BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS133D03

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616023.1|  PREDICTED: uncharacterized protein LOC104108647    357   4e-113   Nicotiana tomentosiformis
ref|XP_004230310.1|  PREDICTED: uncharacterized protein LOC101249681    357   5e-113   
ref|XP_006344767.1|  PREDICTED: uncharacterized protein LOC102580046    354   5e-112   Solanum tuberosum [potatoes]
ref|XP_009783972.1|  PREDICTED: uncharacterized protein LOC104232454    351   7e-111   Nicotiana sylvestris
ref|XP_007208429.1|  hypothetical protein PRUPE_ppa000798mg             335   7e-105   Prunus persica
ref|XP_008246002.1|  PREDICTED: uncharacterized protein LOC103344152    335   1e-104   Prunus mume [ume]
ref|XP_007031156.1|  Uncharacterized protein isoform 2                  334   2e-104   
ref|XP_007031155.1|  Uncharacterized protein isoform 1                  335   2e-104   
ref|XP_002318950.2|  hypothetical protein POPTR_0013s00990g             333   7e-104   
gb|EYU40497.1|  hypothetical protein MIMGU_mgv1a000785mg                331   3e-103   Erythranthe guttata [common monkey flower]
ref|XP_011092150.1|  PREDICTED: uncharacterized protein LOC105172430    330   4e-103   Sesamum indicum [beniseed]
gb|KJB45453.1|  hypothetical protein B456_007G306600                    330   1e-102   Gossypium raimondii
gb|KJB81105.1|  hypothetical protein B456_013G129500                    326   2e-102   Gossypium raimondii
gb|KJB81106.1|  hypothetical protein B456_013G129500                    326   3e-102   Gossypium raimondii
ref|XP_011023781.1|  PREDICTED: uncharacterized protein LOC105125162    328   6e-102   Populus euphratica
gb|KJB81104.1|  hypothetical protein B456_013G129500                    327   2e-101   Gossypium raimondii
ref|XP_006394914.1|  hypothetical protein EUTSA_v10003593mg             326   2e-101   Eutrema salsugineum [saltwater cress]
ref|XP_006394915.1|  hypothetical protein EUTSA_v10003593mg             326   2e-101   Eutrema salsugineum [saltwater cress]
ref|XP_009373286.1|  PREDICTED: uncharacterized protein LOC103962316    326   3e-101   Pyrus x bretschneideri [bai li]
gb|KHG02153.1|  Protein EFR3                                            325   6e-101   Gossypium arboreum [tree cotton]
ref|XP_008370375.1|  PREDICTED: uncharacterized protein LOC103433867    325   9e-101   Malus domestica [apple tree]
ref|NP_198037.3|  uncharacterized protein                               324   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872241.1|  hypothetical protein ARALYDRAFT_489516             323   2e-100   
ref|XP_010546763.1|  PREDICTED: uncharacterized protein LOC104818746    323   2e-100   Tarenaya hassleriana [spider flower]
ref|XP_004302237.1|  PREDICTED: uncharacterized protein LOC101313...    323   2e-100   Fragaria vesca subsp. vesca
ref|XP_011466140.1|  PREDICTED: uncharacterized protein LOC101313...    323   3e-100   Fragaria vesca subsp. vesca
gb|KHG26707.1|  Efr3b                                                   324   3e-100   Gossypium arboreum [tree cotton]
gb|KHG26706.1|  Protein EFR3 B                                          323   4e-100   Gossypium arboreum [tree cotton]
ref|XP_010455044.1|  PREDICTED: uncharacterized protein LOC104736707    322   8e-100   Camelina sativa [gold-of-pleasure]
dbj|BAC41892.1|  unknown protein                                        321   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421542.1|  PREDICTED: uncharacterized protein LOC104706...    320   3e-99    Camelina sativa [gold-of-pleasure]
ref|XP_008359849.1|  PREDICTED: uncharacterized protein LOC103423542    320   3e-99    
ref|XP_010493942.1|  PREDICTED: protein EFR3 homolog B-like isofo...    320   3e-99    Camelina sativa [gold-of-pleasure]
gb|KEH43106.1|  cyclin-like protein                                     319   9e-99    Medicago truncatula
ref|XP_002282109.1|  PREDICTED: uncharacterized protein LOC100264846    319   1e-98    Vitis vinifera
gb|KDP23388.1|  hypothetical protein JCGZ_23221                         319   1e-98    Jatropha curcas
emb|CDP18254.1|  unnamed protein product                                318   4e-98    Coffea canephora [robusta coffee]
emb|CDX87029.1|  BnaC09g03440D                                          316   1e-97    
