+   
Sbjct  54   SPLAVAKGKRRVVPPETWLPAGWLVEDRVRTSGATAGTVDKYYVDPSSGRKFRSKKEVLY  113

Query  277  YIETGDISKCAMKPTLREPG-------PTSTDLSYDT  366
            +IETG      + PT R+ G         ST +S DT
Sbjct  114  FIETG------ITPTKRKKGMETSGTEEVSTGISADT  144



>ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Fragaria vesca subsp. vesca]
Length=209

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETG  291
            LPAGW  EYK R  G      D YY DPVSG  FRSKK+   ++ETG
Sbjct  75   LPAGWRVEYKVRSSGATAGSTDRYYHDPVSGRRFRSKKEVLHFLETG  121



>ref|XP_009353664.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=231

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 33/61 (54%), Gaps = 1/61 (2%)
 Frame = +1

Query  127  AVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            A  +  ES LP GW  + K R  G      D YY DPVSG  FRSK +  R++ETG I K
Sbjct  89   AFTDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLETGTIKK  148

Query  304  C  306
             
Sbjct  149  A  149



>ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
 gb|ERP66093.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa]
Length=167

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 49/104 (47%), Gaps = 8/104 (8%)
 Frame = +1

Query  7    IHHNIEEVSPNEKSVEDNSQISKRRKS----VVDKRPAKIVSPVAVQNGSESELPAGWIK  174
            +  N   + PN+ S  D +      K     V   R  + +S  AV     S LP GW+ 
Sbjct  24   LLQNGSSIDPNKHSTADETLNRTNDKGNQQPVTPVREKRRLSETAVDT---SWLPPGWVV  80

Query  175  EYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            E + R  G     +D YY +PVSG  FRSKKD   Y+ETG + K
Sbjct  81   EDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124



>ref|XP_010521339.1| PREDICTED: methyl-CpG-binding domain-containing protein 13 isoform 
X2 [Tarenaya hassleriana]
Length=666

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  187  RRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP  318
            RR    +RKDP + DP SGY+F S KDA RY+ TG I   A KP
Sbjct  3    RRKARKLRKDPLFIDPKSGYIFLSFKDASRYVRTGVIGNHARKP  46



>gb|KHN31504.1| Methyl-CpG-binding domain-containing protein 13 [Glycine soja]
Length=590

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +1

Query  109  KIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIET  288
            KI   V V+      LP G +K+ +    G  +R+D +Y DPV+GY F S KD   Y+E+
Sbjct  60   KISPNVIVEKAIAEGLPPGRVKKTRITTNGDSVRRDTFYIDPVNGYTFCSIKDVDCYLES  119

Query  289  GDI  297
            G+I
Sbjct  120  GEI  122



>ref|XP_002299872.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
 gb|ABK93437.1| unknown [Populus trichocarpa]
 gb|EEE84677.1| methyl-CpG-binding domain-containing family protein [Populus 
trichocarpa]
Length=214

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 49/104 (47%), Gaps = 8/104 (8%)
 Frame = +1

Query  7    IHHNIEEVSPNEKSVEDNSQISKRRKS----VVDKRPAKIVSPVAVQNGSESELPAGWIK  174
            +  N   + PN+ S  D +      K     V   R  + +S  AV     S LP GW+ 
Sbjct  24   LLQNGSSIDPNKHSTADETLNRTNDKGNQQPVTPVREKRRLSETAVDT---SWLPPGWVV  80

Query  175  EYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            E + R  G     +D YY +PVSG  FRSKKD   Y+ETG + K
Sbjct  81   EDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETGTLKK  124



>gb|AFW80350.1| hypothetical protein ZEAMMB73_827373 [Zea mays]
 tpg|DAA59673.1| TPA: hypothetical protein ZEAMMB73_581852 [Zea mays]
Length=133

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +1

Query  205  IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAM  312
            I++DPYYTDP S Y FR+ K A  ++ETG +S+ A 
Sbjct  5    IKRDPYYTDPASSYTFRTLKSALSFLETGKVSERAF  40



>ref|XP_010255469.1| PREDICTED: uncharacterized protein LOC104596134 isoform X3 [Nelumbo 
nucifera]
Length=543

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 3/66 (5%)
 Frame = +1

Query  154  LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREP  333
            LP GW+ + K R+ G    KD YY    +G  FRSK    RYIETG+   C      R+ 
Sbjct  10   LPDGWVMDVKVRKTGQ---KDKYYIHLKTGRKFRSKDGVLRYIETGESHNCMPLQIERQA  66

Query  334  GPTSTD  351
               S+D
Sbjct  67   NTCSSD  72



>ref|XP_009345985.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like 
[Pyrus x bretschneideri]
Length=234

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 32/61 (52%), Gaps = 1/61 (2%)
 Frame = +1

Query  127  AVQNGSESELPAGWIKEYKTRRLGHGI-RKDPYYTDPVSGYVFRSKKDAFRYIETGDISK  303
            A  +  ES LP GW  + K R  G      D YY DPVSG  FRSK +  R++ETG   K
Sbjct  92   AFTDSMESWLPQGWSVQEKVRSSGATAGSTDRYYIDPVSGRRFRSKIEVLRFLETGTTKK  151

Query  304  C  306
             
Sbjct  152  A  152



Lambda      K        H        a         alpha
   0.312    0.131    0.388    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520