BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS134C12

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761607.1|  PREDICTED: heat shock 70 kDa protein 15-like       291   8e-96   Nicotiana sylvestris
ref|XP_011072334.1|  PREDICTED: heat shock 70 kDa protein 15-like       291   2e-89   Sesamum indicum [beniseed]
ref|XP_007024113.1|  Heat shock protein 91 isoform 2                    284   3e-89   
gb|KJB35057.1|  hypothetical protein B456_006G098500                    283   2e-88   Gossypium raimondii
gb|KHG16619.1|  Heat shock 70 kDa 15 -like protein                      288   4e-88   Gossypium arboreum [tree cotton]
ref|XP_007024112.1|  Heat shock protein 91 isoform 1                    286   1e-87   
ref|XP_002528199.1|  Heat shock 70 kDa protein, putative                286   2e-87   Ricinus communis
ref|XP_010539495.1|  PREDICTED: heat shock 70 kDa protein 15-like       286   2e-87   Tarenaya hassleriana [spider flower]
gb|KJB70511.1|  hypothetical protein B456_011G076800                    283   3e-87   Gossypium raimondii
gb|KJB35056.1|  hypothetical protein B456_006G098500                    285   4e-87   Gossypium raimondii
gb|KHG16198.1|  Heat shock 70 kDa 15 -like protein                      285   4e-87   Gossypium arboreum [tree cotton]
gb|KDP37205.1|  hypothetical protein JCGZ_06261                         284   1e-86   Jatropha curcas
ref|XP_009624163.1|  PREDICTED: heat shock 70 kDa protein 15-like       284   1e-86   Nicotiana tomentosiformis
gb|KJB70509.1|  hypothetical protein B456_011G076800                    284   1e-86   Gossypium raimondii
ref|XP_010521527.1|  PREDICTED: heat shock 70 kDa protein 15            283   3e-86   Tarenaya hassleriana [spider flower]
ref|XP_010538015.1|  PREDICTED: heat shock 70 kDa protein 14            282   3e-86   Tarenaya hassleriana [spider flower]
ref|XP_011080863.1|  PREDICTED: heat shock 70 kDa protein 14-like       282   4e-86   Sesamum indicum [beniseed]
ref|XP_003546366.1|  PREDICTED: heat shock 70 kDa protein 14-like       282   6e-86   Glycine max [soybeans]
gb|KDO51190.1|  hypothetical protein CISIN_1g003056mg                   280   6e-86   Citrus sinensis [apfelsine]
ref|XP_006389708.1|  hypothetical protein EUTSA_v100181451mg            275   9e-86   
ref|XP_004252333.1|  PREDICTED: heat shock 70 kDa protein 15-like       281   1e-85   Solanum lycopersicum
gb|ACF83633.1|  unknown                                                 266   1e-85   Zea mays [maize]
gb|KDO51188.1|  hypothetical protein CISIN_1g003056mg                   280   2e-85   Citrus sinensis [apfelsine]
gb|KDO51189.1|  hypothetical protein CISIN_1g003056mg                   280   3e-85   Citrus sinensis [apfelsine]
ref|XP_006427039.1|  hypothetical protein CICLE_v10024883mg             280   3e-85   Citrus clementina [clementine]
ref|XP_009610837.1|  PREDICTED: heat shock 70 kDa protein 14-like...    278   3e-85   Nicotiana tomentosiformis
ref|XP_006465548.1|  PREDICTED: heat shock 70 kDa protein 14-like       280   4e-85   Citrus sinensis [apfelsine]
ref|XP_010691292.1|  PREDICTED: heat shock 70 kDa protein 15-like       279   8e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009610834.1|  PREDICTED: heat shock 70 kDa protein 15-like...    278   1e-84   Nicotiana tomentosiformis
ref|XP_002279789.2|  PREDICTED: heat shock 70 kDa protein 14-like       278   1e-84   Vitis vinifera
ref|XP_010925328.1|  PREDICTED: heat shock 70 kDa protein 14-like       278   1e-84   Elaeis guineensis
ref|XP_010249783.1|  PREDICTED: heat shock 70 kDa protein 15-like       278   2e-84   Nelumbo nucifera [Indian lotus]
gb|EPS63387.1|  hypothetical protein M569_11394                         266   2e-84   Genlisea aurea
ref|XP_009801414.1|  PREDICTED: heat shock 70 kDa protein 15-like       278   2e-84   Nicotiana sylvestris
gb|KHN32604.1|  Heat shock 70 kDa protein 14                            278   2e-84   Glycine soja [wild soybean]
ref|XP_010915054.1|  PREDICTED: heat shock 70 kDa protein 14-like       278   2e-84   Elaeis guineensis
ref|XP_008354138.1|  PREDICTED: heat shock 70 kDa protein 15-like       271   2e-84   
ref|XP_003543647.1|  PREDICTED: heat shock 70 kDa protein 14-like       278   2e-84   Glycine max [soybeans]
ref|XP_006346576.1|  PREDICTED: heat shock 70 kDa protein 15-like       278   3e-84   Solanum tuberosum [potatoes]
ref|XP_007150665.1|  hypothetical protein PHAVU_005G171400g             278   3e-84   Phaseolus vulgaris [French bean]
ref|XP_010254149.1|  PREDICTED: heat shock 70 kDa protein 15-like       277   3e-84   Nelumbo nucifera [Indian lotus]
ref|XP_006300740.1|  hypothetical protein CARUB_v10019803mg             276   5e-84   Capsella rubella
ref|XP_004252334.1|  PREDICTED: heat shock 70 kDa protein 15-like       276   7e-84   Solanum lycopersicum
ref|XP_009587742.1|  PREDICTED: heat shock 70 kDa protein 15-like       276   7e-84   Nicotiana tomentosiformis
emb|CDO98063.1|  unnamed protein product                                276   7e-84   Coffea canephora [robusta coffee]
ref|XP_002304187.1|  heat shock protein 70                              276   1e-83   Populus trichocarpa [western balsam poplar]
emb|CDY43337.1|  BnaC04g25190D                                          276   1e-83   Brassica napus [oilseed rape]
ref|XP_010033884.1|  PREDICTED: heat shock 70 kDa protein 14-like       276   1e-83   Eucalyptus grandis [rose gum]
gb|EYU21549.1|  hypothetical protein MIMGU_mgv1a001311mg                275   2e-83   Erythranthe guttata [common monkey flower]
ref|XP_010430044.1|  PREDICTED: heat shock 70 kDa protein 15            275   2e-83   
ref|XP_006346577.1|  PREDICTED: heat shock 70 kDa protein 15-like...    275   2e-83   Solanum tuberosum [potatoes]
ref|XP_006392781.1|  hypothetical protein EUTSA_v10011242mg             275   2e-83   Eutrema salsugineum [saltwater cress]
ref|XP_008793460.1|  PREDICTED: heat shock 70 kDa protein 14-like       275   2e-83   Phoenix dactylifera
emb|CDX76065.1|  BnaA04g03290D                                          275   2e-83   
ref|XP_010473008.1|  PREDICTED: heat shock 70 kDa protein 15-like       275   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010473009.1|  PREDICTED: heat shock 70 kDa protein 15-like       275   3e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010417777.1|  PREDICTED: heat shock 70 kDa protein 15-like...    274   3e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010417776.1|  PREDICTED: heat shock 70 kDa protein 15-like...    274   3e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010033879.1|  PREDICTED: heat shock 70 kDa protein 14-like       275   3e-83   Eucalyptus grandis [rose gum]
ref|XP_010098045.1|  Heat shock 70 kDa protein 15                       275   4e-83   Morus notabilis
gb|EYU24689.1|  hypothetical protein MIMGU_mgv1a001324mg                268   4e-83   Erythranthe guttata [common monkey flower]
ref|XP_010430043.1|  PREDICTED: heat shock 70 kDa protein 15-like       274   4e-83   Camelina sativa [gold-of-pleasure]
gb|EPS59607.1|  hypothetical protein M569_15197                         267   5e-83   Genlisea aurea
ref|XP_011000832.1|  PREDICTED: heat shock 70 kDa protein 14-like...    273   5e-83   Populus euphratica
gb|AAG52244.1|AC011717_12  putative heat-shock protein; 41956-44878     272   5e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388669.1|  PREDICTED: heat shock 70 kDa protein 14-like       274   6e-83   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL38353.1|  putative heat-shock protein                             273   6e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850984.4|  Heat shock protein 70                                 273   6e-83   
ref|XP_009147592.1|  PREDICTED: heat shock 70 kDa protein 14            273   6e-83   Brassica rapa
ref|XP_007217050.1|  hypothetical protein PRUPE_ppa001317mg             274   7e-83   Prunus persica
ref|XP_008228510.1|  PREDICTED: heat shock 70 kDa protein 15-like       274   7e-83   Prunus mume [ume]
ref|XP_009408938.1|  PREDICTED: heat shock 70 kDa protein 15-like       274   8e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009139126.1|  PREDICTED: heat shock 70 kDa protein 15            273   8e-83   Brassica rapa
ref|NP_178110.6|  Heat shock protein 70                                 273   1e-82   
emb|CDY24089.1|  BnaA06g00870D                                          273   1e-82   Brassica napus [oilseed rape]
emb|CDY45119.1|  BnaC06g06400D                                          275   1e-82   Brassica napus [oilseed rape]
ref|XP_002887853.1|  hypothetical protein ARALYDRAFT_896005             273   1e-82   Arabidopsis lyrata subsp. lyrata
ref|NP_001031305.1|  heat shock protein 91                              272   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011000830.1|  PREDICTED: heat shock 70 kDa protein 15-like...    273   1e-82   Populus euphratica
ref|XP_006287070.1|  hypothetical protein CARUB_v10000229mg             272   2e-82   Capsella rubella
ref|XP_009389931.1|  PREDICTED: heat shock 70 kDa protein 14-like       272   2e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_178111.1|  heat shock protein 91                                 272   2e-82   Arabidopsis thaliana [mouse-ear cress]
emb|CCM07272.1|  Putative 97 kDa heat shock protein                     272   4e-82   Musa balbisiana [starchy banana]
ref|XP_008786326.1|  PREDICTED: heat shock 70 kDa protein 15-like       271   5e-82   Phoenix dactylifera
ref|XP_011013254.1|  PREDICTED: heat shock 70 kDa protein 15-like       271   8e-82   Populus euphratica
emb|CAA94389.1|  heat-shock protein                                     270   9e-82   Arabidopsis thaliana [mouse-ear cress]
gb|EYU24688.1|  hypothetical protein MIMGU_mgv1a001324mg                270   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_002439385.1|  hypothetical protein SORBIDRAFT_09g005580          270   1e-81   Sorghum bicolor [broomcorn]
ref|XP_003597778.1|  97 kDa heat shock protein                          270   2e-81   Medicago truncatula
gb|AFW81561.1|  hypothetical protein ZEAMMB73_352123                    263   3e-81   
ref|NP_001147805.1|  heat shock 70 kDa protein 4                        269   4e-81   Zea mays [maize]
ref|XP_008654914.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    268   5e-81   
ref|XP_004506856.1|  PREDICTED: heat shock 70 kDa protein 15-like       269   5e-81   Cicer arietinum [garbanzo]
ref|XP_004960855.1|  PREDICTED: heat shock 70 kDa protein 15-like...    269   5e-81   Setaria italica
ref|XP_006842242.1|  hypothetical protein AMTR_s00078p00190750          268   6e-81   Amborella trichopoda
ref|XP_009358190.1|  PREDICTED: heat shock 70 kDa protein 15-like       268   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_006643833.1|  PREDICTED: heat shock 70 kDa protein 14-like       268   1e-80   Oryza brachyantha
ref|XP_010925584.1|  PREDICTED: heat shock 70 kDa protein 14-like       268   1e-80   Elaeis guineensis
ref|XP_009358191.1|  PREDICTED: heat shock 70 kDa protein 15-like       268   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_004960853.1|  PREDICTED: heat shock 70 kDa protein 14-like...    267   1e-80   Setaria italica
ref|XP_004960852.1|  PREDICTED: heat shock 70 kDa protein 14-like...    268   2e-80   
ref|XP_004506857.1|  PREDICTED: heat shock 70 kDa protein 15-like       267   2e-80   Cicer arietinum [garbanzo]
ref|XP_003529646.1|  PREDICTED: heat shock 70 kDa protein 15-like...    267   3e-80   
ref|XP_008647466.1|  PREDICTED: uncharacterized protein LOC100217...    266   3e-80   
gb|KHN47807.1|  Heat shock 70 kDa protein 14                            266   4e-80   Glycine soja [wild soybean]
ref|XP_002440718.1|  hypothetical protein SORBIDRAFT_09g005570          266   4e-80   Sorghum bicolor [broomcorn]
ref|XP_002299641.1|  heat shock protein 70                              266   4e-80   Populus trichocarpa [western balsam poplar]
ref|XP_008362708.1|  PREDICTED: heat shock 70 kDa protein 15-like       266   5e-80   
ref|XP_006585595.1|  PREDICTED: heat shock 70 kDa protein 14-like...    266   5e-80   Glycine max [soybeans]
ref|XP_009399777.1|  PREDICTED: heat shock 70 kDa protein 14-like       266   5e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003531683.1|  PREDICTED: heat shock 70 kDa protein 14-like...    266   5e-80   Glycine max [soybeans]
ref|XP_008371663.1|  PREDICTED: heat shock 70 kDa protein 15-like       266   6e-80   
ref|XP_010231645.1|  PREDICTED: heat shock 70 kDa protein 14-like       266   6e-80   
gb|EAY72790.1|  hypothetical protein OsI_00654                          265   7e-80   Oryza sativa Indica Group [Indian rice]
ref|NP_001151579.1|  heat shock 70 kDa protein 4                        265   1e-79   Zea mays [maize]
ref|NP_001042210.1|  Os01g0180800                                       265   1e-79   
ref|XP_008775317.1|  PREDICTED: heat shock 70 kDa protein 14-like       265   1e-79   Phoenix dactylifera
ref|XP_008462146.1|  PREDICTED: heat shock 70 kDa protein 15-like       265   1e-79   Cucumis melo [Oriental melon]
gb|ACG43420.1|  heat shock 70 kDa protein 4                             265   1e-79   Zea mays [maize]
ref|XP_007135698.1|  hypothetical protein PHAVU_010G150800g             265   2e-79   Phaseolus vulgaris [French bean]
ref|XP_004302913.1|  PREDICTED: heat shock 70 kDa protein 15-like       265   2e-79   Fragaria vesca subsp. vesca
gb|EMS61926.1|  Heat shock 70 kDa protein 4L                            264   2e-79   Triticum urartu
ref|XP_008655087.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    265   2e-79   Zea mays [maize]
ref|XP_004141777.1|  PREDICTED: heat shock 70 kDa protein 15-like       264   3e-79   Cucumis sativus [cucumbers]
gb|EMT09857.1|  Heat shock 70 kDa protein 4L                            264   5e-79   
gb|EMT31029.1|  Heat shock 70 kDa protein 4L                            263   7e-79   
ref|XP_010231644.1|  PREDICTED: heat shock 70 kDa protein 15-like       262   1e-78   Brachypodium distachyon [annual false brome]
ref|XP_008649434.1|  PREDICTED: heat shock 70 kDa protein 14-like       262   1e-78   Zea mays [maize]
gb|KEH28782.1|  heat shock 70 kDa protein                               261   3e-78   Medicago truncatula
ref|NP_001054812.1|  Os05g0181000                                       260   6e-78   
ref|XP_008354139.1|  PREDICTED: heat shock 70 kDa protein 15-like       260   7e-78   
gb|EAY96776.1|  hypothetical protein OsI_18700                          260   7e-78   Oryza sativa Indica Group [Indian rice]
gb|AFW77408.1|  hypothetical protein ZEAMMB73_835876                    263   8e-78   
gb|EMS52665.1|  Heat shock 70 kDa protein 4L                            263   9e-78   Triticum urartu
dbj|BAJ90753.1|  predicted protein                                      259   2e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006654112.1|  PREDICTED: heat shock 70 kDa protein 15-like       252   7e-75   Oryza brachyantha
ref|XP_001764380.1|  predicted protein                                  249   1e-73   
ref|XP_001755636.1|  predicted protein                                  248   1e-73   
ref|XP_001760080.1|  predicted protein                                  243   8e-72   
ref|XP_002986462.1|  hypothetical protein SELMODRAFT_124091             236   2e-69   
ref|XP_002978946.1|  hypothetical protein SELMODRAFT_109750             234   1e-68   
gb|AFG63451.1|  hypothetical protein UMN_2640_01                        214   2e-67   Pinus taeda
ref|XP_002317001.1|  hypothetical protein POPTR_0011s14240g             223   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_008363587.1|  PREDICTED: heat shock 70 kDa protein 16-like       213   4e-64   
ref|XP_011030786.1|  PREDICTED: heat shock 70 kDa protein 16-like...    222   4e-64   Populus euphratica
ref|XP_011030785.1|  PREDICTED: heat shock 70 kDa protein 16-like...    221   5e-64   Populus euphratica
ref|XP_008353314.1|  PREDICTED: heat shock 70 kDa protein 16-like       212   2e-63   
ref|XP_008226915.1|  PREDICTED: heat shock 70 kDa protein 16            219   4e-63   Prunus mume [ume]
ref|XP_007213641.1|  hypothetical protein PRUPE_ppa001697mg             219   5e-63   Prunus persica
ref|XP_008345050.1|  PREDICTED: heat shock 70 kDa protein 16-like       212   8e-63   
gb|KCW67010.1|  hypothetical protein EUGRSUZ_F00767                     216   2e-62   Eucalyptus grandis [rose gum]
ref|XP_004500055.1|  PREDICTED: heat shock 70 kDa protein 16-like       217   3e-62   Cicer arietinum [garbanzo]
ref|XP_010060358.1|  PREDICTED: heat shock 70 kDa protein 16            216   4e-62   Eucalyptus grandis [rose gum]
ref|XP_003600064.1|  Heat shock 70 kDa protein 4L                       216   4e-62   Medicago truncatula
ref|XP_010092150.1|  Heat shock 70 kDa protein 16                       216   4e-62   
gb|AII99893.1|  heat shock protein                                      216   5e-62   Cicer arietinum [garbanzo]
ref|XP_008366399.1|  PREDICTED: heat shock 70 kDa protein 16-like       216   6e-62   
ref|XP_004167874.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    216   6e-62   
ref|XP_004151979.1|  PREDICTED: heat shock 70 kDa protein 16-like       216   6e-62   Cucumis sativus [cucumbers]
ref|XP_009760615.1|  PREDICTED: heat shock 70 kDa protein 16            216   7e-62   Nicotiana sylvestris
ref|XP_008355346.1|  PREDICTED: heat shock 70 kDa protein 16-like       211   8e-62   
ref|XP_007020850.1|  Heat shock protein 70 family protein               215   9e-62   
gb|EYU27799.1|  hypothetical protein MIMGU_mgv1a001740mg                215   1e-61   Erythranthe guttata [common monkey flower]
gb|EYU27798.1|  hypothetical protein MIMGU_mgv1a001740mg                214   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_009352450.1|  PREDICTED: heat shock 70 kDa protein 16-like       214   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_009614255.1|  PREDICTED: heat shock 70 kDa protein 16            214   3e-61   Nicotiana tomentosiformis
gb|KDP39123.1|  hypothetical protein JCGZ_00880                         214   3e-61   Jatropha curcas
gb|AET00484.2|  heat shock 70 kDa protein                               214   4e-61   Medicago truncatula
ref|XP_009352433.1|  PREDICTED: heat shock 70 kDa protein 16-like       213   4e-61   Pyrus x bretschneideri [bai li]
ref|XP_003617525.1|  97 kDa heat shock protein                          214   4e-61   
ref|XP_002522946.1|  Heat-shock protein 105 kDa, putative               213   7e-61   
ref|XP_006858197.1|  hypothetical protein AMTR_s00062p00170870          209   1e-60   
ref|XP_008465078.1|  PREDICTED: heat shock 70 kDa protein 16            212   1e-60   Cucumis melo [Oriental melon]
ref|XP_009372708.1|  PREDICTED: heat shock 70 kDa protein 16-like...    211   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_009372707.1|  PREDICTED: heat shock 70 kDa protein 16-like...    211   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_010278704.1|  PREDICTED: heat shock 70 kDa protein 16            211   4e-60   Nelumbo nucifera [Indian lotus]
ref|XP_007020851.1|  Heat shock protein 70 family protein               211   4e-60   
ref|XP_002278262.1|  PREDICTED: heat shock 70 kDa protein 16            211   5e-60   Vitis vinifera
ref|XP_004232717.1|  PREDICTED: heat shock 70 kDa protein 16            209   9e-60   Solanum lycopersicum
ref|XP_011096072.1|  PREDICTED: heat shock 70 kDa protein 16            209   1e-59   Sesamum indicum [beniseed]
ref|XP_010931798.1|  PREDICTED: heat shock 70 kDa protein 16            208   4e-59   Elaeis guineensis
gb|AII99889.1|  heat shock protein                                      207   7e-59   Cicer arietinum [garbanzo]
ref|XP_004491392.1|  PREDICTED: heat shock 70 kDa protein 16-like       207   8e-59   Cicer arietinum [garbanzo]
ref|XP_006348107.1|  PREDICTED: heat shock 70 kDa protein 16-like...    207   1e-58   Solanum tuberosum [potatoes]
ref|XP_010665569.1|  PREDICTED: heat shock 70 kDa protein 16            206   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008806738.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    205   4e-58   Phoenix dactylifera
ref|XP_008806739.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    205   5e-58   Phoenix dactylifera
gb|KJB69295.1|  hypothetical protein B456_011G014900                    204   1e-57   Gossypium raimondii
emb|CDP04389.1|  unnamed protein product                                204   1e-57   Coffea canephora [robusta coffee]
ref|XP_006306833.1|  hypothetical protein CARUB_v10008380mg             203   2e-57   
ref|XP_003553093.1|  PREDICTED: heat shock 70 kDa protein 16-like       203   2e-57   Glycine max [soybeans]
gb|KHN45217.1|  Heat shock 70 kDa protein 16                            203   2e-57   Glycine soja [wild soybean]
ref|XP_006306834.1|  hypothetical protein CARUB_v10008380mg             203   3e-57   Capsella rubella
ref|XP_004294376.1|  PREDICTED: heat shock 70 kDa protein 16            202   3e-57   Fragaria vesca subsp. vesca
ref|XP_008365284.1|  PREDICTED: heat shock 70 kDa protein 16            201   5e-57   
ref|XP_007146461.1|  hypothetical protein PHAVU_006G042400g             202   7e-57   Phaseolus vulgaris [French bean]
gb|KJB22069.1|  hypothetical protein B456_004G027900                    201   8e-57   Gossypium raimondii
ref|XP_006475182.1|  PREDICTED: heat shock 70 kDa protein 16-like...    201   9e-57   
ref|XP_006452327.1|  hypothetical protein CICLE_v10007538mg             201   1e-56   Citrus clementina [clementine]
ref|XP_011037663.1|  PREDICTED: heat shock 70 kDa protein 16            201   2e-56   Populus euphratica
ref|XP_002305580.2|  hypothetical protein POPTR_0004s01640g             201   2e-56   
gb|KJB22068.1|  hypothetical protein B456_004G027900                    200   3e-56   Gossypium raimondii
gb|KHG25442.1|  Heat shock 70 kDa 16 -like protein                      200   3e-56   Gossypium arboreum [tree cotton]
ref|XP_006595737.1|  PREDICTED: heat shock 70 kDa protein 16-like...    200   3e-56   Glycine max [soybeans]
ref|XP_006595736.1|  PREDICTED: heat shock 70 kDa protein 16-like...    200   4e-56   Glycine max [soybeans]
ref|XP_010493114.1|  PREDICTED: heat shock 70 kDa protein 16-like       198   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002889885.1|  hypothetical protein ARALYDRAFT_888478             198   1e-55   
ref|NP_172631.2|  heat shock protein 70 (Hsp 70) family protein         197   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476099.1|  PREDICTED: heat shock 70 kDa protein 16            197   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010458573.1|  PREDICTED: heat shock 70 kDa protein 16-like       197   2e-55   Camelina sativa [gold-of-pleasure]
gb|KHM99573.1|  Heat shock 70 kDa protein 16                            197   3e-55   Glycine soja [wild soybean]
ref|XP_003532123.1|  PREDICTED: heat shock 70 kDa protein 16-like       197   4e-55   Glycine max [soybeans]
emb|CDY49794.1|  BnaCnng18070D                                          195   1e-54   Brassica napus [oilseed rape]
gb|KDO75458.1|  hypothetical protein CISIN_1g004211mg                   194   2e-54   Citrus sinensis [apfelsine]
ref|XP_006417329.1|  hypothetical protein EUTSA_v10006883mg             195   2e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006468028.1|  PREDICTED: heat shock 70 kDa protein 16-like       194   2e-54   Citrus sinensis [apfelsine]
ref|XP_009148495.1|  PREDICTED: heat shock 70 kDa protein 16            193   7e-54   Brassica rapa
emb|CDX97975.1|  BnaA06g07260D                                          193   8e-54   
ref|XP_007142282.1|  hypothetical protein PHAVU_008G267400g             192   2e-53   Phaseolus vulgaris [French bean]
gb|EPS74057.1|  hypothetical protein M569_00693                         192   2e-53   Genlisea aurea
ref|XP_010533816.1|  PREDICTED: heat shock 70 kDa protein 16            186   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_009420545.1|  PREDICTED: heat shock 70 kDa protein 16            184   1e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI36157.3|  unnamed protein product                                184   1e-50   Vitis vinifera
ref|XP_001695858.1|  heat shock protein 70E                             176   1e-47   Chlamydomonas reinhardtii
ref|XP_002949519.1|  heat shock protein Hsp70E                          172   3e-46   Volvox carteri f. nagariensis
ref|XP_003082170.1|  heat shock protein 91-Arabidopsis thaliana (...    172   4e-46   
emb|CEF99759.1|  Heat shock protein 70 family                           172   5e-46   Ostreococcus tauri
ref|XP_006449032.1|  hypothetical protein CICLE_v10014383mg             166   2e-44   
ref|XP_006449031.1|  hypothetical protein CICLE_v10014383mg             166   3e-44   