ref|XP_002512512.1|  conserved hypothetical protein                     315   2e-97    
ref|XP_010493940.1|  PREDICTED: protein EFR3 homolog B-like isofo...    315   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_009111721.1|  PREDICTED: protein EFR3 homolog B-like             315   4e-97    Brassica rapa
gb|AAB61061.1|  Hypothetical protein F2P16.24                           313   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003536043.1|  PREDICTED: uncharacterized protein LOC100785...    313   3e-96    Glycine max [soybeans]
ref|XP_006589118.1|  PREDICTED: uncharacterized protein LOC100785...    313   3e-96    
ref|XP_004495652.1|  PREDICTED: uncharacterized protein LOC101508...    312   3e-96    
emb|CDY19753.1|  BnaA09g04060D                                          312   4e-96    Brassica napus [oilseed rape]
ref|XP_006433539.1|  hypothetical protein CICLE_v10000144mg             311   1e-95    Citrus clementina [clementine]
ref|XP_003555181.1|  PREDICTED: uncharacterized protein LOC100788290    311   1e-95    
ref|XP_010267987.1|  PREDICTED: uncharacterized protein LOC104605...    309   5e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010267985.1|  PREDICTED: uncharacterized protein LOC104605...    309   6e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010024133.1|  PREDICTED: uncharacterized protein LOC104414673    308   2e-94    Eucalyptus grandis [rose gum]
ref|XP_007145003.1|  hypothetical protein PHAVU_007G201500g             307   2e-94    Phaseolus vulgaris [French bean]
ref|XP_006472204.1|  PREDICTED: uncharacterized protein LOC102623618    307   3e-94    Citrus sinensis [apfelsine]
ref|XP_010092978.1|  hypothetical protein L484_018915                   301   4e-92    
ref|XP_006840435.1|  hypothetical protein AMTR_s00045p00164850          301   5e-92    Amborella trichopoda
ref|XP_010674649.1|  PREDICTED: protein EFR3 homolog A                  301   7e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008453377.1|  PREDICTED: uncharacterized protein LOC103494111    294   2e-89    Cucumis melo [Oriental melon]
ref|XP_008778937.1|  PREDICTED: protein EFR3 homolog cmp44E-like        278   2e-89    
ref|XP_004165925.1|  PREDICTED: uncharacterized LOC101202927            292   1e-88    
ref|XP_004144747.1|  PREDICTED: uncharacterized protein LOC101202927    291   1e-88    Cucumis sativus [cucumbers]
emb|CDX80597.1|  BnaC07g28470D                                          288   2e-87    
ref|XP_009384434.1|  PREDICTED: uncharacterized protein LOC103971...    286   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384437.1|  PREDICTED: uncharacterized protein LOC103971...    285   3e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF95548.1|  cyclin, putative, expressed                             278   4e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938251.1|  PREDICTED: uncharacterized protein LOC105057...    282   5e-85    Elaeis guineensis
ref|XP_009151505.1|  PREDICTED: uncharacterized protein LOC103874824    278   5e-85    
ref|XP_010938250.1|  PREDICTED: uncharacterized protein LOC105057...    282   6e-85    
ref|XP_008781115.1|  PREDICTED: uncharacterized protein LOC103700...    281   8e-85    Phoenix dactylifera
emb|CDX88246.1|  BnaA06g28370D                                          281   1e-84    
ref|XP_008781114.1|  PREDICTED: protein EFR3 homolog cmp44E-like ...    281   1e-84    
ref|XP_002465372.1|  hypothetical protein SORBIDRAFT_01g037420          280   2e-84    Sorghum bicolor [broomcorn]
ref|XP_006649970.1|  PREDICTED: uncharacterized protein LOC102701065    280   3e-84    Oryza brachyantha
ref|XP_008808672.1|  PREDICTED: uncharacterized protein LOC103720...    280   4e-84    Phoenix dactylifera
ref|XP_008808671.1|  PREDICTED: uncharacterized protein LOC103720...    280   4e-84    Phoenix dactylifera
ref|XP_004984608.1|  PREDICTED: uncharacterized protein LOC101782956    280   4e-84    Setaria italica
ref|XP_010921489.1|  PREDICTED: uncharacterized protein LOC105045026    279   6e-84    Elaeis guineensis
emb|CAN82509.1|  hypothetical protein VITISV_012725                     282   8e-84    Vitis vinifera
ref|XP_008646153.1|  PREDICTED: uncharacterized protein LOC100384...    278   1e-83    
ref|NP_001049903.1|  Os03g0308200                                       277   3e-83    