ref|XP_005642775.1|  heat shock protein 70E                             166   6e-44   Coccomyxa subellipsoidea C-169
ref|XP_002969191.1|  hypothetical protein SELMODRAFT_440676             164   2e-43   
ref|XP_002973871.1|  hypothetical protein SELMODRAFT_267697             164   2e-43   
ref|XP_002505210.1|  heat shock protein 70                              163   6e-43   Micromonas commoda
ref|XP_003060408.1|  heat shock protein 70                              154   8e-40   Micromonas pusilla CCMP1545
ref|XP_011304595.1|  PREDICTED: 97 kDa heat shock protein isoform X2    154   1e-39   Fopius arisanus
sp|Q06068.2|HSP97_STRPU  RecName: Full=97 kDa heat shock protein;...    154   2e-39   Strongylocentrotus purpuratus [purple urchin]
ref|NP_999695.1|  97 kDa heat shock protein                             154   2e-39   Strongylocentrotus purpuratus [purple urchin]
ref|XP_011304586.1|  PREDICTED: 97 kDa heat shock protein isoform X1    154   2e-39   Fopius arisanus
sp|Q94738.1|HSP97_STRFN  RecName: Full=97 kDa heat shock protein;...    154   2e-39   Mesocentrotus franciscanus
ref|XP_001641799.1|  predicted protein                                  152   8e-39   Nematostella vectensis
ref|XP_003485911.1|  PREDICTED: heat shock 70 kDa protein 4L-like       151   1e-38   Bombus impatiens
ref|XP_002585532.1|  hypothetical protein BRAFLDRAFT_111895             146   3e-38   Branchiostoma floridae
ref|XP_003394081.1|  PREDICTED: heat shock 70 kDa protein 4L-like       150   4e-38   Bombus terrestris [large earth bumblebee]
ref|XP_006561225.1|  PREDICTED: 97 kDa heat shock protein isoform X2    150   5e-38   Apis mellifera [bee]
ref|XP_006615729.1|  PREDICTED: 97 kDa heat shock protein-like is...    150   5e-38   Apis dorsata [rock honeybee]
ref|XP_003702344.1|  PREDICTED: 97 kDa heat shock protein-like          150   5e-38   Megachile rotundata
ref|XP_003691374.1|  PREDICTED: heat shock 70 kDa protein 4L-like       150   5e-38   Apis florea [dwarf honeybee]
gb|KJE91467.1|  hsp97-like protein                                      149   6e-38   Capsaspora owczarzaki ATCC 30864
ref|XP_623199.2|  PREDICTED: 97 kDa heat shock protein isoformX1        149   6e-38   Apis mellifera [bee]
ref|XP_006615728.1|  PREDICTED: 97 kDa heat shock protein-like is...    149   6e-38   Apis dorsata [rock honeybee]
ref|XP_004349347.1|  hsp97-like protein                                 148   2e-37   Capsaspora owczarzaki ATCC 30864
ref|XP_011256245.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    147   3e-37   Camponotus floridanus
ref|XP_011256244.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    147   3e-37   Camponotus floridanus
ref|XP_011162513.1|  PREDICTED: 97 kDa heat shock protein isoform X2    147   3e-37   Solenopsis invicta [imported red fire ant]
ref|XP_011162512.1|  PREDICTED: 97 kDa heat shock protein isoform X1    147   3e-37   Solenopsis invicta [imported red fire ant]
ref|XP_002585896.1|  hypothetical protein BRAFLDRAFT_256670             146   7e-37   Branchiostoma floridae
ref|XP_011052837.1|  PREDICTED: 97 kDa heat shock protein isoform X2    146   7e-37   Acromyrmex echinatior
ref|XP_011052836.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    146   8e-37   Acromyrmex echinatior
gb|KDD72574.1|  heat shock protein Hsp70                                137   8e-37   Helicosporidium sp. ATCC 50920
ref|XP_008557094.1|  PREDICTED: 97 kDa heat shock protein isoform X2    145   2e-36   
ref|XP_008557093.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    145   2e-36   Microplitis demolitor
ref|XP_011154271.1|  PREDICTED: heat shock 70 kDa protein 4L            145   2e-36   Harpegnathos saltator
ref|XP_011399703.1|  97 kDa heat shock protein                          142   6e-36   Auxenochlorella protothecoides
ref|XP_011497950.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    142   2e-35   Ceratosolen solmsi marchali
gb|EHJ64651.1|  hypothetical protein KGM_00738                          142   2e-35   
ref|XP_011497941.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    142   2e-35   Ceratosolen solmsi marchali
ref|XP_002431004.1|  Heat-shock protein 105 kDa, putative               142   3e-35   Pediculus humanus corporis [human body lice]
ref|XP_004927888.1|  PREDICTED: 97 kDa heat shock protein-like          142   3e-35   Bombyx mori [silk moth]
ref|XP_005846866.1|  hypothetical protein CHLNCDRAFT_35731              142   3e-35   Chlorella variabilis
ref|XP_008191928.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    141   5e-35   Tribolium castaneum [rust-red flour beetle]
ref|XP_008191929.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    141   5e-35   Tribolium castaneum [rust-red flour beetle]
ref|XP_011339673.1|  PREDICTED: 97 kDa heat shock protein isoform X2    141   7e-35   
ref|XP_011339672.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    140   8e-35   Ooceraea biroi
gb|ELT92200.1|  hypothetical protein CAPTEDRAFT_221226                  139   2e-34   Capitella teleta
gb|AEB26316.1|  heat shock protein 105                                  138   3e-34   Helicoverpa armigera [American bollworm]
ref|XP_006003281.1|  PREDICTED: heat shock 70 kDa protein 4             138   4e-34   
gb|KFM56735.1|  heat shock protein                                      138   4e-34   Stegodyphus mimosarum
gb|ENN79035.1|  hypothetical protein YQE_04502                          136   3e-33   Dendroctonus ponderosae
gb|ERL85506.1|  hypothetical protein D910_02925                         136   3e-33   Dendroctonus ponderosae
dbj|BAA97566.1|  hsp70                                                  135   4e-33   
ref|XP_005819695.1|  hypothetical protein GUITHDRAFT_166641             135   6e-33   
ref|XP_003687776.1|  hypothetical protein TPHA_0K02090                  133   2e-32   
ref|XP_005837933.1|  hypothetical protein GUITHDRAFT_103535             134   2e-32   
ref|XP_008202915.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    133   3e-32   
ref|XP_008202916.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    133   3e-32   
gb|KIK59701.1|  hypothetical protein GYMLUDRAFT_201113                  132   3e-32   
emb|CDH59379.1|  heat shock protein                                     133   4e-32   
dbj|GAN04884.1|  heat shock protein                                     132   4e-32   
gb|KDR19282.1|  Heat shock 70 kDa protein 4L                            133   5e-32   
emb|CDS05536.1|  hypothetical protein LRAMOSA08064                      132   8e-32   
emb|CEG71289.1|  Putative Heat shock 70kDa protein 4                    132   8e-32   
ref|XP_005242837.1|  PREDICTED: heat shock 70 kDa protein 4             132   1e-31   
emb|CEP19347.1|  hypothetical protein                                   131   1e-31   
emb|CDW59396.1|  heat shock 70 kDa protein 4                            131   1e-31   
ref|XP_002119191.1|  PREDICTED: heat shock 70 kDa protein 4L            132   1e-31   
emb|CDS10615.1|  hypothetical protein LRAMOSA11101                      131   1e-31   
ref|XP_004338433.1|  HSP91 (Heat shock protein 91), putative            131   1e-31   
ref|XP_005177158.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    131   1e-31   
ref|XP_005177155.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    131   2e-31   
dbj|BAC35620.1|  unnamed protein product                                125   2e-31   
ref|XP_007389090.1|  heat shock protein 70                              129   2e-31   
ref|XP_011190144.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    131   2e-31   
ref|XP_004320561.1|  PREDICTED: heat shock 70 kDa protein 4-like        123   2e-31   
ref|XP_011190138.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    131   2e-31   
gb|EPB87687.1|  heat shock 70kDa protein 4                              130   4e-31   
ref|XP_007003338.1|  hypothetical protein TREMEDRAFT_43142              129   4e-31   
gb|KHN76490.1|  Uncharacterized protein C30C11.4                        129   4e-31   
ref|XP_011199483.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    130   5e-31   
gb|AAH60431.1|  LOC398863 protein                                       126   5e-31   
emb|CEI91389.1|  Putative Heat shock 70kDa protein 4                    130   5e-31   
gb|AAA35095.1|  70kDal heat shock protein                               126   5e-31   
ref|XP_005053752.1|  PREDICTED: heat shock 70 kDa protein 4             130   5e-31   
ref|XP_011199479.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    130   5e-31   
ref|XP_005523757.1|  PREDICTED: heat shock 70 kDa protein 4             130   5e-31   
emb|CDO64077.1|  heat shock protein 70, putative                        129   6e-31   
gb|KIR24989.1|  hsp72-like protein                                      122   7e-31   
gb|AGM32458.1|  cytoplasmic heat shock protein 70                       124   7e-31   
emb|CCL98188.1|  predicted protein                                      129   8e-31   
gb|EHK40353.1|  hypothetical protein TRIATDRAFT_128447                  128   9e-31   
gb|KFB38249.1|  AGAP010331-PA-like protein                              129   1e-30   
emb|CDO70718.1|  hypothetical protein BN946_scf184798.g33               127   1e-30   
dbj|BAK07442.1|  predicted protein                                      129   1e-30   
gb|EPT05848.1|  hypothetical protein FOMPIDRAFT_1021055                 127   1e-30   
ref|XP_002193589.1|  PREDICTED: heat shock 70 kDa protein 4             129   1e-30   
gb|KFH64507.1|  heat shock 70kDa protein 4                              129   1e-30   
gb|KDQ33571.1|  hypothetical protein PLEOSDRAFT_1052407                 127   1e-30   
ref|XP_009462627.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    129   1e-30   
gb|KDQ18475.1|  hypothetical protein BOTBODRAFT_154372                  127   1e-30   
gb|KIK06501.1|  hypothetical protein K443DRAFT_674159                   127   1e-30   
ref|XP_005537819.1|  heat shock protein Hsp70, cytosolic                128   1e-30   
gb|KFQ04337.1|  Heat shock 70 kDa protein 4                             129   1e-30   
ref|XP_009959027.1|  PREDICTED: heat shock 70 kDa protein 4             129   1e-30   
ref|XP_009462626.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    129   1e-30   
gb|KFQ96406.1|  Heat shock 70 kDa protein 4                             128   2e-30   
ref|XP_002174397.1|  heat shock protein                                 127   2e-30   
ref|XP_002173111.1|  heat shock protein                                 127   2e-30   
ref|XP_009900614.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   2e-30   
gb|KFV68743.1|  Heat shock 70 kDa protein 4                             128   2e-30   
ref|XP_010577101.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   2e-30   
ref|XP_009900615.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   2e-30   
ref|XP_004519098.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    128   2e-30   
ref|XP_001366416.1|  PREDICTED: heat shock 70 kDa protein 4             128   2e-30   
ref|XP_008469279.1|  PREDICTED: heat shock protein 105 kDa-like         126   2e-30   
ref|XP_005512494.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   2e-30   
ref|XP_004519096.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    128   2e-30   
gb|EDL33602.1|  heat shock protein 4, isoform CRA_b                     125   2e-30   
gb|ERZ96294.1|  hypothetical protein GLOINDRAFT_12777                   127   2e-30   
ref|XP_005493118.1|  PREDICTED: heat shock 70 kDa protein 4             128   2e-30   
emb|CDY32364.1|  BnaC01g36830D                                          123   2e-30   
ref|XP_005147344.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    128   2e-30   
ref|XP_009089808.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   2e-30   
ref|XP_001878586.1|  predicted protein                                  127   2e-30   
gb|EDM04372.1|  heat shock protein 4, isoform CRA_a                     124   2e-30   
ref|XP_009089807.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   2e-30   
ref|XP_806460.1|  heat shock 70 kDa protein                             122   2e-30   
ref|XP_009089806.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    128   2e-30   
ref|XP_001951792.1|  PREDICTED: heat shock 70 kDa protein 4             128   2e-30   
gb|KDQ59435.1|  hypothetical protein JAAARDRAFT_32998                   127   2e-30   
gb|EJU05725.1|  heat shock protein 70                                   126   3e-30   
ref|XP_008036836.1|  heat shock protein                                 126   3e-30   
ref|XP_002781830.1|  heat shock protein 70, putative                    120   3e-30   
gb|AAH41515.1|  Hspa4 protein                                           124   3e-30   
ref|XP_006220075.1|  PREDICTED: heat shock 70 kDa protein A-like        120   3e-30   
ref|XP_008598905.1|  heat shock protein 70-2                            127   3e-30   
gb|EMD38594.1|  hypothetical protein CERSUDRAFT_105182                  126   3e-30   
ref|XP_003738350.1|  PREDICTED: heat shock 70 kDa protein 4-like        127   3e-30   
ref|NP_009396.2|  Hsp70 family ATPase SSA1                              127   3e-30   
gb|AAC04952.1|  Ssa1p: Heat shock protein of HSP70 family               127   3e-30   
ref|XP_002840352.1|  hypothetical protein                               126   3e-30   
ref|XP_009542365.1|  hypothetical protein HETIRDRAFT_310898             126   3e-30   
emb|CCO26137.1|  Heat shock protein SSB                                 126   3e-30   
gb|KJA20216.1|  hypothetical protein HYPSUDRAFT_43335                   126   3e-30   
gb|AAB34280.1|  70 kda heat shock protein                               122   3e-30   
gb|AEX60710.1|  Hsp70-x                                                 127   3e-30   
gb|ETW18876.1|  hsp70-like protein                                      127   3e-30   
ref|NP_595438.1|  heat shock protein, ribosome associated molecul...    126   4e-30   
dbj|BAA20093.1|  Heat-Shock Protein                                     126   4e-30   
gb|KFO70037.1|  Heat shock 70 kDa protein 4                             127   4e-30   
ref|XP_007847651.1|  heat shock protein sks2                            126   4e-30   
dbj|BAA12279.1|  heat shock cognate                                     126   4e-30   
ref|XP_006128593.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    127   4e-30   
gb|AFJ20626.1|  heat shock protein 70                                   126   4e-30   
gb|KDR08212.1|  Heat shock 70 kDa protein cognate 2                     126   4e-30   
emb|CAY77648.1|  Ssa1p                                                  126   4e-30   
gb|KHJ49442.1|  hypothetical protein D918_00568                         127   4e-30   
gb|AJO93829.1|  Ssa1p                                                   126   4e-30   
gb|AJO96221.1|  Ssa1p                                                   126   4e-30   
gb|EGA59895.1|  Ssa1p                                                   126   4e-30   
gb|EGA63465.1|  Ssa1p                                                   126   4e-30   
gb|EDN59758.1|  stress-seventy subfamily A protein                      126   4e-30   
emb|CAA47886.1|  HS24/P52                                               124   4e-30   
ref|XP_009560733.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    127   4e-30   
gb|AHY74361.1|  Ssa1p                                                   126   4e-30   
gb|AJO93117.1|  Ssa1p                                                   126   4e-30   
gb|AJO98092.1|  Ssa1p                                                   126   4e-30   
gb|AJO97872.1|  Ssa1p                                                   126   4e-30   
gb|AJO96370.1|  Ssa1p                                                   126   4e-30   
gb|KII89044.1|  hypothetical protein PLICRDRAFT_109952                  126   5e-30   
gb|AJO92970.1|  Ssa1p                                                   126   5e-30   
ref|NP_498868.1|  Protein C30C11.4                                      127   5e-30   
gb|KIL68610.1|  hypothetical protein M378DRAFT_158432                   125   5e-30   
ref|XP_009560725.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    127   5e-30   
gb|ETW31578.1|  hsp70-like protein                                      126   5e-30   
ref|XP_003405063.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    127   5e-30   
gb|ABD85255.1|  heat shock protein 70                                   119   5e-30   
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          126   5e-30   
gb|EKC30577.1|  hypothetical protein CGI_10017255                       125   5e-30   
ref|XP_007863613.1|  heat shock protein 70                              125   5e-30   
gb|AJO96439.1|  Ssa1p                                                   126   5e-30   
ref|XP_004686775.1|  PREDICTED: heat shock 70 kDa protein 4             127   5e-30   
ref|XP_011424694.1|  PREDICTED: heat shock 70 kDa protein 4-like        125   5e-30   
gb|EDM04373.1|  heat shock protein 4, isoform CRA_b                     124   5e-30   
gb|AJO92527.1|  Ssa1p                                                   126   5e-30   
gb|AJO92605.1|  Ssa1p                                                   126   5e-30   
ref|XP_010588220.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    127   5e-30   
ref|XP_004384781.1|  PREDICTED: heat shock 70 kDa protein 4             127   5e-30   
gb|AJO92385.1|  Ssa1p                                                   126   5e-30   
gb|AJO97289.1|  Ssa1p                                                   126   6e-30   
ref|XP_007301367.1|  heat shock protein 70                              125   6e-30   
gb|AJO92307.1|  Ssa1p                                                   126   6e-30   
emb|CBK24438.2|  unnamed protein product                                126   6e-30   
gb|ELK03095.1|  Heat shock 70 kDa protein 4                             121   6e-30   
gb|KIM49447.1|  hypothetical protein M413DRAFT_438630                   125   6e-30   
emb|CDF44000.1|  hypothetical protein BofuT4P114000012001               125   6e-30   
gb|AJO92897.1|  Ssa1p                                                   125   6e-30   
gb|KFD57756.1|  hypothetical protein M513_01426                         127   7e-30   
ref|XP_004420257.1|  PREDICTED: heat shock 70 kDa protein 4             127   7e-30   
ref|XP_005703010.1|  molecular chaperone DnaK                           127   7e-30   
emb|CBK24647.2|  unnamed protein product                                125   7e-30   
ref|XP_004456538.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    126   7e-30   
ref|XP_004456539.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    126   7e-30   
gb|EKF27699.1|  heat shock 70 kDa protein, putative                     122   7e-30   
gb|ACZ95778.1|  heat shock protein 70                                   125   7e-30   
ref|XP_001295355.1|  cytoplasmic heat shock protein 70                  122   8e-30   
gb|KFY50117.1|  hypothetical protein V496_09590                         125   8e-30   
ref|XP_009345467.1|  PREDICTED: heat shock cognate 70 kDa protein...    124   8e-30   
ref|XP_003104191.1|  hypothetical protein CRE_00953                     126   8e-30   
ref|XP_007402330.1|  hypothetical protein PHACADRAFT_265825             125   8e-30   
ref|XP_811549.1|  heat shock 70 kDa protein                             121   8e-30   
gb|KDO55354.1|  hypothetical protein CISIN_1g043296mg                   125   9e-30   
ref|XP_006493389.1|  PREDICTED: heat shock 70 kDa protein-like          125   9e-30   
ref|XP_006872974.1|  PREDICTED: heat shock 70 kDa protein 4             126   9e-30   
gb|KIO13411.1|  hypothetical protein M404DRAFT_992969                   125   9e-30   
ref|XP_004896768.1|  PREDICTED: heat shock 70 kDa protein 4             126   9e-30   
ref|XP_006734734.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    126   9e-30   
ref|XP_002021371.1|  GL25289                                            124   9e-30   
ref|XP_006734733.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    126   1e-29   
ref|XP_007519977.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    126   1e-29   
gb|AAZ05448.1|  Hsp70                                                   119   1e-29   
ref|XP_004408329.1|  PREDICTED: heat shock 70 kDa protein 4             126   1e-29   
gb|KIM65321.1|  hypothetical protein SCLCIDRAFT_541821                  125   1e-29   
gb|AAC84134.1|  heat shock protein                                      118   1e-29   
ref|XP_006923201.1|  PREDICTED: heat shock 70 kDa protein 4             126   1e-29   
gb|KHN76389.1|  Heat shock 70 kDa protein A                             123   1e-29   
ref|XP_008882675.1|  heat shock protein HSP70                           125   1e-29   
ref|XP_011102369.1|  ssa1p                                              125   1e-29   
ref|XP_007519978.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    126   1e-29   
gb|KIJ69340.1|  hypothetical protein HYDPIDRAFT_36410                   125   1e-29   
gb|ELR60264.1|  Heat shock 70 kDa protein 4                             126   1e-29   
ref|XP_006065134.1|  PREDICTED: heat shock 70 kDa protein 4-like        126   1e-29   
ref|XP_005890481.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    126   1e-29   
gb|EPX74268.1|  heat shock protein                                      125   1e-29   
ref|XP_503148.1|  YALI0D22352p                                          125   1e-29   
gb|AJO92679.1|  Ssa1p                                                   125   1e-29   
ref|XP_002168044.1|  PREDICTED: heat shock protein 105 kDa-like         126   1e-29   
ref|XP_006458814.1|  heat shock HSP70 protein                           125   1e-29   
gb|KIK31153.1|  hypothetical protein PISMIDRAFT_134034                  124   1e-29   
emb|CCM02852.1|  predicted protein                                      124   1e-29   
ref|NP_001107664.1|  heat shock 70 kDa protein 4                        126   1e-29   
gb|ACC93947.1|  heat-shock protein 70                                   125   1e-29   
gb|KIJ17459.1|  hypothetical protein PAXINDRAFT_73182                   124   1e-29   
gb|AAA02807.1|  heat shock protein 70                                   125   1e-29   
emb|CAA81135.1|  heat shock protein                                     125   1e-29   
gb|AAC26629.1|  heat shock protein 70                                   125   1e-29   
ref|XP_011104412.1|  ssa2p                                              125   1e-29   
gb|AAC72001.1|  heat shock protein 70                                   125   1e-29   
ref|XP_002911943.1|  heat shock protein                                 124   1e-29   
ref|XP_008140583.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    125   1e-29   
ref|XP_011135643.1|  PREDICTED: heat shock 70 kDa protein cognate...    125   1e-29   
ref|XP_002365977.1|  heat shock protein 70, putative                    125   1e-29   
ref|XP_003980811.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    125   1e-29   
ref|XP_002172440.1|  heat shock protein S                               125   1e-29   
emb|CDJ62090.1|  Heat shock protein, related                            125   1e-29   
ref|NP_001083317.1|  heat shock 70kDa protein 4                         125   1e-29   
gb|KIK97082.1|  hypothetical protein PAXRUDRAFT_137049                  124   1e-29   
ref|XP_001314691.1|  cytoplasmic heat shock protein 70                  125   1e-29   
ref|XP_006888134.1|  PREDICTED: heat shock 70 kDa protein 4-like        125   1e-29   
ref|XP_008140579.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    125   1e-29   
gb|AEF30000.1|  heat shock protein 70                                   125   1e-29   
ref|XP_003035960.1|  hypothetical protein SCHCODRAFT_65817              124   1e-29   
ref|XP_008140572.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    125   2e-29   
ref|XP_004745039.1|  PREDICTED: heat shock 70 kDa protein 4             125   2e-29   
gb|EDL33604.1|  heat shock protein 4, isoform CRA_d                     125   2e-29   
ref|NP_001041481.1|  heat shock 70 kDa protein 4                        125   2e-29   
ref|XP_003870868.1|  Hsp70 hsp70 chaperone                              119   2e-29   
gb|KDR81815.1|  hypothetical protein GALMADRAFT_240042                  124   2e-29   
ref|XP_001324527.1|  cytoplasmic heat shock protein 70                  125   2e-29   
gb|AAZ05449.1|  Hsp70                                                   118   2e-29   
ref|XP_007461414.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    125   2e-29   
ref|XP_003292454.1|  hypothetical protein DICPUDRAFT_57975              125   2e-29   



>ref|XP_009761607.1| PREDICTED: heat shock 70 kDa protein 15-like, partial [Nicotiana 
sylvestris]
Length=263

 Score =   291 bits (745),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 159/187 (85%), Gaps = 8/187 (4%)
 Frame = +3

Query  33   EERVLEYTCALLLARSFRHFLL--CLLPVFRSVGL*LLLATKMSVVGFDVGNESCVVAVA  206
            + R LE+    +L   F+ F++  CL    R V L   +  KMSVVGFD GNES VVAVA
Sbjct  47   QSRTLEHRFQKILFYVFKEFVITDCLT---RGVAL---MPAKMSVVGFDFGNESGVVAVA  100

Query  207  RQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNPKNTISQVKRLIGRQFSDP  386
            RQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNPKNTISQ+KRLIGRQFSDP
Sbjct  101  RQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNPKNTISQIKRLIGRQFSDP  160

Query  387  ELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGMVLSNLKSIAETNLNAAVV  566
            ELQRDLK+ PFSVTEGPDG+PLIHARYLGEMRTFTPTQVLGMV S+LK+IAE NLNAAVV
Sbjct  161  ELQRDLKALPFSVTEGPDGYPLIHARYLGEMRTFTPTQVLGMVFSDLKTIAEKNLNAAVV  220

Query  567  DCCIGIP  587
            DCCIGIP
Sbjct  221  DCCIGIP  227



>ref|XP_011072334.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
 ref|XP_011072335.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
Length=845

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAATSMMNP
Sbjct  1    MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAATSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQRDLKS PF VTEGPDG+PLIHARYLGE RTFTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKSLPFLVTEGPDGYPLIHARYLGETRTFTPTQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIP  145



>ref|XP_007024113.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
 gb|EOY26735.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
Length=575

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PFSVTEGPDG+PLIHARYLGEM+TFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFSVTEGPDGYPLIHARYLGEMKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLS+LKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIP  145



>gb|KJB35057.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=628

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V SNLKSIAE NL AAVVDCCIGIP
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIP  145



>gb|KHG16619.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=855

 Score =   288 bits (736),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIP  145



>ref|XP_007024112.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
 gb|EOY26734.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
Length=860

 Score =   286 bits (733),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PFSVTEGPDG+PLIHARYLGEM+TFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFSVTEGPDGYPLIHARYLGEMKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLS+LKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIP  145



>ref|XP_002528199.1| Heat shock 70 kDa protein, putative [Ricinus communis]
 gb|EEF34206.1| Heat shock 70 kDa protein, putative [Ricinus communis]
Length=849

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GRQFSDPELQ+DLKS PF+VTEGPDGFPLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLVGRQFSDPELQKDLKSLPFAVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLS+LK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSDLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_010539495.1| PREDICTED: heat shock 70 kDa protein 15-like [Tarenaya hassleriana]
Length=866

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 144/149 (97%), Gaps = 0/149 (0%)
 Frame = +3

Query  141  LATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATS  320
            +  KMSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++
Sbjct  17   IKAKMSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAAST  76

Query  321  MMNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQ  500
            MMNPK+++SQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQ
Sbjct  77   MMNPKSSVSQIKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGEMRTFTPTQ  136

Query  501  VLGMVLSNLKSIAETNLNAAVVDCCIGIP  587
            V+GMVLSNLKSIAE NLNAAVVDCCIGIP
Sbjct  137  VMGMVLSNLKSIAENNLNAAVVDCCIGIP  165