gb|KHN23227.1|  Protein EFR3 like cmp44E                                275   6e-83    Glycine soja [wild soybean]
ref|XP_010228707.1|  PREDICTED: uncharacterized protein LOC100831...    275   2e-82    Brachypodium distachyon [annual false brome]
ref|XP_003558072.1|  PREDICTED: uncharacterized protein LOC100831...    275   2e-82    Brachypodium distachyon [annual false brome]
ref|XP_008646145.1|  PREDICTED: uncharacterized protein LOC100384...    273   6e-82    Zea mays [maize]
ref|XP_003591099.1|  EFR3-like protein                                  243   2e-77    
ref|XP_010932401.1|  PREDICTED: uncharacterized protein LOC105053...    243   8e-72    
ref|XP_008798151.1|  PREDICTED: uncharacterized protein LOC103713119    245   9e-72    Phoenix dactylifera
ref|XP_006838291.1|  hypothetical protein AMTR_s00103p00108190          244   3e-71    Amborella trichopoda
ref|XP_009405043.1|  PREDICTED: uncharacterized protein LOC103988214    241   2e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784321.1|  PREDICTED: uncharacterized protein LOC103703...    240   6e-70    Phoenix dactylifera
ref|XP_008784320.1|  PREDICTED: uncharacterized protein LOC103703...    240   6e-70    Phoenix dactylifera
ref|XP_008784316.1|  PREDICTED: protein EFR3 homolog isoform X1         240   7e-70    
dbj|BAK01387.1|  predicted protein                                      239   2e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS68493.1|  hypothetical protein M569_06272                         238   2e-69    Genlisea aurea
ref|XP_010313082.1|  PREDICTED: uncharacterized protein LOC101250...    238   2e-69    Solanum lycopersicum
ref|XP_004250744.1|  PREDICTED: uncharacterized protein LOC101250...    238   2e-69    Solanum lycopersicum
ref|XP_006352098.1|  PREDICTED: uncharacterized protein LOC102584...    238   2e-69    Solanum tuberosum [potatoes]
ref|XP_006352099.1|  PREDICTED: uncharacterized protein LOC102584...    238   3e-69    Solanum tuberosum [potatoes]
ref|XP_009401306.1|  PREDICTED: uncharacterized protein LOC103985362    238   3e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008231409.1|  PREDICTED: uncharacterized protein LOC103330592    238   4e-69    Prunus mume [ume]
ref|XP_007218911.1|  hypothetical protein PRUPE_ppa000649mg             238   4e-69    
ref|XP_009391228.1|  PREDICTED: uncharacterized protein LOC103977445    238   5e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078902.1|  PREDICTED: uncharacterized protein LOC105162543    237   7e-69    Sesamum indicum [beniseed]
ref|XP_006858684.1|  hypothetical protein AMTR_s00066p00085830          236   1e-68    Amborella trichopoda
ref|XP_010241226.1|  PREDICTED: uncharacterized protein LOC104585...    236   1e-68    Nelumbo nucifera [Indian lotus]
ref|XP_011457274.1|  PREDICTED: uncharacterized protein LOC101313...    236   1e-68    Fragaria vesca subsp. vesca
ref|XP_009393518.1|  PREDICTED: uncharacterized protein LOC103979184    236   2e-68    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002264735.1|  PREDICTED: uncharacterized protein LOC100264...    236   2e-68    Vitis vinifera
ref|XP_009355500.1|  PREDICTED: uncharacterized protein LOC103946512    236   2e-68    Pyrus x bretschneideri [bai li]
ref|XP_002968494.1|  hypothetical protein SELMODRAFT_90004              234   4e-68    
ref|XP_002975992.1|  hypothetical protein SELMODRAFT_443103             234   5e-68    
ref|XP_008443197.1|  PREDICTED: uncharacterized protein LOC103486...    234   6e-68    Cucumis melo [Oriental melon]
ref|XP_010523668.1|  PREDICTED: protein EFR3 homolog isoform X2         234   6e-68    Tarenaya hassleriana [spider flower]
ref|XP_010523667.1|  PREDICTED: protein EFR3 homolog isoform X1         234   7e-68    Tarenaya hassleriana [spider flower]
ref|XP_007203221.1|  hypothetical protein PRUPE_ppa000725mg             234   9e-68    
ref|XP_010257179.1|  PREDICTED: uncharacterized protein LOC104597...    234   1e-67    Nelumbo nucifera [Indian lotus]
ref|XP_004309822.1|  PREDICTED: uncharacterized protein LOC101313...    234   1e-67    Fragaria vesca subsp. vesca
ref|XP_010653791.1|  PREDICTED: uncharacterized protein LOC100255...    234   1e-67    Vitis vinifera
ref|XP_002277870.1|  PREDICTED: uncharacterized protein LOC100255...    234   1e-67    Vitis vinifera