>gb|KJB70511.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=749

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRSFTPTQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VL NLKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLLNLKSIAEKNLNAAVVDCCIGIP  145



>gb|KJB35056.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
 gb|KJB35058.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=856

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V SNLKSIAE NL AAVVDCCIGIP
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIP  145



>gb|KHG16198.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=856

 Score =   285 bits (729),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V SNLKSIAE NL AAVVDCCIGIP
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIP  145



>gb|KDP37205.1| hypothetical protein JCGZ_06261 [Jatropha curcas]
Length=847

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+V+EGPDGFPLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQKDLKSLPFAVSEGPDGFPLIHARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_009624163.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=854

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK+IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIP  145



>gb|KJB70509.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
 gb|KJB70510.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=855

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRSFTPTQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VL NLKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLLNLKSIAEKNLNAAVVDCCIGIP  145



>ref|XP_010521527.1| PREDICTED: heat shock 70 kDa protein 15 [Tarenaya hassleriana]
Length=832

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS P++VTEGPDG+PLIHAR+LGEMRTFTPTQV+GM
Sbjct  61   KNSISQMKRLIGRQFSDPELQRDIKSLPYTVTEGPDGYPLIHARFLGEMRTFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAETNLNAAVVDCCIGIP
Sbjct  121  VLSNLKSIAETNLNAAVVDCCIGIP  145



>ref|XP_010538015.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
 ref|XP_010538016.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
Length=829

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+++SQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQV+GM
Sbjct  61   KSSVSQIKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGEMRTFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKSIAENNLNAAVVDCCIGIP  145



>ref|XP_011080863.1| PREDICTED: heat shock 70 kDa protein 14-like [Sesamum indicum]
Length=856

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPALVCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQRDLKS PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKSLPFLVTEGPDGYPLIHARYLGENRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_003546366.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
 gb|KHM98765.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=863

 Score =   282 bits (722),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLK+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKTFPFVVTEGPDGYPLIHARYLGEARTFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIP  145



>gb|KDO51190.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=726

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK+IAE+NLNAAVVDCCIGIP
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIP  145



>ref|XP_006389708.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
 gb|ESQ26994.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
Length=569

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA++CFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIICFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+P+IHARYLGEMR FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPMIHARYLGEMRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE N+NAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNMNAAVVDCCIGIP  145



>ref|XP_004252333.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=846

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQRDLK+ PF VTEGPDG+PLIHARYLGEMRTFTPTQV+GM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKALPFLVTEGPDGYPLIHARYLGEMRTFTPTQVVGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK+IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIP  145



>gb|ACF83633.1| unknown [Zea mays]
Length=293

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIP  145



>gb|KDO51188.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=833

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK+IAE+NLNAAVVDCCIGIP
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIP  145



>gb|KDO51189.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=852

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK+IAE+NLNAAVVDCCIGIP
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIP  145



>ref|XP_006427039.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
 gb|ESR40279.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
Length=852

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK+IAE+NLNAAVVDCCIGIP
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIP  145



>ref|XP_009610837.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Nicotiana 
tomentosiformis]
Length=780

 Score =   278 bits (712),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGR+FSDPELQRD+K+ PFSVTEGPDG+PLIHA YLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFSDPELQRDIKALPFSVTEGPDGYPLIHALYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK+IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIP  145



>ref|XP_006465548.1| PREDICTED: heat shock 70 kDa protein 14-like [Citrus sinensis]
Length=852

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK+IAE+NLNAAVVDCCIGIP
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIP  145



>ref|XP_010691292.1| PREDICTED: heat shock 70 kDa protein 15-like [Beta vulgaris subsp. 
vulgaris]
Length=850

 Score =   279 bits (713),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQ+SDPELQRDLKS PF+V EGPDGFPLIHARYLGE R FTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQYSDPELQRDLKSLPFTVAEGPDGFPLIHARYLGETRAFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLKSIA  NLNAAVVDCCIGIP
Sbjct  121  LFSNLKSIAAQNLNAAVVDCCIGIP  145



>ref|XP_009610834.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610835.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610836.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=856

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGR+FSDPELQRD+K+ PFSVTEGPDG+PLIHA YLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFSDPELQRDIKALPFSVTEGPDGYPLIHALYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK+IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIP  145



>ref|XP_002279789.2| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654673.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654674.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
Length=848

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPDG+PLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNSISQMKRLIGRQFSDPELQQDLKSLPFTVTEGPDGYPLIHARYLGEVRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MFSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_010925328.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=851

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQRDL+S PF VTEG DGFPLIHARYLGE RTFTPTQVL M
Sbjct  61   KNSISQIKRLVGRKFSDPELQRDLQSLPFLVTEGADGFPLIHARYLGEQRTFTPTQVLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NL+AAVVDCCIGIP
Sbjct  121  VLSNLKSIAEKNLSAAVVDCCIGIP  145



>ref|XP_010249783.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010249784.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=850

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQ+DLK+ PF+VTEGPDG+PLIHARYLGE R FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQQDLKALPFTVTEGPDGYPLIHARYLGESRVFTPTQLLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLS+LKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIP  145



>gb|EPS63387.1| hypothetical protein M569_11394, partial [Genlisea aurea]
Length=391

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPALVCFG+KQRFLGTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAASSLMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+SQ+KRLIGR+FSDPELQ DLK  PFSV+EGPDGFPLIHARYL E + FTPTQVLGM
Sbjct  61   KNTVSQIKRLIGRKFSDPELQSDLKVLPFSVSEGPDGFPLIHARYLRENKAFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V SNLKSIAE NLNAAVVDCCIGIP
Sbjct  121  VFSNLKSIAEKNLNAAVVDCCIGIP  145



>ref|XP_009801414.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana sylvestris]
Length=846

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGR+F DPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMR+FTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFLDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRSFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIP  145



>gb|KHN32604.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=862

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQF+DPELQ+D+K+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFADPELQQDIKTFPFVVTEGPDGYPLIHARYLGESRTFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIP  145



>ref|XP_010915054.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=853

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFVGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQ+KRL+GR+FSDPELQRDL+S PF VTEGPDGFPLIHARYLGE RTFTPTQVL M
Sbjct  61   KNSVSQIKRLLGRKFSDPELQRDLQSLPFLVTEGPDGFPLIHARYLGEQRTFTPTQVLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLS+LKSIAE NL AAVVDCCIGIP
Sbjct  121  VLSDLKSIAEKNLGAAVVDCCIGIP  145



>ref|XP_008354138.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=558

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_003543647.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
Length=863

 Score =   278 bits (710),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQF+DPELQ+D+K+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFADPELQQDIKTFPFVVTEGPDGYPLIHARYLGESRTFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIP  145



>ref|XP_006346576.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum tuberosum]
Length=847

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQ+DLK+ PF VTEGPDG+PLIHA YLGEMRTFTPTQV+GM
Sbjct  61   KNTISQIKRLIGRQFSDPELQKDLKALPFLVTEGPDGYPLIHAHYLGEMRTFTPTQVVGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK+IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIP  145



>ref|XP_007150665.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
 gb|ESW22659.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
Length=865

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAAT+MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAATTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+K LIGRQFSDPELQRDLK++PF VTEGPDG+PLIHARYLG+++TFTPTQV GM
Sbjct  61   KNSISQIKSLIGRQFSDPELQRDLKTYPFLVTEGPDGYPLIHARYLGDVKTFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIP  145



>ref|XP_010254149.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254150.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254151.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=851

 Score =   277 bits (709),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FGEKQRF+GTAGAA++ MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVSFGEKQRFIGTAGAASTTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQLKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGESRVFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIP  145



>ref|XP_006300740.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
 gb|EOA33638.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
Length=828

 Score =   276 bits (707),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGEMR FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEMRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_004252334.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
 ref|XP_010314276.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=852

 Score =   276 bits (707),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQRD+K+ PF VTEGPDG+PLIHARYLGE+RTFTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKTLPFLVTEGPDGYPLIHARYLGEVRTFTPTQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK+IAE NLNA VVDCCIGIP
Sbjct  121  VFSDLKTIAEKNLNAVVVDCCIGIP  145



>ref|XP_009587742.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=844

 Score =   276 bits (707),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGR+F DPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRKFVDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRSFTPTQLLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIP  145



>emb|CDO98063.1| unnamed protein product [Coffea canephora]
Length=858

 Score =   276 bits (707),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGR FSDPELQRDLK+ PF+VTEGPDGFPLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNTISQMKRLIGRPFSDPELQRDLKALPFTVTEGPDGFPLIHARYLGELRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LKSIA+ NLNAAVVDCCIGIP
Sbjct  121  VFSDLKSIAQKNLNAAVVDCCIGIP  145



>ref|XP_002304187.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE79166.1| heat shock protein 70 [Populus trichocarpa]
Length=858

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK IA+ NLNAAVVDCCIGIP
Sbjct  121  VFSDLKIIAQKNLNAAVVDCCIGIP  145



>emb|CDY43337.1| BnaC04g25190D [Brassica napus]
Length=889

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  144  ATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSM  323
            A +MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++M
Sbjct  73   ALRMSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTM  132

Query  324  MNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQV  503
            MNPKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV
Sbjct  133  MNPKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQV  192

Query  504  LGMVLSNLKSIAETNLNAAVVDCCIGIP  587
            +GM+LSNLK IAE NLNAAVVDCCIGIP
Sbjct  193  MGMMLSNLKGIAEKNLNAAVVDCCIGIP  220



>ref|XP_010033884.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53736.1| hypothetical protein EUGRSUZ_J02991 [Eucalyptus grandis]
Length=874

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDSGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGR+FSDPELQRDL+S PF VTEGP+G+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRKFSDPELQRDLQSLPFQVTEGPEGYPLIHARYLGESRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MFSNLKGIAEKNLNAAVVDCCIGIP  145



>gb|EYU21549.1| hypothetical protein MIMGU_mgv1a001311mg [Erythranthe guttata]
Length=842

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQRD+KS PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKSLPFLVTEGPDGYPLIHARYLGETRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK IAE NLN AVVDCCIGIP
Sbjct  121  VFSDLKIIAEKNLNTAVVDCCIGIP  145



>ref|XP_010430044.1| PREDICTED: heat shock 70 kDa protein 15 [Camelina sativa]
Length=830

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_006346577.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346578.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Solanum 
tuberosum]
Length=849

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE  VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNERGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQRD+K+ PF VTEGPDG+PLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKTLPFLVTEGPDGYPLIHARYLGEVRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK+IAE NLNA VVDCCIGIP
Sbjct  121  VFSDLKTIAEKNLNAVVVDCCIGIP  145



>ref|XP_006392781.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
 gb|ESQ30067.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
Length=829

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGERRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_008793460.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=854

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLN+ESKRETPA+VCFGEKQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGEKQRFVGTAGAASSLMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQ+KRL+GR+FSDPELQRDL+S PF VTEGPDGFPLIHARYLGE R FTPTQVL M
Sbjct  61   KNSVSQIKRLLGRKFSDPELQRDLQSLPFLVTEGPDGFPLIHARYLGEQRAFTPTQVLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NL AAVVDCCIGIP
Sbjct  121  VLSNLKSIAEKNLGAAVVDCCIGIP  145



>emb|CDX76065.1| BnaA04g03290D [Brassica napus]
Length=814

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_010473008.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=830

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_010473009.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_010417777.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Camelina 
sativa]
Length=829

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_010417776.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Camelina 
sativa]
Length=829

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_010033879.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53729.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
 gb|KCW53730.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
Length=851

 Score =   275 bits (702),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+V VARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVGVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+G++F+DPELQRDL+S PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNSISQMKRLVGQKFADPELQRDLQSLPFHVTEGPDGYPLIHARYLGEARTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLKSIAE NLNAAVVDCCIGIP
Sbjct  121  MFSNLKSIAEKNLNAAVVDCCIGIP  145



>ref|XP_010098045.1| Heat shock 70 kDa protein 15 [Morus notabilis]
 gb|EXB74482.1| Heat shock 70 kDa protein 15 [Morus notabilis]
Length=860

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLG 
Sbjct  61   KNSISQIKRLIGRQFSDPELQKDLKSLPFTVTEGPDGYPLIHARYLGEARTFTPTQVLGT  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V ++LK IAE NLNAAVVDCCIGIP
Sbjct  121  VFADLKVIAEKNLNAAVVDCCIGIP  145



>gb|EYU24689.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=573

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDES R TPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESNRLTPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQ D+KS PFSVTEGPDG+PLIHA YLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQHDIKSLPFSVTEGPDGYPLIHAHYLGESRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_010430043.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFS+TEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSITEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>gb|EPS59607.1| hypothetical protein M569_15197, partial [Genlisea aurea]
Length=534

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTA AA+S+MNP
Sbjct  6    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFLGTAAAASSLMNP  65

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+SQVKRLIGR+FSDPELQ DLK+ PFSV+EGPDG+PLIHARYLGE  TFTPTQVLGM
Sbjct  66   KNTVSQVKRLIGRKFSDPELQSDLKALPFSVSEGPDGYPLIHARYLGETTTFTPTQVLGM  125

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V SNLKSIAE NLNA V DCCIGIP
Sbjct  126  VFSNLKSIAEKNLNAVVADCCIGIP  150



>ref|XP_011000832.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Populus 
euphratica]
Length=789

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRLFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V ++LK I + NLNAAVVDCCIGIP
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIP  145



>gb|AAG52244.1|AC011717_12 putative heat-shock protein; 41956-44878 [Arabidopsis thaliana]
Length=736

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN AVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIP  145



>ref|XP_009388669.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+SQ+KRLIGR+FSDPELQRD++S PF VTEGPDGFPLIH  YLGE RTFTPTQ+L M
Sbjct  61   KNTVSQIKRLIGRKFSDPELQRDIQSLPFKVTEGPDGFPLIHVNYLGEQRTFTPTQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLS+LK IAE N++AAVVDCCIGIP
Sbjct  121  VLSDLKGIAEKNMHAAVVDCCIGIP  145



>gb|AAL38353.1| putative heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN AVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIP  145



>ref|NP_850984.4| Heat shock protein 70 [Arabidopsis thaliana]
 sp|F4HQD4.1|HSP7P_ARATH RecName: Full=Heat shock 70 kDa protein 15; AltName: Full=Heat 
shock protein 70-15; Short=AtHsp70-15 [Arabidopsis thaliana]
 gb|AEE36325.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN AVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIP  145



>ref|XP_009147592.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
 ref|XP_009147593.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
Length=818

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GN++C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNDNCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_007217050.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
 gb|EMJ18249.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
Length=855

 Score =   274 bits (700),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFG+KQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGDKQRFIGTAGAASSLMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDP +QRD+KS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPVVQRDIKSLPFAVTEGPDGYPLIHARYLGESRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_008228510.1| PREDICTED: heat shock 70 kDa protein 15-like [Prunus mume]
Length=855

 Score =   274 bits (700),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFG+KQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGDKQRFIGTAGAASSLMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDP +QRD+KS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPVVQRDIKSLPFAVTEGPDGYPLIHARYLGESRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_009408938.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408939.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   274 bits (700),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSVMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+SQ+KRL+GR+FSDPELQRD++S PF VTEG DGFPLIHA YLGE+R FTPTQ+L M
Sbjct  61   KNTVSQIKRLVGRKFSDPELQRDIQSLPFKVTEGRDGFPLIHANYLGELRAFTPTQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK+IAETNL+AAVVDCCIGIP
Sbjct  121  VLSNLKTIAETNLHAAVVDCCIGIP  145



>ref|XP_009139126.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
 ref|XP_009139127.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
Length=814

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GRQFSDP+LQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPDLQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|NP_178110.6| Heat shock protein 70 [Arabidopsis thaliana]
 gb|AEE36326.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN AVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIP  145



>emb|CDY24089.1| BnaA06g00870D [Brassica napus]
Length=858

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  150  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  329
            +MSVVGFD GN++C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMN
Sbjct  40   RMSVVGFDFGNDNCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMN  99

Query  330  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  509
            PKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+G
Sbjct  100  PKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMG  159

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LSNLK IAE NLNAAVVDCCIGIP
Sbjct  160  MMLSNLKGIAEKNLNAAVVDCCIGIP  185



>emb|CDY45119.1| BnaC06g06400D [Brassica napus]
Length=956

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  150  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  329
            +MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMN
Sbjct  140  RMSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMN  199

Query  330  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  509
            PKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+G
Sbjct  200  PKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMG  259

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LSNLK IAE NLNAAVVDCCIGIP
Sbjct  260  MMLSNLKGIAEKNLNAAVVDCCIGIP  285



>ref|XP_002887853.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64112.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
Length=830

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVT+GPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTQGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|NP_001031305.1| heat shock protein 91 [Arabidopsis thaliana]
 dbj|BAE98929.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AEE36328.1| heat shock protein 91 [Arabidopsis thaliana]
Length=789

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN AVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIP  145



>ref|XP_011000830.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011000831.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
Length=859

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRLFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V ++LK I + NLNAAVVDCCIGIP
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIP  145



>ref|XP_006287070.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
 gb|EOA19968.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
Length=828

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVT+GPDG+PLIHA YLG+MR FTPTQ++GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTQGPDGYPLIHANYLGDMRAFTPTQLMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_009389931.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=849

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQ+KRL+GR+FSDPE+Q+D++SFPF VTEGPDGF LIHA YLGE R FTPTQ+L M
Sbjct  61   KNSVSQIKRLLGRKFSDPEVQKDIQSFPFRVTEGPDGFALIHANYLGEQRAFTPTQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIP  145



>ref|NP_178111.1| heat shock protein 91 [Arabidopsis thaliana]
 sp|Q9S7C0.1|HSP7O_ARATH RecName: Full=Heat shock 70 kDa protein 14; AltName: Full=Heat 
shock protein 70-14; Short=AtHsp70-14; AltName: Full=Heat 
shock protein 91 [Arabidopsis thaliana]
 gb|AAD55461.1|AC009322_1 Heat-shock protein [Arabidopsis thaliana]
 gb|AAG52240.1|AC011717_8 putative heat-shock protein; 37113-40399 [Arabidopsis thaliana]
 gb|AAL84971.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AAO11541.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AEE36327.1| heat shock protein 91 [Arabidopsis thaliana]
Length=831

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN AVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIP  145



>emb|CCM07272.1| Putative 97 kDa heat shock protein [Musa balbisiana]
Length=845

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+SQ+KRLIGR+FSDPELQRD++S PF VTEGPDGFPLIH  YLGE RTFTPTQ+L M
Sbjct  61   KNTVSQIKRLIGRKFSDPELQRDIQSLPFKVTEGPDGFPLIHVNYLGEQRTFTPTQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLS+LK IAE N++A VVDCCIGIP
Sbjct  121  VLSDLKRIAEKNMHATVVDCCIGIP  145



>ref|XP_008786326.1| PREDICTED: heat shock 70 kDa protein 15-like [Phoenix dactylifera]
Length=854

 Score =   271 bits (694),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQ+KRL+GR+FSDPELQRDL+S  F V+EGPDGFPLIHARYLGE R FTPTQVL M
Sbjct  61   KNSVSQIKRLVGRKFSDPELQRDLQSLSFLVSEGPDGFPLIHARYLGEQRAFTPTQVLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NL AAVVDCCIGIP
Sbjct  121  VLSNLKSIAEKNLGAAVVDCCIGIP  145



>ref|XP_011013254.1| PREDICTED: heat shock 70 kDa protein 15-like [Populus euphratica]
Length=852

 Score =   271 bits (693),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGR FSDPELQRDLKS PF+VTEGPDGFPLI ARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLKSLPFTVTEGPDGFPLIQARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V ++LK I + NLNAAVVDCCIGIP
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIP  145



>emb|CAA94389.1| heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   270 bits (691),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+GFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+ +RF+GTAGAA++MMNP
Sbjct  1    MSVIGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDNERFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGRQFSDPELQRD+KSFPFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSFPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN AVVDCCIGIP
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIP  145



>gb|EYU24688.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=840

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES VVAVARQRGIDVVLNDES R TPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESNRLTPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIGRQFSDPELQ D+KS PFSVTEGPDG+PLIHA YLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQHDIKSLPFSVTEGPDGYPLIHAHYLGESRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_002439385.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
 gb|EES17815.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
Length=842

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+HARYLGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHARYLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLN AVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNTAVVDCCIGIP  145



>ref|XP_003597778.1| 97 kDa heat shock protein [Medicago truncatula]
 ref|XP_003597784.1| 97 kDa heat shock protein [Medicago truncatula]
 gb|AES68029.1| heat shock 70 kDa protein [Medicago truncatula]
Length=858

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIG++F+DPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FT TQV GM
Sbjct  61   KNSISQIKRLIGKKFADPELQRDLKSLPFNVTEGPDGYPLIHARYLGESREFTATQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IA+ NLNAAVVDCCIGIP
Sbjct  121  MLSNLKEIAQKNLNAAVVDCCIGIP  145



>gb|AFW81561.1| hypothetical protein ZEAMMB73_352123 [Zea mays]
Length=564

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NL  AVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIP  145



>ref|NP_001147805.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACG28747.1| heat shock 70 kDa protein 4 [Zea mays]
Length=833

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIP  145



>ref|XP_008654914.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=833

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIP  145



>ref|XP_004506856.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=851

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIG+QFSDPE+Q DLKS PFSVTEGPDG+PLIHARYLGE++TFTPTQV  M
Sbjct  61   KNSISQIKRLIGKQFSDPEVQGDLKSLPFSVTEGPDGYPLIHARYLGEVKTFTPTQVFAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IA+ NLNA V DCCIGIP
Sbjct  121  MLSNLKEIAQKNLNAGVNDCCIGIP  145



>ref|XP_004960855.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Setaria 
italica]
Length=845

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF V+EGPDGFPL+HARYLGE + FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVSEGPDGFPLVHARYLGEEQAFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKVIAEGNLNAAVVDCCIGIP  145



>ref|XP_006842242.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
 gb|ERN03917.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
Length=855

 Score =   268 bits (686),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S+MN 
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSLMNI  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQ+KRLIGR+FSDPELQRDL++F F VTEGPDGFPLIH RYLGE + FTPTQVLGM
Sbjct  61   KNSVSQIKRLIGRRFSDPELQRDLQAFAFLVTEGPDGFPLIHVRYLGESKLFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  ILSNLKGIAEKNLNAAVVDCCIGIP  145



>ref|XP_009358190.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_006643833.1| PREDICTED: heat shock 70 kDa protein 14-like [Oryza brachyantha]
Length=843

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGR+FSDPELQ DL +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSISQIKRLIGRKFSDPELQSDLAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK+IAE+NLNAAV DCCIGIP
Sbjct  121  VLSNLKAIAESNLNAAVADCCIGIP  145



>ref|XP_010925584.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
 ref|XP_010932975.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=852

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQVKRLIGR+FSDPELQRDL+S PF VTEGPDG+PLIHA YLGE +TF PTQVLGM
Sbjct  61   KNSVSQVKRLIGRKFSDPELQRDLQSLPFLVTEGPDGYPLIHASYLGEKKTFMPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK +AE NLN AVVDCCIGIP
Sbjct  121  ILSNLKGMAEKNLNNAVVDCCIGIP  145



>ref|XP_009358191.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
 ref|XP_009358192.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_004960853.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Setaria 
italica]
Length=850

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIP  145



>ref|XP_004960852.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Setaria 
italica]
Length=878

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIP  145



>ref|XP_004506857.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=849

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIG+QFSDP++Q DLKS PFSVTEGPDG+PLIHARYLGE++TFTPTQV  M
Sbjct  61   KNSISQIKRLIGKQFSDPDVQGDLKSLPFSVTEGPDGYPLIHARYLGEVKTFTPTQVFAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN  V DCCIGIP
Sbjct  121  MLSNLKEIAEKNLNTGVNDCCIGIP  145



>ref|XP_003529646.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Glycine 
max]
 ref|XP_006582999.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Glycine 
max]
 gb|KHN39337.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=857

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGR+F+DPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQIKRLIGRKFADPELQRDLKSLPFLVTEGSDGYPLIHARYMGEAKTFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NL  AVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIP  145



>ref|XP_008647466.1| PREDICTED: uncharacterized protein LOC100217188 isoform X1 [Zea 
mays]
 gb|AFW77385.1| heat shock protein 4 [Zea mays]
Length=841

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR++SDPE+QRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKYSDPEVQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIP  145



>gb|KHN47807.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=816

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NL  AVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIP  145



>ref|XP_002440718.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
 gb|EES19148.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
Length=851

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLN AVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNTAVVDCCIGIP  145



>ref|XP_002299641.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE84446.1| heat shock protein 70 [Populus trichocarpa]
Length=852

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+ +VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENSLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIGR FSDPELQRDL+S PF+VTEGPDGFPLI ARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLRSLPFTVTEGPDGFPLIQARYLGEMRTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V ++LK I + NLNAAVVDCCIGIP
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIP  145



>ref|XP_008362708.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQRGIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_006585595.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Glycine 
max]
Length=850

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NL  AVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIP  145



>ref|XP_009399777.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=851

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGA +S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGATSSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQ+KRL+GR+FSDPE+QRD++  PF VTEGPDGFPLIHA YLGE +TF+PTQ+L M
Sbjct  61   KNSVSQIKRLVGRKFSDPEVQRDIQLVPFKVTEGPDGFPLIHANYLGEQKTFSPTQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NLNAAV+DCCIG+P
Sbjct  121  VLSNLKSIAENNLNAAVMDCCIGVP  145



>ref|XP_003531683.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Glycine 
max]
Length=852

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NL  AVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIP  145



>ref|XP_008371663.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQRGIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIP  145



>ref|XP_010231645.1| PREDICTED: heat shock 70 kDa protein 14-like [Brachypodium distachyon]
Length=843

 Score =   266 bits (679),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+F+DPELQ DL+SFPF V+EGPDGFPL+HARYLGE R+FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFTDPELQHDLQSFPFHVSEGPDGFPLVHARYLGEERSFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLN+AV+DCCIGIP
Sbjct  121  VLSNLKGIAEGNLNSAVIDCCIGIP  145



>gb|EAY72790.1| hypothetical protein OsI_00654 [Oryza sativa Indica Group]
Length=813

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQ+KRL+GR++SDPELQRD+ +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSVSQIKRLLGRKYSDPELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE+NLN AVVDCCIGIP
Sbjct  121  VLSNLKGIAESNLNTAVVDCCIGIP  145



>ref|NP_001151579.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACN33614.1| unknown [Zea mays]
Length=848

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFHVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NL  AVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIP  145



>ref|NP_001042210.1| Os01g0180800 [Oryza sativa Japonica Group]
 dbj|BAB32902.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAB33024.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAF04124.1| Os01g0180800 [Oryza sativa Japonica Group]
 gb|EAZ10794.1| hypothetical protein OsJ_00630 [Oryza sativa Japonica Group]
 gb|ADR66977.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=845

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQ+KRL+GR++SDPELQRD+ +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSVSQIKRLLGRKYSDPELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE+NLN AVVDCCIGIP
Sbjct  121  VLSNLKGIAESNLNTAVVDCCIGIP  145



>ref|XP_008775317.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=852

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQVKRLIGR+FSDPELQ D++S PFSVTEGPDG+PLIHA YLGE  TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPELQGDVQSLPFSVTEGPDGYPLIHASYLGEKGTFTPTQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NLN AV DCCIGIP
Sbjct  121  ILSNLKGIAEKNLNNAVADCCIGIP  145



>ref|XP_008462146.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
 ref|XP_008462147.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
Length=844

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FG+KQRF+GTAGAA+ MMN 
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVSFGDKQRFIGTAGAASIMMNI  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQVKRLIGR+FSDP LQ+DL+S PFSVTEGPDGFPL+H RYLGE++TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPGLQKDLQSLPFSVTEGPDGFPLVHVRYLGELKTFTPTQLLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLK IAETNLNAAVVDCCIGIP
Sbjct  121  LFSNLKGIAETNLNAAVVDCCIGIP  145



>gb|ACG43420.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACL52695.1| unknown [Zea mays]
 gb|AFW81562.1| heat shock protein 4 [Zea mays]
Length=848

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NL  AVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIP  145



>ref|XP_007135698.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 ref|XP_007135699.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07692.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07693.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
Length=841

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLG+AGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGSAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIH +YLGE R FTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGNDGYPLIHVQYLGEARKFTPTQVFGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLK IAE NL  AVVDCCIGIP
Sbjct  121  MLSNLKEIAEKNLGTAVVDCCIGIP  145



>ref|XP_004302913.1| PREDICTED: heat shock 70 kDa protein 15-like [Fragaria vesca 
subsp. vesca]
Length=848

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASSMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIG++FSDP LQRD+KS PF+V EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKKFSDPVLQRDIKSLPFAVLEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V S+LK IA+ NLNAAVVDCCIGIP
Sbjct  121  VFSDLKIIAQKNLNAAVVDCCIGIP  145



>gb|EMS61926.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=841

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+HARYLGE   FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQRDLQSFPFRVSEGPDGFPLVHARYLGEEHAFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK+IAE NL +AVVDCCIGIP
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIP  145



>ref|XP_008655087.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=875

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NL  AVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIP  145



>ref|XP_004141777.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 ref|XP_004168280.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 gb|KGN45354.1| hypothetical protein Csa_7G446710 [Cucumis sativus]
Length=843

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FG+KQRF+GTAGAA+ MMN 
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVSFGDKQRFIGTAGAASIMMNI  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN++SQVKRLIGR+FSDP LQ+DL+S PFSV+EGPDGFPL+H RYLGE++TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPGLQKDLQSLPFSVSEGPDGFPLVHVRYLGELKTFTPTQLLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLK IAETNLNAAVVDCCIGIP
Sbjct  121  LFSNLKGIAETNLNAAVVDCCIGIP  145



>gb|EMT09857.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=901

 Score =   264 bits (674),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+HARYLGE   FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQRDLQSFPFRVSEGPDGFPLVHARYLGEEHAFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK+IAE NL +AVVDCCIGIP
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIP  145



>gb|EMT31029.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=842

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+F+DPELQ D+K+FPF V+EGPDGFPL+H RYLGE R+FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQDDIKAFPFRVSEGPDGFPLVHVRYLGEERSFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK+IAE NLN+AV+DCCIGIP
Sbjct  121  VLSNLKAIAEGNLNSAVIDCCIGIP  145



>ref|XP_010231644.1| PREDICTED: heat shock 70 kDa protein 15-like [Brachypodium distachyon]
Length=836

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRL+GR+F+DPE+Q D++SFPF V+EGPDGFPL+HARYLGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFTDPEVQHDIQSFPFRVSEGPDGFPLVHARYLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLN AV DCCIGIP
Sbjct  121  VLSNLKGIAEGNLNTAVSDCCIGIP  145



>ref|XP_008649434.1| PREDICTED: heat shock 70 kDa protein 14-like [Zea mays]
 gb|AFW77407.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=843

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +N+ISQ+KRL+GR+FSDPE+Q D+ SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   RNSISQIKRLLGRKFSDPEVQSDIASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLKSIAE NL  AVVDCCIGIP
Sbjct  121  VLSNLKSIAEGNLKTAVVDCCIGIP  145



>gb|KEH28782.1| heat shock 70 kDa protein [Medicago truncatula]
Length=851

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN+ISQ+KRLIG+ +SDP+LQRDLKS PFSV EGPDG+PLI ARYLGE++ FTPTQV  M
Sbjct  61   KNSISQIKRLIGKLYSDPDLQRDLKSLPFSVAEGPDGYPLIQARYLGEVKMFTPTQVFAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L N+K IAE NLNAAV DCCIGIP
Sbjct  121  MLGNMKEIAEKNLNAAVNDCCIGIP  145



>ref|NP_001054812.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|AAW57812.1| putative heat shock protein Hsp70 [Oryza sativa Japonica Group]
 dbj|BAF16726.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|EEE62549.1| hypothetical protein OsJ_17347 [Oryza sativa Japonica Group]
Length=853

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNES +VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +N++SQ+KRL+GR F+DPELQRDL SFPF V+EGPDGFPL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSVSQIKRLLGRAFADPELQRDLASFPFRVSEGPDGFPLVHARYLGEDRAFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAV DCCIGIP
Sbjct  121  VLSNLKGIAEGNLNAAVFDCCIGIP  145



>ref|XP_008354139.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=834

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNES +VAVARQ  IDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQXXIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NLNAAVVDCCIGIP
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIP  145



>gb|EAY96776.1| hypothetical protein OsI_18700 [Oryza sativa Indica Group]
Length=853

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNES +VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +N++SQ+KRL+GR F+DPELQRDL SFPF V+EGPDGFPL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSVSQIKRLLGRAFADPELQRDLASFPFRVSEGPDGFPLVHARYLGEDRAFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLNAAV DCCIGIP
Sbjct  121  VLSNLKGIAEGNLNAAVFDCCIGIP  145



>gb|AFW77408.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=1186

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  150  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  329
            KMSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MN
Sbjct  343  KMSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMN  402

Query  330  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  509
            P+N+ISQ+KRL+GR+FSDPE+Q D+ SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L 
Sbjct  403  PRNSISQIKRLLGRKFSDPEVQSDIASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLA  462

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            MVLSNLKSIAE NL  AVVDCCIGIP
Sbjct  463  MVLSNLKSIAEGNLKTAVVDCCIGIP  488



>gb|EMS52665.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=1269

 Score =   263 bits (672),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  147  TKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMM  326
            ++MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S M
Sbjct  159  SEMSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTM  218

Query  327  NPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVL  506
            NPKN+ISQ+KRL+GR+F+DPELQ D+K+FPF V+EGPDGFPL+H RYLGE R+FTPTQ+L
Sbjct  219  NPKNSISQIKRLLGRKFADPELQNDIKAFPFRVSEGPDGFPLVHVRYLGEERSFTPTQLL  278

Query  507  GMVLSNLKSIAETNLNAAVVDCCIGIP  587
             MVLSNLK+IAE NLN+AV+DCCIGIP
Sbjct  279  AMVLSNLKAIAEGNLNSAVIDCCIGIP  305



>dbj|BAJ90753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=835

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
             N+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+ ARYLGE   FTPTQ+L M
Sbjct  61   NNSISQIKRLLGRKFADPELQRDLQSFPFLVSEGPDGFPLVQARYLGEEHAFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK+IAE NL +AVVDCCIGIP
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIP  145



>ref|XP_006654112.1| PREDICTED: heat shock 70 kDa protein 15-like [Oryza brachyantha]
Length=856

 Score =   252 bits (644),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESC+VAVAR RGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARLRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +N+ISQ+KRL+GR F+DPELQRDL SFPF V+EG  G+PL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSISQIKRLLGRSFADPELQRDLGSFPFRVSEGLGGYPLVHARYLGEDRAFTPTQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK IAE NLN AVVDCCIGIP
Sbjct  121  VLSNLKGIAEGNLNCAVVDCCIGIP  145



>ref|XP_001764380.1| predicted protein [Physcomitrella patens]
 gb|EDQ70934.1| predicted protein [Physcomitrella patens]
Length=820

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+C+V VARQRGIDVVLNDESKRETP +V FGEKQRF+G AGAA+++MNP
Sbjct  1    MSVVGFDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFGEKQRFVGVAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ+KR+IGR FSDPELQ DL+ FPFSVTEGPDGFP I+ +YLGE R FTPTQVLGM
Sbjct  61   KNTISQIKRMIGRPFSDPELQNDLRLFPFSVTEGPDGFPSINVQYLGEPRQFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLKSIAE NL  +VVDC IG+P
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVP  145