ref|XP_009625862.1|  PREDICTED: protein EFR3 homolog isoform X1         233   1e-67    
ref|XP_009625867.1|  PREDICTED: protein EFR3 homolog isoform X2         233   2e-67    Nicotiana tomentosiformis
ref|XP_004304390.1|  PREDICTED: uncharacterized protein LOC101298629    233   2e-67    Fragaria vesca subsp. vesca
ref|XP_011075240.1|  PREDICTED: uncharacterized protein LOC105159...    233   3e-67    Sesamum indicum [beniseed]
ref|XP_011075238.1|  PREDICTED: uncharacterized protein LOC105159...    233   3e-67    Sesamum indicum [beniseed]
ref|XP_003605757.1|  EFR3-like protein                                  232   4e-67    Medicago truncatula
ref|XP_004308677.1|  PREDICTED: uncharacterized protein LOC101307642    232   4e-67    Fragaria vesca subsp. vesca
ref|XP_002517810.1|  conserved hypothetical protein                     232   4e-67    
ref|XP_003540587.1|  PREDICTED: uncharacterized protein LOC100816475    232   5e-67    Glycine max [soybeans]
gb|KCW90195.1|  hypothetical protein EUGRSUZ_A02368                     231   7e-67    Eucalyptus grandis [rose gum]
ref|XP_004166917.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    231   7e-67    
gb|KGN59399.1|  hypothetical protein Csa_3G816120                       231   8e-67    Cucumis sativus [cucumbers]
ref|XP_002322714.1|  cyclin-related family protein                      231   9e-67    
ref|XP_010057214.1|  PREDICTED: uncharacterized protein LOC104445...    231   9e-67    Eucalyptus grandis [rose gum]
ref|XP_010057221.1|  PREDICTED: uncharacterized protein LOC104445...    231   1e-66    Eucalyptus grandis [rose gum]
ref|XP_009379627.1|  PREDICTED: uncharacterized protein LOC103968...    231   1e-66    
ref|XP_004136762.1|  PREDICTED: uncharacterized protein LOC101210251    231   1e-66    
ref|XP_009379628.1|  PREDICTED: uncharacterized protein LOC103968...    231   1e-66    Pyrus x bretschneideri [bai li]
ref|XP_009789125.1|  PREDICTED: protein EFR3 homolog B isoform X4       230   2e-66    Nicotiana sylvestris
ref|NP_197607.5|  uncharacterized protein                               230   3e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006657548.1|  PREDICTED: uncharacterized protein LOC102712271    230   3e-66    Oryza brachyantha
ref|XP_009789120.1|  PREDICTED: protein EFR3 homolog B isoform X1       229   3e-66    Nicotiana sylvestris
ref|XP_009789124.1|  PREDICTED: protein EFR3 homolog B isoform X3       229   3e-66    Nicotiana sylvestris
ref|XP_009789122.1|  PREDICTED: protein EFR3 homolog B isoform X2       229   3e-66    Nicotiana sylvestris
ref|XP_010241506.1|  PREDICTED: uncharacterized protein LOC104586...    229   4e-66    Nelumbo nucifera [Indian lotus]
ref|XP_010241507.1|  PREDICTED: uncharacterized protein LOC104586...    229   4e-66    Nelumbo nucifera [Indian lotus]
ref|XP_002874031.1|  hypothetical protein ARALYDRAFT_489019             229   4e-66    
ref|XP_011048039.1|  PREDICTED: uncharacterized protein LOC105142218    229   5e-66    Populus euphratica
ref|XP_006286974.1|  hypothetical protein CARUB_v10000121mg             229   5e-66    Capsella rubella
ref|XP_006587694.1|  PREDICTED: uncharacterized protein LOC100808352    229   6e-66    Glycine max [soybeans]
gb|EMS53000.1|  Protein EFR3-like protein B                             229   6e-66    Triticum urartu
ref|XP_010555004.1|  PREDICTED: uncharacterized protein LOC104824606    229   6e-66    
ref|XP_010420957.1|  PREDICTED: uncharacterized protein LOC104706460    229   6e-66    Camelina sativa [gold-of-pleasure]
ref|XP_010493228.1|  PREDICTED: uncharacterized protein LOC104770495    229   8e-66    Camelina sativa [gold-of-pleasure]
ref|XP_002529611.1|  conserved hypothetical protein                     228   8e-66    
emb|CDY09095.1|  BnaA02g05210D                                          228   9e-66    Brassica napus [oilseed rape]
ref|XP_007028783.1|  Uncharacterized protein isoform 3                  226   9e-66    
ref|XP_009789840.1|  PREDICTED: protein EFR3 homolog B-like isofo...    228   1e-65    Nicotiana sylvestris
ref|XP_009789839.1|  PREDICTED: protein EFR3 homolog B-like isofo...    228   1e-65    Nicotiana sylvestris
ref|XP_009124331.1|  PREDICTED: uncharacterized protein LOC103849280    228   1e-65    Brassica rapa
ref|XP_010319193.1|  PREDICTED: protein EFR3 homolog B isoform X3       228   1e-65    Solanum lycopersicum
ref|XP_006345431.1|  PREDICTED: uncharacterized protein LOC102584593    228   1e-65    Solanum tuberosum [potatoes]
ref|XP_004229640.1|  PREDICTED: protein EFR3 homolog B-like             228   1e-65    Solanum lycopersicum
emb|CDP18636.1|  unnamed protein product                                228   1e-65    Coffea canephora [robusta coffee]
ref|XP_006421414.1|  hypothetical protein CICLE_v10006843mg             228   1e-65    
ref|XP_010319191.1|  PREDICTED: protein EFR3 homolog B isoform X1       228   1e-65    Solanum lycopersicum
ref|XP_004236620.1|  PREDICTED: protein EFR3 homolog B isoform X2       228   1e-65    Solanum lycopersicum
gb|EMT11310.1|  hypothetical protein F775_16040                         228   2e-65    
ref|XP_009610957.1|  PREDICTED: protein EFR3 homolog B isoform X5       228   2e-65    Nicotiana tomentosiformis
gb|KHN11694.1|  Protein EFR3 like B                                     228   2e-65    Glycine soja [wild soybean]
ref|XP_009610937.1|  PREDICTED: protein EFR3 homolog B isoform X2       228   2e-65    Nicotiana tomentosiformis
ref|XP_009610919.1|  PREDICTED: protein EFR3 homolog B isoform X1       228   2e-65    Nicotiana tomentosiformis
ref|XP_010930207.1|  PREDICTED: uncharacterized protein LOC105051451    228   2e-65    Elaeis guineensis
ref|XP_009610949.1|  PREDICTED: protein EFR3 homolog B isoform X4       227   2e-65    Nicotiana tomentosiformis
ref|XP_009610943.1|  PREDICTED: protein EFR3 homolog B isoform X3       227   2e-65    Nicotiana tomentosiformis
gb|KEH23652.1|  cyclin-like protein                                     227   2e-65    Medicago truncatula
ref|XP_011033323.1|  PREDICTED: uncharacterized protein LOC105131...    227   2e-65    Populus euphratica
emb|CDP16550.1|  unnamed protein product                                227   2e-65    Coffea canephora [robusta coffee]
ref|XP_006350206.1|  PREDICTED: protein EFR3 homolog B-like isofo...    227   3e-65    
ref|XP_011033324.1|  PREDICTED: protein EFR3 homolog B-like isofo...    227   3e-65    Populus euphratica
ref|XP_006350204.1|  PREDICTED: protein EFR3 homolog B-like isofo...    227   3e-65    Solanum tuberosum [potatoes]
ref|XP_010666756.1|  PREDICTED: uncharacterized protein LOC104883885    226   4e-65    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004506319.1|  PREDICTED: uncharacterized protein LOC101489771    226   5e-65    Cicer arietinum [garbanzo]
ref|XP_007131432.1|  hypothetical protein PHAVU_011G013000g             226   5e-65    Phaseolus vulgaris [French bean]
ref|XP_007028781.1|  Uncharacterized protein isoform 1                  226   7e-65    
gb|KFK26320.1|  hypothetical protein AALP_AA8G232400                    226   7e-65    Arabis alpina [alpine rockcress]
gb|EAY92960.1|  hypothetical protein OsI_14753                          213   8e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_006489936.1|  PREDICTED: uncharacterized protein LOC102624456    226   9e-65    Citrus sinensis [apfelsine]
ref|XP_007225374.1|  hypothetical protein PRUPE_ppa000810mg             225   1e-64    Prunus persica
ref|XP_008222533.1|  PREDICTED: uncharacterized protein LOC103322398    225   1e-64    Prunus mume [ume]
ref|XP_006648302.1|  PREDICTED: uncharacterized protein LOC102704216    225   1e-64    Oryza brachyantha
ref|XP_004158232.1|  PREDICTED: protein EFR3 homolog cmp44E-like        224   1e-64    
ref|XP_008461314.1|  PREDICTED: uncharacterized protein LOC103499...    225   1e-64    Cucumis melo [Oriental melon]
ref|XP_010546486.1|  PREDICTED: uncharacterized protein LOC104818...    225   1e-64    
ref|XP_009765963.1|  PREDICTED: protein EFR3 homolog cmp44E-like        210   2e-64    Nicotiana sylvestris
gb|KGN64805.1|  hypothetical protein Csa_1G108300                       224   2e-64    Cucumis sativus [cucumbers]
ref|XP_002308951.2|  cyclin-related family protein                      224   2e-64    
ref|XP_004147289.1|  PREDICTED: uncharacterized protein LOC101219905    225   2e-64    Cucumis sativus [cucumbers]
ref|XP_004951914.1|  PREDICTED: uncharacterized protein LOC101783...    224   2e-64    Setaria italica