>ref|XP_001755636.1| predicted protein [Physcomitrella patens]
 gb|EDQ79696.1| predicted protein [Physcomitrella patens]
Length=770

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V F EKQRFLG AGAA++MMNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFAEKQRFLGVAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +NTISQ+KR+IGR FSDPE+Q DL+ FPFSVTEGPDGFPLI+ +YLGE R FTPTQVLGM
Sbjct  61   RNTISQIKRMIGRPFSDPEMQEDLRLFPFSVTEGPDGFPLINVQYLGEPRQFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLKSIAE NL  +VVDC IG+P
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVP  145



>ref|XP_001760080.1| predicted protein [Physcomitrella patens]
 gb|EDQ75205.1| predicted protein [Physcomitrella patens]
Length=816

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V FGEKQRF+G AGAA+++MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGVVSFGEKQRFVGVAGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +NTISQ+KR+IGR FSDPELQ+DL  FPF+VTEGPDG PLI+ +YLGE R FTPTQVLGM
Sbjct  61   RNTISQIKRMIGRSFSDPELQKDLHLFPFTVTEGPDGSPLINVQYLGEPRQFTPTQVLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LSNLKSIAE NL  +VVDC IG+P
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVP  145



>ref|XP_002986462.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
 gb|EFJ12319.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
Length=774

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETPA+V F EKQRFLGTA AA++ MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPAMVSFSEKQRFLGTAAAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +NT+SQ+KRLIGR+F+DPE+Q+DL+  PF+VTE  DG  LIH RYLGE++ FTPTQ+LGM
Sbjct  61   RNTVSQIKRLIGRRFADPEVQKDLQLLPFNVTEAADGTCLIHVRYLGEVKAFTPTQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK+IAETNL   VVDC IGIP
Sbjct  121  VLSNLKTIAETNLGTHVVDCVIGIP  145



>ref|XP_002978946.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
 gb|EFJ19903.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
Length=779

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V F EKQRFLGTA AA++ MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFSEKQRFLGTAAAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +NT+SQ+KRLIGR+F+DPE+Q+DL+  PF+VTE  DG  LIH RYLGE++ FTPTQ+LGM
Sbjct  61   RNTVSQIKRLIGRRFADPEVQKDLQLLPFNVTEAADGTCLIHVRYLGEVKAFTPTQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            VLSNLK+IAETNL   VVDC IGIP
Sbjct  121  VLSNLKTIAETNLGTHVVDCVIGIP  145



>gb|AFG63451.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63452.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63453.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63454.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63455.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63456.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63457.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
Length=124

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGA++S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGASSSLMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KN +SQ+KRLIG+QF DPE+QRDL+S P++V EGPDG   IHARYLG+ R FT TQ+L M
Sbjct  61   KNAVSQIKRLIGKQFRDPEVQRDLQSLPYTVDEGPDGGVRIHARYLGDSRAFTATQILAM  120

Query  513  VLSN  524
            +LSN
Sbjct  121  LLSN  124



>ref|XP_002317001.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
 gb|EEE97613.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
Length=770

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TI QVKRLIGR F DPE+Q +L   PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEVQNELTLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLK I E NL   V DC IG+P
Sbjct  121  LFSNLKDITEKNLEIPVTDCVIGVP  145



>ref|XP_008363587.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=342

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F++P++QRDL+  P   +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLQILPLDTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIP  145



>ref|XP_011030786.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Populus 
euphratica]
Length=770

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MN 
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNL  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TI QVKRLIGR F DPE Q +LK  PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEFQNELKLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLK++ E NL   V DC IGIP
Sbjct  121  LFSNLKNVTEKNLEIPVTDCVIGIP  145



>ref|XP_011030785.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Populus 
euphratica]
Length=771

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MN 
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNL  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TI QVKRLIGR F DPE Q +LK  PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEFQNELKLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + SNLK++ E NL   V DC IGIP
Sbjct  121  LFSNLKNVTEKNLEIPVTDCVIGIP  145



>ref|XP_008353314.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=395

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F++P++QRDL+  P   +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLQILPLDTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIP  145



>ref|XP_008226915.1| PREDICTED: heat shock 70 kDa protein 16 [Prunus mume]
Length=777

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+FS+P++QRDL+  PF  +E PDG  LIH +YLGE  TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFSEPDVQRDLRMLPFQTSEAPDGGILIHLKYLGETHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEIPISDCVIGIP  145



>ref|XP_007213641.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
 gb|EMJ14840.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
Length=777

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+FS+P++QRDL+  PF  +E PDG  LIH +YLGE  TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFSEPDVQRDLRMLPFQTSEAPDGGILIHLKYLGETHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIP  145



>ref|XP_008345050.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=440

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPALVCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVNQWGVDVLLNDESKRETPALVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRL+GR+F++P++QRDL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLMGRKFTEPDVQRDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEMPIXDCVIGIP  145



>gb|KCW67010.1| hypothetical protein EUGRSUZ_F00767 [Eucalyptus grandis]
Length=711

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESNRETPAIVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F+DP++QR+LK  P    EGPDG  LI  +Y GE  TF+PTQV+ M
Sbjct  61   KSTVSQVKRLIGRKFADPDVQRELKMLPVETCEGPDGGILIRIQYAGEKHTFSPTQVMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK IAE NL   V DC IGIP
Sbjct  121  LFAHLKDIAEKNLEIPVSDCVIGIP  145



>ref|XP_004500055.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=770

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG++GAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSSGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR+F DP+++RDLK  P   +EGPDG  LIH +YL    TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFQDPDMERDLKMLPLETSEGPDGGILIHLKYLEGTHTFTPVQIMSM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK++ E +L  ++ DC IGIP
Sbjct  121  LFAHLKTMTEKDLETSISDCVIGIP  145



>ref|XP_010060358.1| PREDICTED: heat shock 70 kDa protein 16 [Eucalyptus grandis]
Length=774

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESNRETPAIVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F+DP++QR+LK  P    EGPDG  LI  +Y GE  TF+PTQV+ M
Sbjct  61   KSTVSQVKRLIGRKFADPDVQRELKMLPVETCEGPDGGILIRIQYAGEKHTFSPTQVMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK IAE NL   V DC IGIP
Sbjct  121  LFAHLKDIAEKNLEIPVSDCVIGIP  145



>ref|XP_003600064.1| Heat shock 70 kDa protein 4L [Medicago truncatula]
 gb|AES70315.1| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKR IGR+F DP++++DLK  P   +EGPDG  LIH +YL  + TFTP Q++ M
Sbjct  61   KSTISQVKRFIGRKFLDPDMEKDLKMLPLETSEGPDGGVLIHLKYLDGIHTFTPVQIMSM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK++ E +L A + DC IGIP
Sbjct  121  LFAHLKTMTEKDLEAPISDCVIGIP  145



>ref|XP_010092150.1| Heat shock 70 kDa protein 16 [Morus notabilis]
 gb|EXB50301.1| Heat shock 70 kDa protein 16 [Morus notabilis]
Length=749

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA+++MNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAVMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIG +FS+P++Q +LK FPF  +E PDG  LIH +YLGE  TFT  Q++ M
Sbjct  61   KSTVSQVKRLIGTKFSEPDIQNELKLFPFETSEAPDGGILIHLKYLGETHTFTLVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++L+ +AE NL   V DC IGIP
Sbjct  121  LFAHLRELAEKNLEILVSDCVIGIP  145



>gb|AII99893.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG++GAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSSGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR+F DP+++RDLK  P   +EGPDG  LIH +YL    TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFQDPDMERDLKMLPLETSEGPDGGILIHLKYLEGTHTFTPVQIMSM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK++ E +L  ++ DC IGIP
Sbjct  121  LFAHLKTMTEKDLETSISDCVIGIP  145



>ref|XP_008366399.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=777

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F++P++QRDL+  PF  +EGPDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLRILPFETSEGPDGGILIHLKYLGXTHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC I IP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIP  145



>ref|XP_004167874.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 16-like 
[Cucumis sativus]
Length=762

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RETPA++ FGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETPAVIYFGEKQRFLGSAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++TISQVKRLIGR FS+P++Q +LK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFSEPDVQIELKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK +AE NL A   DC IGIP
Sbjct  121  LLAHLKDVAEKNLGAPFSDCVIGIP  145



>ref|XP_004151979.1| PREDICTED: heat shock 70 kDa protein 16-like [Cucumis sativus]
 gb|KGN57923.1| hypothetical protein Csa_3G391900 [Cucumis sativus]
Length=762

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RETPA++ FGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETPAVIYFGEKQRFLGSAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++TISQVKRLIGR FS+P++Q +LK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFSEPDVQIELKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK +AE NL A   DC IGIP
Sbjct  121  LLAHLKDVAEKNLGAPFSDCVIGIP  145



>ref|XP_009760615.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
 ref|XP_009760616.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
Length=753

 Score =   216 bits (549),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIAFAKQRGIDVILNDESKRETPAVVSFGEKQRFIGSAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR++ +P +Q+DLK  PF+ +EGPDG  LIH +Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLLPFTTSEGPDGGILIHLQYMNEKQSFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK IAE NL   V DC IGIP
Sbjct  121  LFAHLKQIAEKNLEMDVSDCVIGIP  145



>ref|XP_008355346.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=498

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPALVCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVNQWGVDVLLNDESKRETPALVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRL+GR+F++P++QRDL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLMGRKFTEPDVQRDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIP  145



>ref|XP_007020850.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12375.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=765

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+A  +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            + T+SQVKRLIGR+F +P++Q++L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   QTTVSQVKRLIGRKFREPDVQKELRLLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK I ETNL  +V+DC IGIP
Sbjct  121  LFAHLKYITETNLGVSVLDCVIGIP  145



>gb|EYU27799.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=766

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRFLG+AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQRGIDVLLNDESNRENPAVVSFGEKQRFLGSAGAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR FS+P +Q DL+  PF  +EGPDG  LIH RYL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRNFSEPTVQNDLRLLPFETSEGPDGGILIHLRYLEERQTFTPIQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK IAE NL   + +C IGIP
Sbjct  121  LLAHLKQIAEKNLETQISNCVIGIP  145



>gb|EYU27798.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=722

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRFLG+AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQRGIDVLLNDESNRENPAVVSFGEKQRFLGSAGAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR FS+P +Q DL+  PF  +EGPDG  LIH RYL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRNFSEPTVQNDLRLLPFETSEGPDGGILIHLRYLEERQTFTPIQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK IAE NL   + +C IGIP
Sbjct  121  LLAHLKQIAEKNLETQISNCVIGIP  145



>ref|XP_009352450.1| PREDICTED: heat shock 70 kDa protein 16-like, partial [Pyrus 
x bretschneideri]
Length=736

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQHDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIP  145



>ref|XP_009614255.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana tomentosiformis]
Length=753

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIAFAKQRGIDVILNDESKRETPAVVSFGEKQRFIGSAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR++ +P +Q DLK  PF+ +EGPDG  LIH +Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQMDLKLLPFATSEGPDGGILIHLQYMNEKQSFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK IAE NL   V DC IGIP
Sbjct  121  LFAHLKQIAEKNLEMDVSDCVIGIP  145



>gb|KDP39123.1| hypothetical protein JCGZ_00880 [Jatropha curcas]
Length=771

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+A  +QRGIDV+LNDESKRETPA++CFGE+QR LG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGIDVLLNDESKRETPAVICFGERQRLLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR F DP++Q DLK  PF  + G DG  LIH RYLGE+ TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRNFKDPDVQNDLKLLPFETSGGQDGGILIHLRYLGEIHTFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK I E +L   V DC IGIP
Sbjct  121  LFSHLKEITEKDLEMPVSDCVIGIP  145



>gb|AET00484.2| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AVA+Q G+DV+LN+ES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQGGVDVLLNNESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+ +SQVKRLIGR+F DP++Q DLK FPF   EG DG  LIH  YL E   FTP Q+LGM
Sbjct  61   KSIVSQVKRLIGRRFDDPDVQNDLKMFPFETFEGSDGGILIHLEYLNETHKFTPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK+IAE +L +AV DC IG+P
Sbjct  121  LFAHLKTIAENDLGSAVSDCVIGVP  145



>ref|XP_009352433.1| PREDICTED: heat shock 70 kDa protein 16-like [Pyrus x bretschneideri]
Length=762

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQHDLQILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIP  145



>ref|XP_003617525.1| 97 kDa heat shock protein [Medicago truncatula]
Length=789

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AVA+Q G+DV+LN+ES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQGGVDVLLNNESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+ +SQVKRLIGR+F DP++Q DLK FPF   EG DG  LIH  YL E   FTP Q+LGM
Sbjct  61   KSIVSQVKRLIGRRFDDPDVQNDLKMFPFETFEGSDGGILIHLEYLNETHKFTPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK+IAE +L +AV DC IG+P
Sbjct  121  LFAHLKTIAENDLGSAVSDCVIGVP  145



>ref|XP_002522946.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
 gb|EEF39376.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
Length=740

 Score =   213 bits (541),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CVVA  +Q GIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVVATVKQGGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TI QVKRLIGR F+DP+++ +LK  PF ++ G DG  LIH +YLGEM TFTP Q++ M
Sbjct  61   KSTICQVKRLIGRNFADPDIRNELKLLPFEISGGKDGGILIHLKYLGEMYTFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK I E NL   V DC IGIP
Sbjct  121  LFSHLKEITEKNLEMPVTDCVIGIP  145



>ref|XP_006858197.1| hypothetical protein AMTR_s00062p00170870 [Amborella trichopoda]
 gb|ERN19664.1| hypothetical protein AMTR_s00062p00170870 [Amborella trichopoda]
Length=568

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+G+E+CVVAVA+QRGI+VVLNDESKRETPA+V FGEKQRFLG++G A++ MNP
Sbjct  1    MSVVGFDIGDENCVVAVAKQRGIEVVLNDESKRETPAIVSFGEKQRFLGSSGLASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQ+KRLIGR+F+ P  QRDL   PF+ +E PDG  LIH  Y+GE R FTP QVL M
Sbjct  61   KSTVSQIKRLIGRKFNCPYAQRDLHFLPFATSEAPDGGILIHIPYMGETRVFTPVQVLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IA  NL   V DC IGIP
Sbjct  121  LLSHLKQIAAKNLELGVTDCVIGIP  145



>ref|XP_008465078.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
 ref|XP_008465079.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
Length=762

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RET A++CFGEKQRFLG+A AA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETSAVICFGEKQRFLGSAAAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++TISQVKRLIGR F++P +Q DLK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFTEPGVQIDLKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++L+ +AE NL A   DC IGIP
Sbjct  121  LLAHLRDVAEKNLGAPFSDCVIGIP  145



>ref|XP_009372708.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Pyrus 
x bretschneideri]
Length=718

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQSDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC I IP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIP  145



>ref|XP_009372707.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Pyrus 
x bretschneideri]
Length=761

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQSDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC I IP
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIP  145



>ref|XP_010278704.1| PREDICTED: heat shock 70 kDa protein 16 [Nelumbo nucifera]
Length=777

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNESCV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G +GAA+++MNP
Sbjct  1    MSVVGFDIGNESCVIAAAKQRGIDVLLNDESKRETPAVVSFGEKQRFIGASGAASALMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIG  F  P++Q++L++FPF  +EG DG  LIH +YLGE    TP Q+L M
Sbjct  61   KSTISQVKRLIGLNFRQPDVQKELRNFPFETSEGSDGNILIHLQYLGETLKLTPVQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NL   V DC IGIP
Sbjct  121  LFSHLKQIAEKNLETPVSDCVIGIP  145



>ref|XP_007020851.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12376.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=764

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV++  +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVISAVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K  +SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LI  +YLGE   FTP Q++ M
Sbjct  61   KTMVSQVKRLIGRKFKDPDVQNELRLLPFETSEGQDGGILIQLKYLGETHRFTPLQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK IAE NL  +V+DC IGIP
Sbjct  121  LFAHLKYIAEANLGVSVLDCVIGIP  145



>ref|XP_002278262.1| PREDICTED: heat shock 70 kDa protein 16 [Vitis vinifera]
Length=771

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV++V +QRGIDV+LNDESKRETP++VCFGEKQR LG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVISVVKQRGIDVLLNDESKRETPSVVCFGEKQRILGSAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++TI QVKRLIG  FS+P ++ +LK FPF  +EGPDG  LIH +YLGE  TFTP Q+L M
Sbjct  61   RSTIFQVKRLIGLNFSEPHIKDELKMFPFETSEGPDGGILIHLQYLGERHTFTPVQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK I E NL   ++DC IGIP
Sbjct  121  LFAHLKDITEKNLEFPILDCVIGIP  145



>ref|XP_004232717.1| PREDICTED: heat shock 70 kDa protein 16 [Solanum lycopersicum]
Length=753

 Score =   209 bits (533),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+ VA+QRGIDV+LNDES RETPA+V FGEKQRF+G AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIGVAKQRGIDVILNDESNRETPAVVSFGEKQRFIGAAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR++ +P +Q+DLK  PF+ +EGPDG  LI+  Y+ E  +FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLLPFATSEGPDGGILINLHYMDEKHSFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK IAE NL   V DC IGIP
Sbjct  121  LFAHLKQIAEKNLETDVSDCVIGIP  145



>ref|XP_011096072.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096074.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096075.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
Length=756

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AVA++RGIDV+LNDESKRE PA+V FGEKQRF+G AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKERGIDVLLNDESKRENPAVVSFGEKQRFIGCAGAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR +S+P +Q DL+  PF  +EGPDG  LIH +YL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRTYSEPTVQDDLRLLPFETSEGPDGGILIHLQYLDEKQTFTPIQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK I E NL   + +C IGIP
Sbjct  121  LLAHLKQITEKNLEKQITNCVIGIP  145