ref|XP_006293443.1|  hypothetical protein CARUB_v10022560mg             224   3e-64    Capsella rubella
ref|XP_007033971.1|  ARM repeat superfamily protein isoform 1           224   3e-64    
ref|XP_007033975.1|  ARM repeat superfamily protein isoform 5           224   3e-64    
ref|XP_004136123.1|  PREDICTED: uncharacterized protein LOC101211879    224   5e-64    
ref|XP_004493504.1|  PREDICTED: uncharacterized protein LOC101511...    223   6e-64    Cicer arietinum [garbanzo]
ref|XP_004493505.1|  PREDICTED: uncharacterized protein LOC101511...    223   6e-64    Cicer arietinum [garbanzo]
ref|XP_009363645.1|  PREDICTED: uncharacterized protein LOC103953608    223   8e-64    Pyrus x bretschneideri [bai li]
ref|XP_002277709.2|  PREDICTED: uncharacterized protein LOC100265428    223   9e-64    Vitis vinifera
ref|XP_010094723.1|  hypothetical protein L484_003597                   218   9e-64    
ref|XP_006400678.1|  hypothetical protein EUTSA_v10012553mg             223   9e-64    Eutrema salsugineum [saltwater cress]
ref|XP_010546363.1|  PREDICTED: uncharacterized protein LOC104818...    223   1e-63    
ref|XP_008463083.1|  PREDICTED: uncharacterized protein LOC103501...    223   1e-63    Cucumis melo [Oriental melon]
dbj|BAK04246.1|  predicted protein                                      223   1e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU27043.1|  hypothetical protein MIMGU_mgv1a000818mg                222   1e-63    Erythranthe guttata [common monkey flower]
ref|XP_008463075.1|  PREDICTED: uncharacterized protein LOC103501...    223   1e-63    Cucumis melo [Oriental melon]
ref|XP_008799995.1|  PREDICTED: uncharacterized protein LOC103714...    222   1e-63    Phoenix dactylifera
emb|CDY06905.1|  BnaA04g24100D                                          222   1e-63    
ref|XP_006597228.1|  PREDICTED: uncharacterized protein LOC100811...    222   2e-63    Glycine max [soybeans]
emb|CDY14788.1|  BnaC04g47850D                                          222   2e-63    Brassica napus [oilseed rape]
ref|NP_001045867.1|  Os02g0143200                                       222   2e-63    
ref|XP_006411452.1|  hypothetical protein EUTSA_v10016171mg             222   2e-63    Eutrema salsugineum [saltwater cress]
gb|EEE56284.1|  hypothetical protein OsJ_05346                          222   2e-63    Oryza sativa Japonica Group [Japonica rice]
gb|EEC72466.1|  hypothetical protein OsI_05818                          222   2e-63    Oryza sativa Indica Group [Indian rice]
ref|XP_006648006.1|  PREDICTED: protein EFR3 homolog B-like isofo...    221   3e-63    Oryza brachyantha
ref|NP_001048304.1|  Os02g0780500                                       221   3e-63    
gb|EYU20743.1|  hypothetical protein MIMGU_mgv1a000711mg                221   4e-63    Erythranthe guttata [common monkey flower]
gb|KJB49179.1|  hypothetical protein B456_008G105100                    220   4e-63    Gossypium raimondii
ref|XP_010505973.1|  PREDICTED: uncharacterized protein LOC104782671    221   5e-63    Camelina sativa [gold-of-pleasure]
ref|XP_009142008.1|  PREDICTED: uncharacterized protein LOC103865...    221   5e-63    
ref|XP_009142010.1|  PREDICTED: uncharacterized protein LOC103865...    221   5e-63    
ref|XP_010508669.1|  PREDICTED: uncharacterized protein LOC104785...    221   5e-63    Camelina sativa [gold-of-pleasure]
ref|XP_009142012.1|  PREDICTED: uncharacterized protein LOC103865...    221   5e-63    Brassica rapa
ref|XP_010069300.1|  PREDICTED: protein EFR3 homolog B isoform X1       220   6e-63    Eucalyptus grandis [rose gum]
gb|KHG10450.1|  Protein EFR3                                            220   6e-63    Gossypium arboreum [tree cotton]
ref|XP_009142011.1|  PREDICTED: uncharacterized protein LOC103865...    221   6e-63    Brassica rapa
gb|KJB49180.1|  hypothetical protein B456_008G105100                    220   7e-63    Gossypium raimondii
gb|KCW57602.1|  hypothetical protein EUGRSUZ_H00374                     220   8e-63    Eucalyptus grandis [rose gum]
gb|KDO47318.1|  hypothetical protein CISIN_1g001882mg                   219   1e-62    Citrus sinensis [apfelsine]
gb|KJB49178.1|  hypothetical protein B456_008G105100                    220   1e-62    Gossypium raimondii
gb|KJB37960.1|  hypothetical protein B456_006G228200                    218   1e-62    Gossypium raimondii
gb|KDO47319.1|  hypothetical protein CISIN_1g001882mg                   219   1e-62    Citrus sinensis [apfelsine]
gb|KDO47320.1|  hypothetical protein CISIN_1g001882mg                   219   1e-62    Citrus sinensis [apfelsine]
gb|EAZ26671.1|  hypothetical protein OsJ_10574                          219   1e-62    Oryza sativa Japonica Group [Japonica rice]
gb|KJB71806.1|  hypothetical protein B456_011G143200                    218   2e-62    Gossypium raimondii
gb|KJB37959.1|  hypothetical protein B456_006G228200                    218   3e-62    Gossypium raimondii
ref|XP_011087843.1|  PREDICTED: uncharacterized protein LOC105169196    218   3e-62    Sesamum indicum [beniseed]
gb|KJB71809.1|  hypothetical protein B456_011G143200                    218   4e-62    Gossypium raimondii
ref|XP_009626575.1|  PREDICTED: protein EFR3 homolog B-like             203   4e-62    Nicotiana tomentosiformis
gb|KJB71808.1|  hypothetical protein B456_011G143200                    218   4e-62    Gossypium raimondii
ref|XP_007162229.1|  hypothetical protein PHAVU_001G134800g             218   4e-62    Phaseolus vulgaris [French bean]
gb|KJB71804.1|  hypothetical protein B456_011G143200                    218   5e-62    Gossypium raimondii
ref|XP_006595061.1|  PREDICTED: uncharacterized protein LOC100806...    218   6e-62    Glycine max [soybeans]
gb|KDO53678.1|  hypothetical protein CISIN_1g0359231mg                  203   6e-62    Citrus sinensis [apfelsine]
ref|XP_003520520.1|  PREDICTED: uncharacterized protein LOC100817...    218   7e-62    Glycine max [soybeans]
ref|XP_006576825.1|  PREDICTED: uncharacterized protein LOC100817...    218   7e-62    Glycine max [soybeans]
ref|XP_007162228.1|  hypothetical protein PHAVU_001G134800g             218   7e-62    Phaseolus vulgaris [French bean]
ref|XP_002457472.1|  hypothetical protein SORBIDRAFT_03g007790          217   1e-61    
gb|EAY89716.1|  hypothetical protein OsI_11254                          216   1e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_002881801.1|  hypothetical protein ARALYDRAFT_483264             217   1e-61    
ref|XP_006478683.1|  PREDICTED: uncharacterized protein LOC102614...    217   1e-61    Citrus sinensis [apfelsine]
gb|EPS68833.1|  hypothetical protein M569_05934                         212   2e-61    Genlisea aurea
ref|XP_003597513.1|  EFR3-like protein                                  216   2e-61    
gb|KEH39475.1|  cyclin-like protein                                     216   2e-61    Medicago truncatula
gb|KHN30101.1|  Protein EFR3 like B                                     216   3e-61    Glycine soja [wild soybean]
gb|EMS54754.1|  Protein EFR3-like protein A                             215   3e-61    Triticum urartu
gb|EMT28557.1|  Protein EFR3-like protein                               214   5e-61    
tpg|DAA53702.1|  TPA: hypothetical protein ZEAMMB73_302622              213   6e-61    
ref|NP_001059150.1|  Os07g0205900                                       215   1e-60    
gb|EEC81712.1|  hypothetical protein OsI_25322                          214   1e-60    Oryza sativa Indica Group [Indian rice]
dbj|BAF00551.1|  hypothetical protein                                   214   1e-60    Arabidopsis thaliana [mouse-ear cress]
ref|NP_181714.3|  uncharacterized protein                               214   2e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790619.1|  PREDICTED: uncharacterized protein LOC103707...    214   2e-60    
ref|XP_010907685.1|  PREDICTED: uncharacterized protein LOC105034...    213   2e-60    
gb|AFW70121.1|  hypothetical protein ZEAMMB73_889435                    213   3e-60    
gb|KEH30318.1|  cyclin-like protein                                     213   3e-60    Medicago truncatula
ref|XP_004486920.1|  PREDICTED: uncharacterized protein LOC101509...    213   3e-60    Cicer arietinum [garbanzo]
ref|XP_010907684.1|  PREDICTED: uncharacterized protein LOC105034...    213   3e-60    Elaeis guineensis
ref|XP_004954123.1|  PREDICTED: protein EFR3 homolog B-like             213   3e-60    Setaria italica
ref|XP_008644197.1|  PREDICTED: uncharacterized protein LOC100501...    213   4e-60    
ref|XP_008644199.1|  PREDICTED: uncharacterized protein LOC100501...    213   4e-60    Zea mays [maize]