>ref|XP_010931798.1| PREDICTED: heat shock 70 kDa protein 16 [Elaeis guineensis]
Length=784

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GN++CV+A  +QRGIDV+LNDESKRETPA+V FGEKQRFLGT GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESKRETPAVVSFGEKQRFLGTTGAASAAMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++T+SQVKRLIGR F  P++Q DL+  PF  ++ PDG  LIH RYL E R FTP Q+LGM
Sbjct  61   RSTVSQVKRLIGRAFDHPDVQADLRRLPFLTSQAPDGGILIHLRYLNEDRAFTPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK +AE +L   V DC IGIP
Sbjct  121  LLAHLKDVAEKSLETLVSDCVIGIP  145



>gb|AII99889.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +Q G+DV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQGGVDVLLNDESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F+D ++Q DLK  P   +EG DG  LIH +YL E   FTP Q+L M
Sbjct  61   KSTVSQVKRLIGRRFADLDVQNDLKRLPIETSEGSDGGILIHLKYLKETHKFTPVQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK+IAE +L  AV DC IG+P
Sbjct  121  LFAHLKTIAENDLGTAVSDCVIGVP  145



>ref|XP_004491392.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=773

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV +Q G+DV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQGGVDVLLNDESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F+D ++Q DLK  P   +EG DG  LIH +YL E   FTP Q+L M
Sbjct  61   KSTVSQVKRLIGRRFADLDVQNDLKRLPIETSEGSDGGILIHLKYLKETHKFTPVQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK+IAE +L  AV DC IG+P
Sbjct  121  LFAHLKTIAENDLGTAVSDCVIGVP  145



>ref|XP_006348107.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Solanum 
tuberosum]
Length=753

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+GFDVGNE+CV+ VA+QRGIDV+LNDES RETPA+V FG+KQRF+G AGAA++ MNP
Sbjct  1    MSVIGFDVGNENCVIGVAKQRGIDVILNDESNRETPAVVSFGDKQRFIGAAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR++ +P +Q+DLK FPF+ +EG DG  LI+  Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLFPFATSEGQDGGILINLHYMDEKQSFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK IAE NL   V DC IGIP
Sbjct  121  LFAHLKQIAEKNLETDVSDCVIGIP  145



>ref|XP_010665569.1| PREDICTED: heat shock 70 kDa protein 16 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+A  +QRGIDV+LN+ESKRETP +V FGE QR  G+A AA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGIDVLLNEESKRETPGVVSFGENQRLFGSAAAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
             +TISQVKRLIGR+F +P++Q DL+ FPF  +EGPDG+ LIH +YLGE++TFTP Q+L M
Sbjct  61   TSTISQVKRLIGRRFDNPKVQNDLRLFPFETSEGPDGYILIHLKYLGELQTFTPVQLLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK  A+ +L+  V DC IGIP
Sbjct  121  LFSHLKETADKSLDVPVNDCVIGIP  145



>ref|XP_008806738.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Phoenix dactylifera]
Length=783

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GN++CV+A  +QRGIDV+LNDES+RETPA+V FGEKQRFLG+ GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESERETPAVVSFGEKQRFLGSTGAASAAMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++T+SQVKRL+GR F  P++Q DL+  PF  ++  DG  LIH RYL E RTFTP Q+LGM
Sbjct  61   RSTVSQVKRLVGRAFGHPDVQSDLRRLPFPTSQASDGGILIHIRYLNEDRTFTPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK +AE +L  +V DC IGIP
Sbjct  121  LLAHLKDVAEKSLETSVSDCVIGIP  145



>ref|XP_008806739.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Phoenix dactylifera]
Length=782

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GN++CV+A  +QRGIDV+LNDES+RETPA+V FGEKQRFLG+ GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESERETPAVVSFGEKQRFLGSTGAASAAMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++T+SQVKRL+GR F  P++Q DL+  PF  ++  DG  LIH RYL E RTFTP Q+LGM
Sbjct  61   RSTVSQVKRLVGRAFGHPDVQSDLRRLPFPTSQASDGGILIHIRYLNEDRTFTPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK +AE +L  +V DC IGIP
Sbjct  121  LLAHLKDVAEKSLETSVSDCVIGIP  145



>gb|KJB69295.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69296.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69297.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69298.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
Length=774

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG D+GNE+C++AVA+QRGIDV+LNDESKRETPA V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGLDIGNENCIIAVAKQRGIDVLLNDESKRETPAAVSFGEKQRFIGSAGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++TI QVKRLIGR+F++P L+++LK FPF   E PDG  LI  +++GE+  FTP Q+LGM
Sbjct  61   RSTILQVKRLIGRKFNEPGLEKELKLFPFETFESPDGGILIRLQFMGEVHEFTPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE NL   V +C IGIP
Sbjct  121  LFSHLKQIAEKNLEMPVSECVIGIP  145



>emb|CDP04389.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G DVGNE+CVVAVA+QRGIDV+LNDESKRETPA+V FGEKQRF+G  GAA++ MNP
Sbjct  1    MSVLGLDVGNENCVVAVAKQRGIDVLLNDESKRETPAVVSFGEKQRFMGAVGAASATMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++TISQVKRLIGR+F +P +Q DLK  PF  +EGPDG  LIH  YL E ++FTP Q++ M
Sbjct  61   RSTISQVKRLIGRKFREPSVQDDLKLVPFETSEGPDGGILIHLYYLDEKQSFTPFQIMVM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +  +LK I+E NL   V DC IGIP
Sbjct  121  LFGHLKQISEKNLETHVSDCVIGIP  145



>ref|XP_006306833.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39731.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=737

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGID++LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDILLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG  LI  RY+GEM+ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEGSDGGILIQLRYMGEMQGFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IAE +L   V DC IGIP
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIP  145



>ref|XP_003553093.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=766

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCFGEKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFGEKQRILGSAGAASAMMHI  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y+GE+  FTP Q+L M
Sbjct  61   KSTISQIKRLIGRKFADPDVEKELKMLPVETSEGQDGGILIHLKYMGEIHVFTPVQLLSM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK++ E +L   + DC IGIP
Sbjct  121  LFAHLKTMTEKDLEMLISDCVIGIP  145



>gb|KHN45217.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=766

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCFGEKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFGEKQRILGSAGAASAMMHI  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y+GE+  FTP Q+L M
Sbjct  61   KSTISQIKRLIGRKFADPDVEKELKMLPVETSEGQDGGILIHLKYMGEIHVFTPVQLLSM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK++ E +L   + DC IGIP
Sbjct  121  LFAHLKTMTEKDLEMPISDCVIGIP  145



>ref|XP_006306834.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39732.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=763

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGID++LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDILLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG  LI  RY+GEM+ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEGSDGGILIQLRYMGEMQGFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IAE +L   V DC IGIP
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIP  145



>ref|XP_004294376.1| PREDICTED: heat shock 70 kDa protein 16 [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG D+GNE+CV+AV +QRGIDV+LN+ESKRETPA+VCFGEKQRFLG+A +A++MM+P
Sbjct  1    MSVVGIDIGNENCVIAVVKQRGIDVLLNEESKRETPAVVCFGEKQRFLGSAASASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F++ ++Q+DL+  PF  +EGPDG  LIH  YLG    FTP Q+  M
Sbjct  61   KSTVSQVKRLIGRRFNEADVQKDLRMLPFKTSEGPDGSILIHLSYLGGTHMFTPVQITAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++L+ I E NL   + DC IGIP
Sbjct  121  LFAHLREIIEKNLEMPISDCVIGIP  145



>ref|XP_008365284.1| PREDICTED: heat shock 70 kDa protein 16, partial [Malus domestica]
Length=683

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPA VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVXQXGVDVLLNDESKRETPAXVCFGEKQRFLGSAGAASAMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRL GR+F++P++QRDL       +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLXGRKFTEPDVQRDLXILXXXTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + E N    + DC IGIP
Sbjct  121  LFAHLKDLIEKNQEMPIXDCVIGIP  145



>ref|XP_007146461.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
 gb|ESW18455.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
Length=771

 Score =   202 bits (513),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV R+RGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRERGIDVLLNYESKRETPAVVCFNEKQRLLGSAGAASAMMHI  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F+DP++ ++LK  P   +E PDG  LIH +YLGE+  FTP Q++ M
Sbjct  61   KSTISQIKRLIGRKFADPDVDKELKMLPLETSESPDGGILIHLKYLGEIHVFTPVQIMSM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK++ E +L   + DC IGIP
Sbjct  121  LFAHLKTMTEKDLEMPISDCVIGIP  145



>gb|KJB22069.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=686

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + ETNL   V+DC IGIP
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIP  145



>ref|XP_006475182.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Citrus 
sinensis]
 gb|KDO62656.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=708

 Score =   201 bits (511),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+A  + RG+DV+LN+ES RETP++VCFGEKQRF+G AG A++MM+P
Sbjct  1    MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR++ DP +Q+DL   PF   E PDG   I  +YLGE  TF P QV+GM
Sbjct  61   KSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK +AE NL   VVDC IG+P
Sbjct  121  LFSHLKDVAEKNLEMPVVDCVIGVP  145



>ref|XP_006452327.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 ref|XP_006475181.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Citrus 
sinensis]
 gb|ESR65567.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 gb|KDO62654.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
 gb|KDO62655.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=763

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+A  + RG+DV+LN+ES RETP++VCFGEKQRF+G AG A++MM+P
Sbjct  1    MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR++ DP +Q+DL   PF   E PDG   I  +YLGE  TF P QV+GM
Sbjct  61   KSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK +AE NL   VVDC IG+P
Sbjct  121  LFSHLKDVAEKNLEMPVVDCVIGVP  145



>ref|XP_011037663.1| PREDICTED: heat shock 70 kDa protein 16 [Populus euphratica]
Length=769

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+CV+AVA++RGIDV+LNDES RETPA+V F EKQRF+G+ GAA+  MNP
Sbjct  1    MSVVGFDFGNENCVIAVAKERGIDVLLNDESNRETPAVVSFFEKQRFMGSEGAASLTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F + E+Q DLK FPF + EG DG  LI  +YLGE+  F+P Q+LGM
Sbjct  61   KSTVSQVKRLIGRKFKEVEVQDDLKLFPFEIVEGHDGGILIKVQYLGEIHEFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE +L   + DC IGIP
Sbjct  121  LFSHLKQIAEKSLEMPISDCVIGIP  145



>ref|XP_002305580.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
 gb|EEE86091.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
Length=757

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNE+CV+AVA++RGIDV+LNDES RETPA+V F EKQRF+G+ GAA+  MNP
Sbjct  1    MSVVGFDFGNENCVIAVAKERGIDVLLNDESNRETPAVVSFFEKQRFMGSEGAASLTMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+T+SQVKRLIGR+F + E+Q DLK FPF + EG DG  LI  +YLGE+  F+P Q+LGM
Sbjct  61   KSTVSQVKRLIGRKFKEVEVQDDLKLFPFEIVEGHDGGILIKVQYLGEIHEFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + S+LK IAE +L   + DC IGIP
Sbjct  121  LFSHLKQIAEKSLEMPISDCVIGIP  145



>gb|KJB22068.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
 gb|KJB22070.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=757

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + ETNL   V+DC IGIP
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIP  145



>gb|KHG25442.1| Heat shock 70 kDa 16 -like protein [Gossypium arboreum]
Length=757

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK + ETNL   V+DC IGIP
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIP  145



>ref|XP_006595737.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Glycine 
max]
Length=773

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MS VG D+GNE+CV+A  +QR IDV+LNDESKRETP +VCFGEKQRF+G+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQRVIDVLLNDESKRETPGVVCFGEKQRFIGSAGAVSAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR+F+DP++Q DLK  P   +EGPDG  LI  +YL E+  FTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFTDPDVQNDLKLLPVETSEGPDGGILIRLKYLKEIHAFTPVQIVAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK+IAE +   AV DC IG+P
Sbjct  121  LFAHLKTIAEKDFGTAVSDCVIGVP  145



>ref|XP_006595736.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Glycine 
max]
 gb|KHN11927.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=802

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MS VG D+GNE+CV+A  +QR IDV+LNDESKRETP +VCFGEKQRF+G+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQRVIDVLLNDESKRETPGVVCFGEKQRFIGSAGAVSAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQVKRLIGR+F+DP++Q DLK  P   +EGPDG  LI  +YL E+  FTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFTDPDVQNDLKLLPVETSEGPDGGILIRLKYLKEIHAFTPVQIVAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK+IAE +   AV DC IG+P
Sbjct  121  LFAHLKTIAEKDFGTAVSDCVIGVP  145



>ref|XP_010493114.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
 ref|XP_010493121.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=764

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK  AE +L   V DC IGIP
Sbjct  121  LLSHLKQTAEKSLKTPVSDCVIGIP  145



>ref|XP_002889885.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66144.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +E  DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IAE +L   V DC IGIP
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIP  145



>ref|NP_172631.2| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
 sp|Q9SAB1.1|HSP7Q_ARATH RecName: Full=Heat shock 70 kDa protein 16; AltName: Full=Heat 
shock protein 70-16; Short=AtHsp70-16 [Arabidopsis thaliana]
 gb|AAD30257.1|AC007296_18 Strong similarity to gb|Z70314 heat-shock protein from Arabidopsis 
thaliana and is a member of the PF|00012 Hsp70 protein 
family [Arabidopsis thaliana]
 gb|AEE28767.1| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
Length=763

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +E  DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IAE +L   V DC IGIP
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIP  145



>ref|XP_010476099.1| PREDICTED: heat shock 70 kDa protein 16 [Camelina sativa]
Length=764

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK  AE +L   V DC IGIP
Sbjct  121  LLSHLKLTAEKSLKTPVSDCVIGIP  145



>ref|XP_010458573.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=765

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE++ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQRFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK  AE +L   V DC IGIP
Sbjct  121  LLSHLKQTAEKSLKTPVSDCVIGIP  145



>gb|KHM99573.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=769

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFSEKQRILGSAGAASAMMHI  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y GE+  FTP Q L M
Sbjct  61   KSTISQIKRLIGRKFADPDVKKELKMLPGKTSEGQDGGILIHLKYSGEIHVFTPVQFLSM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK++ E +L   + DC IGIP
Sbjct  121  LFAHLKTMTENDLEMPISDCVIGIP  145



>ref|XP_003532123.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=769

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFSEKQRILGSAGAASAMMHI  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y GE+  FTP Q L M
Sbjct  61   KSTISQIKRLIGRKFADPDVKKELKMLPGKTSEGQDGGILIHLKYSGEIHVFTPVQFLSM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK++ E +L   + DC IGIP
Sbjct  121  LFAHLKTMTENDLEMPISDCVIGIP  145



>emb|CDY49794.1| BnaCnng18070D [Brassica napus]
Length=761

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  509
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFREPDVQKDLKLFPFETSEDSADGGIQIRLRYMGEVQSFSPVQILG  120

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LS+LK +AE +LN  V DC IGIP
Sbjct  121  MLLSHLKQVAEKSLNTPVSDCVIGIP  146



>gb|KDO75458.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75459.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=692

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 1/146 (1%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  329
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  330  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  509
            PK+TISQVKRL+GR+F + ++Q+DLK FPF   E  DG  LI   YLGE   FTP Q+LG
Sbjct  61   PKSTISQVKRLLGRKFREDDVQKDLKLFPFETCESHDGGILIMLEYLGETHKFTPVQILG  120

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LSNLK I E N+   + +C IG+P
Sbjct  121  MLLSNLKQITEKNIKIPISNCVIGVP  146



>ref|XP_006417329.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
 gb|ESQ35682.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
Length=763

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIG ++ +P++Q DL+ FPF  +E  DG   I  RY+GEM++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGMKYREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEMQSFSPVQLLGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IAE +L   V DC IGIP
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIP  145



>ref|XP_006468028.1| PREDICTED: heat shock 70 kDa protein 16-like [Citrus sinensis]
 gb|KDO75456.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75457.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=768

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 114/146 (78%), Gaps = 1/146 (1%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  329
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  330  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  509
            PK+TISQVKRL+GR+F + ++Q+DLK FPF   E  DG  LI   YLGE   FTP Q+LG
Sbjct  61   PKSTISQVKRLLGRKFREDDVQKDLKLFPFETCESHDGGILIMLEYLGETHKFTPVQILG  120

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LSNLK I E N+   + +C IG+P
Sbjct  121  MLLSNLKQITEKNIKIPISNCVIGVP  146



>ref|XP_009148495.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
 ref|XP_009148496.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
Length=761

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  509
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFKEPDVQKDLKLFPFETSEDSADGGIQIQLRYMGEVQSFSPVQILG  120

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LS+LK +AE +L   V DC IGIP
Sbjct  121  MLLSHLKQVAEKSLKTPVSDCVIGIP  146



>emb|CDX97975.1| BnaA06g07260D [Brassica napus]
Length=761

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  509
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFKEPDVQKDLKLFPFETSEDSADGGIQIQLRYMGEVQSFSPVQILG  120

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LS+LK +AE +L   V DC IGIP
Sbjct  121  MLLSHLKQVAEKSLKTPVSDCVIGIP  146



>ref|XP_007142282.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
 gb|ESW14276.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
Length=765

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MS VG D+GNE+CV+A  +Q G+DV+LNDESKRETPA+VCFGEKQRFLG+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQGGVDVLLNDESKRETPAVVCFGEKQRFLGSAGADSAMMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+ ISQVKRLIGR+F+DP++Q +LK  P   +E  DG  LIH +Y+ E   FTP Q++ M
Sbjct  61   KSAISQVKRLIGRRFADPDVQNELKMLPVETSESADGGILIHLKYMKESHVFTPVQIVAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + ++LK+IAE      V DC IG+P
Sbjct  121  LFAHLKTIAEKGFGTTVSDCVIGVP  145



>gb|EPS74057.1| hypothetical protein M569_00693, partial [Genlisea aurea]
Length=738

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GN++CV+AVA QRG+DV+LNDESKRETPA+V FG+KQRF+G++GAA++ M+P
Sbjct  1    MSVVGFDIGNDNCVIAVANQRGVDVLLNDESKRETPAVVSFGDKQRFMGSSGAASTTMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLI   + DP +Q +L+  PF  +EG DG  LIH RYLG+   FTP QVL M
Sbjct  61   KSTISQIKRLITLSYRDPSVQNELQLLPFETSEGADGGILIHLRYLGQRHIFTPVQVLAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L  LK + E NL   +  C I IP
Sbjct  121  LLGYLKELTEKNLGMEIASCVISIP  145



>ref|XP_010533816.1| PREDICTED: heat shock 70 kDa protein 16 [Tarenaya hassleriana]
Length=763

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            M+VVGFDVGNE C++AVA+QRGIDV+LN+ES RETP++V FG+KQRF+G A AA++ M+P
Sbjct  1    MNVVGFDVGNEKCIIAVAKQRGIDVLLNEESNRETPSVVSFGDKQRFMGAAAAASATMHP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TISQ+KRLIGR+F +P++Q DL+ FPF   EG DG   I  +Y G   +F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFGEPDVQNDLRLFPFETFEGSDGGVQIRLQYSGMTHSFSPVQILGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK I E NL   V DC IGIP
Sbjct  121  LLSHLKQITEKNLKMPVSDCVIGIP  145



>ref|XP_009420545.1| PREDICTED: heat shock 70 kDa protein 16 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGN+SCVVA  RQRGIDV+LNDES+RE PA+V FGEKQRFLG AGAA++   P
Sbjct  1    MSVVGFDVGNDSCVVAAVRQRGIDVLLNDESQRENPAVVSFGEKQRFLGAAGAASAARFP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            ++T+SQVKRL+GR F DP +Q DL+  PF  +E PDG  LI  R+L E R FTP Q+L M
Sbjct  61   RSTVSQVKRLLGRPFRDPAVQDDLRRLPFPTSEAPDGGILIRIRFLNEERVFTPVQILAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L++LK IAE +L   V DC IGIP
Sbjct  121  LLAHLKLIAEKSLETLVSDCVIGIP  145



>emb|CBI36157.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPD  440
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPD
Sbjct  61   KNSISQMKRLIGRQFSDPELQQDLKSLPFTVTEGPD  96



>ref|XP_001695858.1| heat shock protein 70E [Chlamydomonas reinhardtii]
 gb|EDP01195.1| heat shock protein 70E [Chlamydomonas reinhardtii]
Length=803

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            +SVVGFDVGN++  VA+AR+RGIDV++N ESKRETPA + FGEK RFLGT GAA   + P
Sbjct  4    VSVVGFDVGNDTSCVALARKRGIDVIMNKESKRETPAAINFGEKMRFLGTDGAAKLGLQP  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +NT+ Q+KR++G++F DP++Q D+   PF+V EGPDG  LI  RY  E   FTP QV+ M
Sbjct  64   QNTVHQLKRILGKKFKDPQVQEDIARLPFAVIEGPDGGCLIKVRYCNEEAVFTPEQVMAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            V+ +LK IAE     AV DC + +P
Sbjct  124  VIVDLKRIAEAEGGIAVTDCALSVP  148



>ref|XP_002949519.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
 gb|EFJ49538.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
Length=809

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            +SVVGFDVGN++  VA+AR+RGIDV++N ESKRETPA + FGEK RFLGT GAA   + P
Sbjct  4    VSVVGFDVGNDTSCVALARKRGIDVIMNKESKRETPAAINFGEKMRFLGTDGAAKLGLQP  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +NT+ Q+KR++G++F DP +Q D+   PF+V EGPDG  LI  RY  E   FTP QV+ M
Sbjct  64   QNTVHQLKRILGKKFQDPLVQADIAKLPFAVLEGPDGGCLIKVRYCNEDAIFTPEQVMAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L +LK IAE      V DC + +P
Sbjct  124  ILVDLKRIAEAESGIPVTDCALSVP  148



>ref|XP_003082170.1| heat shock protein 91-Arabidopsis thaliana (ISS) [Ostreococcus 
tauri]
Length=779

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG D GN + VVA+AR++GIDVVLNDESKRETP++V FGEKQRF+G+A A    M P
Sbjct  29   MSVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP  88

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +NT++QVKRL+GR F DPE+QRDL+   + V +G +G  L    YLG+ + FTP Q +  
Sbjct  89   RNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVAS  148

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IAE +    V DC I +P
Sbjct  149  ILSDLKRIAEKDNGTKVTDCVISVP  173



>emb|CEF99759.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=801

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG D GN + VVA+AR++GIDVVLNDESKRETP++V FGEKQRF+G+A A    M P
Sbjct  1    MSVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            +NT++QVKRL+GR F DPE+QRDL+   + V +G +G  L    YLG+ + FTP Q +  
Sbjct  61   RNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVAS  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IAE +    V DC I +P
Sbjct  121  ILSDLKRIAEKDNGTKVTDCVISVP  145



>ref|XP_006449032.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62272.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=646

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 101/146 (69%), Gaps = 17/146 (12%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  329
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  330  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  509
            PK+TISQ                DLK FPF   E  DG  LI   YLGE+  FTP Q+LG
Sbjct  61   PKSTISQ----------------DLKLFPFETCESHDGGILIMLEYLGELHKFTPVQILG  104

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LSNLK I E N+   + +C IG+P
Sbjct  105  MLLSNLKQITEKNIKIPISNCVIGVP  130



>ref|XP_006449031.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62271.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=752

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 101/146 (69%), Gaps = 17/146 (12%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  329
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  330  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  509
            PK+TISQ                DLK FPF   E  DG  LI   YLGE+  FTP Q+LG
Sbjct  61   PKSTISQ----------------DLKLFPFETCESHDGGILIMLEYLGELHKFTPVQILG  104

Query  510  MVLSNLKSIAETNLNAAVVDCCIGIP  587
            M+LSNLK I E N+   + +C IG+P
Sbjct  105  MLLSNLKQITEKNIKIPISNCVIGVP  130



>ref|XP_005642775.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
 gb|EIE18231.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
Length=792

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 108/145 (74%), Gaps = 1/145 (1%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV G D+G++   +AVAR+RGIDV++N ESKRETP+LV FG KQR LGT  A +  +NP
Sbjct  1    MSVAGIDIGDQKSCIAVARKRGIDVLMNKESKRETPSLVSFGTKQRQLGTDAAGSLTINP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+  +KRL+G+ FS+P++QRDL   P++V+EGPDG  LI+  YLGE ++FTP Q++  
Sbjct  61   KNTLFGLKRLLGKNFSNPDVQRDLPELPYNVSEGPDGGILINVDYLGERQSFTPEQIVAA  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            ++ ++K IAE +  + V DC + +P
Sbjct  121  IIVDMKDIAEVD-GSPVTDCVLSVP  144



>ref|XP_002969191.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
 gb|EFJ30307.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
Length=743

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 106/146 (73%), Gaps = 1/146 (1%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MS +G D+GNE   +A+ARQ G+DV L++ES RETP+++ F ++ R +G +GAA+++ N 
Sbjct  1    MSCLGLDLGNEHSRIAIARQGGVDVFLDEESSRETPSVISFTQRDRCIGASGAASALGNL  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+ Q+KR+IGR+F DPELQ DLK  P  VTEG  G+P IH  YLGE R F  T++LGM
Sbjct  61   KNTVWQIKRIIGRKFRDPELQSDLKLMPCLVTEGRGGWPAIHVSYLGEHRIFGATELLGM  120

Query  513  VLSNLKSIAETN-LNAAVVDCCIGIP  587
            VL++LKSIA  N +  A  +C IG P
Sbjct  121  VLAHLKSIAAKNMMGVAPGECVIGTP  146



>ref|XP_002973871.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
 gb|EFJ24826.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
Length=751

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 106/146 (73%), Gaps = 1/146 (1%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MS +G D+GNE   +A+ARQ G+DV L++ES RETP+++ F ++ R +G +GAA+++ N 
Sbjct  1    MSCLGLDLGNEHSRIAIARQGGVDVFLDEESSRETPSVISFTQRDRCIGASGAASALGNL  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+ Q+KR+IGR+F DPELQ DLK  P  VTEG  G+P IH  YLGE R F  T++LGM
Sbjct  61   KNTVWQIKRIIGRKFRDPELQSDLKLMPCLVTEGRGGWPAIHVSYLGEHRIFGATELLGM  120

Query  513  VLSNLKSIAETN-LNAAVVDCCIGIP  587
            VL++LKSIA  N +  A  +C IG P
Sbjct  121  VLAHLKSIAAKNMMGVAPGECVIGTP  146



>ref|XP_002505210.1| heat shock protein 70 [Micromonas sp. RCC299]
 gb|ACO66468.1| heat shock protein 70 [Micromonas sp. RCC299]
Length=811

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG D G+ + VVA+AR++GIDVVLN ESKRETPA+V FG+KQRF+G A A    M P
Sbjct  1    MSVVGLDFGSVNSVVALARRKGIDVVLNTESKRETPAMVNFGDKQRFIGCAAADKINMQP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI Q+KRLIG +FSDPE+Q  + +F F ++ GP+   LI   YLGE +TFTP +++ M
Sbjct  61   KNTIVQLKRLIGLRFSDPEVQALVPAFLFPISGGPNDEILITVDYLGEKKTFTPERLVAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +LS+LK IAE +  A V D  I +P
Sbjct  121  ILSDLKVIAEADHGAKVTDSVISVP  145



>ref|XP_003060408.1| heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH55177.1| heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=819

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 101/145 (70%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVG D GN + V+A+AR++GIDVVLN ESKRETP++V FGEKQRFLG A A    M P
Sbjct  1    MSVVGLDFGNANSVIALARRKGIDVVLNGESKRETPSMVNFGEKQRFLGCAAADKINMKP  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            K+TI Q+K LIG ++SDPE+Q  L +F F +  GP+   LI   Y+ E + FTP +++ M
Sbjct  61   KDTIVQLKSLIGLRYSDPEVQAMLPNFVFPIAGGPNDEILITVTYMNEKKAFTPERLVAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
             L++LK IAE +  + V D  I IP
Sbjct  121  ALADLKIIAEQDQGSKVTDAVISIP  145



>ref|XP_011304595.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Fopius arisanus]
Length=806

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+   KRL+GR+++DP++Q++L+S P+ VT  PDG   IH +YLGE   FTP Q+  M
Sbjct  64   KNTVFGFKRLLGRKYNDPQVQKELRSLPYKVTAQPDGTIGIHVQYLGEEHIFTPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L  AV DC I +P
Sbjct  124  LFTKLKEISETALQTAVNDCVISVP  148



>sp|Q06068.2|HSP97_STRPU RecName: Full=97 kDa heat shock protein; AltName: Full=Egg sperm 
receptor [Strongylocentrotus purpuratus]
 gb|AAB09737.1| sperm receptor [Strongylocentrotus purpuratus]
Length=889

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L+ LKS AE NL   VVDC I +P
Sbjct  121  ILTKLKSTAEINLCRKVVDCVISVP  145



>ref|NP_999695.1| 97 kDa heat shock protein [Strongylocentrotus purpuratus]
 gb|AAB17669.1| egg receptor for sperm [Strongylocentrotus purpuratus]
Length=889

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L+ LKS AE NL   VVDC I +P
Sbjct  121  ILTKLKSTAEINLCRKVVDCVISVP  145



>ref|XP_011304586.1| PREDICTED: 97 kDa heat shock protein isoform X1 [Fopius arisanus]
Length=842

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 95/145 (66%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+   KRL+GR+++DP++Q++L+S P+ VT  PDG   IH +YLGE   FTP Q+  M
Sbjct  64   KNTVFGFKRLLGRKYNDPQVQKELRSLPYKVTAQPDGTIGIHVQYLGEEHIFTPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L  AV DC I +P
Sbjct  124  LFTKLKEISETALQTAVNDCVISVP  148



>sp|Q94738.1|HSP97_STRFN RecName: Full=97 kDa heat shock protein; AltName: Full=Heat shock 
protein 110 [Strongylocentrotus franciscanus]
 gb|AAB09038.1| heat shock protein 110 [Strongylocentrotus franciscanus]
Length=886

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+SQ KR I RQFSDP +Q+D    P+ VT+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARQFSDPSVQKDAHVVPYKVTQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L+ LK+ AE NL   VVDC I +P
Sbjct  121  ILTKLKATAEVNLCRKVVDCVISVP  145



>ref|XP_001641799.1| predicted protein [Nematostella vectensis]
 gb|EDO49736.1| predicted protein [Nematostella vectensis]
Length=843

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFDVGN+SC +AVAR  GI+ V N+ S R TP+ V  G+KQR +GT+G    + N 
Sbjct  1    MSVVGFDVGNQSCYIAVARGGGIETVANEFSDRCTPSFVSLGDKQRLIGTSGKNQMISNL  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTISQ KR IGR+FSDP +Q+++   P+ V E P+    I  +YLG+   F+P QV+ M
Sbjct  61   KNTISQFKRFIGRKFSDPAVQKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVMAM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK+ AE  L   V DC I +P
Sbjct  121  LFTRLKTTAEIALKTKVTDCVISVP  145



>ref|XP_003485911.1| PREDICTED: heat shock 70 kDa protein 4L-like [Bombus impatiens]
Length=866

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 93/145 (64%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRNTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI   KRL+GR+++DP++QR+L++ PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQTLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L   V DC I +P
Sbjct  124  LFTKLKDISETALQTVVNDCVISVP  148



>ref|XP_002585532.1| hypothetical protein BRAFLDRAFT_111895 [Branchiostoma floridae]
 gb|EEN41543.1| hypothetical protein BRAFLDRAFT_111895 [Branchiostoma floridae]
Length=385

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 92/145 (63%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSVVGFD+GN SC + VARQ GI+ + N+ S R TP +V FGEKQR +GT      + N 
Sbjct  1    MSVVGFDLGNLSCYIGVARQGGIETIANEYSDRCTPTVVSFGEKQRSIGTPAKNQMVTNY  60

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNT+ Q KR +GR+F DP++Q +L+   +   E PDG   +   Y GE   F+  Q+ GM
Sbjct  61   KNTVYQFKRFLGRRFQDPQVQSELQHVQYRAAEMPDGSTGMKLHYQGEEHVFSTEQITGM  120

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            +L+ LK ++E NL   VVDC I +P
Sbjct  121  ILTKLKEVSEMNLKVKVVDCVISVP  145



>ref|XP_003394081.1| PREDICTED: heat shock 70 kDa protein 4L-like [Bombus terrestris]
Length=866

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 93/145 (64%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETITNDYSLRNTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI   KRL+GR+++DP++QR+L++ PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQTLPFKVTHQSDGGIGIHVQYLGEEHIFSPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+E+ L   V DC I +P
Sbjct  124  LFTKLKDISESALQTVVNDCVISVP  148



>ref|XP_006561225.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Apis mellifera]
Length=831

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L   V DC I +P
Sbjct  124  LFTKLKDISETALQTIVNDCVISVP  148



>ref|XP_006615729.1| PREDICTED: 97 kDa heat shock protein-like isoform X2 [Apis dorsata]
Length=831

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L   V DC I +P
Sbjct  124  LFTKLKDISETALQTIVNDCVISVP  148



>ref|XP_003702344.1| PREDICTED: 97 kDa heat shock protein-like [Megachile rotundata]
Length=865

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 93/145 (64%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI   KRL+GR+++DP++QR++K  PF VT+  DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIYGFKRLLGRKYNDPQVQREIKMLPFKVTQQADGNIGIHVQYLGEEHIFSPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L   V DC I +P
Sbjct  124  LFTKLKDISETALQTIVNDCVISVP  148



>ref|XP_003691374.1| PREDICTED: heat shock 70 kDa protein 4L-like [Apis florea]
Length=866

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L   V DC I +P
Sbjct  124  LFTKLKDISETALQTIVNDCVISVP  148



>gb|KJE91467.1| hsp97-like protein [Capsaspora owczarzaki ATCC 30864]
Length=789

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 98/150 (65%), Gaps = 0/150 (0%)
 Frame = +3

Query  138  LLATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAAT  317
             L+  MSVVGFD+GNE+C +AVARQ GI+VV N+ + R+TPA+V  G K+RF+G AG   
Sbjct  18   FLSRTMSVVGFDLGNENCFIAVARQGGIEVVANEYTYRQTPAVVSLGAKKRFIGEAGKTA  77

Query  318  SMMNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPT  497
               NPKNT+   K L+GR+++DP  Q +LK   +  TE  DGF      + GE +TFT  
Sbjct  78   IPTNPKNTVYNFKHLLGRKYNDPFTQAELKRAFYRHTETADGFVGFKLDFQGETKTFTVQ  137

Query  498  QVLGMVLSNLKSIAETNLNAAVVDCCIGIP  587
            Q++GM+L+ L+  AE NL   V DC + +P
Sbjct  138  QIMGMLLTQLRGTAEMNLKMKVTDCVLSVP  167



>ref|XP_623199.2| PREDICTED: 97 kDa heat shock protein isoformX1 [Apis mellifera]
Length=867

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L   V DC I +P
Sbjct  124  LFTKLKDISETALQTIVNDCVISVP  148



>ref|XP_006615728.1| PREDICTED: 97 kDa heat shock protein-like isoform X1 [Apis dorsata]
Length=867

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 0/145 (0%)
 Frame = +3

Query  153  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  332
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  333  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  512
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  513  VLSNLKSIAETNLNAAVVDCCIGIP  587
            + + LK I+ET L   V DC I +P
Sbjct  124  LFTKLKDISETALQTIVNDCVISVP  148



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925