ref|XP_008644200.1|  PREDICTED: uncharacterized protein LOC100501...    213   4e-60    Zea mays [maize]
ref|XP_008644196.1|  PREDICTED: uncharacterized protein LOC100501...    213   4e-60    Zea mays [maize]
ref|XP_008644198.1|  PREDICTED: uncharacterized protein LOC100501...    213   4e-60    
ref|XP_008644195.1|  PREDICTED: uncharacterized protein LOC100501...    213   4e-60    
ref|XP_010907683.1|  PREDICTED: uncharacterized protein LOC105034...    213   4e-60    
ref|XP_010907682.1|  PREDICTED: uncharacterized protein LOC105034...    213   5e-60    
ref|XP_008673100.1|  PREDICTED: uncharacterized protein LOC100381...    212   5e-60    
ref|XP_008655586.1|  PREDICTED: uncharacterized protein LOC103634...    213   5e-60    
ref|XP_010907681.1|  PREDICTED: uncharacterized protein LOC105034...    213   5e-60    
ref|XP_008673097.1|  PREDICTED: uncharacterized protein LOC100381...    212   5e-60    
ref|XP_008673099.1|  PREDICTED: uncharacterized protein LOC100381...    212   5e-60    
ref|XP_006592150.1|  PREDICTED: uncharacterized protein LOC100799...    212   5e-60    
ref|XP_002451526.1|  hypothetical protein SORBIDRAFT_04g003310          212   6e-60    
ref|XP_010672159.1|  PREDICTED: uncharacterized protein LOC104888...    212   7e-60    
ref|XP_010672158.1|  PREDICTED: uncharacterized protein LOC104888...    212   7e-60    
ref|XP_011026408.1|  PREDICTED: uncharacterized protein LOC105127...    211   8e-60    
ref|XP_002309810.1|  hypothetical protein POPTR_0007s02020g             211   9e-60    
ref|XP_011026411.1|  PREDICTED: uncharacterized protein LOC105127...    211   9e-60    
ref|XP_010454428.1|  PREDICTED: uncharacterized protein LOC104736187    211   1e-59    
ref|XP_004140882.1|  PREDICTED: uncharacterized protein LOC101203725    211   2e-59    
ref|XP_008445732.1|  PREDICTED: uncharacterized protein LOC103488...    211   2e-59    
ref|XP_008445731.1|  PREDICTED: uncharacterized protein LOC103488...    211   2e-59    
gb|KHN25286.1|  Protein EFR3 like B                                     211   2e-59    
emb|CDX79909.1|  BnaA05g02470D                                          210   2e-59    
ref|XP_003539042.1|  PREDICTED: uncharacterized protein LOC100817...    209   4e-59    
gb|KHN06209.1|  Protein EFR3 like B                                     209   5e-59    
ref|XP_010257180.1|  PREDICTED: uncharacterized protein LOC104597...    209   6e-59    
ref|XP_010413002.1|  PREDICTED: uncharacterized protein LOC104699388    209   1e-58    
ref|XP_007150426.1|  hypothetical protein PHAVU_005G152600g             208   2e-58    
gb|KJB16447.1|  hypothetical protein B456_002G230500                    208   2e-58    
ref|XP_004507331.1|  PREDICTED: uncharacterized protein LOC101496...    207   4e-58    
ref|XP_007131956.1|  hypothetical protein PHAVU_011G054800g             206   9e-58    
ref|XP_006443048.1|  hypothetical protein CICLE_v100186802mg            192   1e-57    
ref|XP_010485557.1|  PREDICTED: uncharacterized protein LOC104763859    206   1e-57    
ref|XP_003570918.1|  PREDICTED: uncharacterized protein LOC100821...    206   1e-57    
ref|XP_010457707.1|  PREDICTED: uncharacterized protein LOC104739144    205   1e-57    
emb|CDY06190.1|  BnaA09g50130D                                          204   2e-57    
ref|XP_006417969.1|  hypothetical protein EUTSA_v10006704mg             205   2e-57    
emb|CDY09999.1|  BnaC08g44520D                                          204   2e-57    
ref|XP_009118564.1|  PREDICTED: protein EFR3 homolog                    204   2e-57    
gb|AAK56279.1|AF367291_1  At1g05960/T21E18_20                           202   3e-57    
gb|EMT12879.1|  hypothetical protein F775_15212                         204   4e-57    
gb|EEE55815.1|  hypothetical protein OsJ_04415                          203   8e-57    
ref|XP_002533049.1|  conserved hypothetical protein                     203   9e-57    
ref|NP_563755.1|  ARM repeat superfamily protein                        203   9e-57    
ref|NP_001045092.1|  Os01g0898300                                       203   1e-56    
ref|XP_006303900.1|  hypothetical protein CARUB_v10008206mg             202   1e-56    
ref|XP_008647478.1|  PREDICTED: uncharacterized protein LOC100217...    203   2e-56    
ref|XP_008647477.1|  PREDICTED: uncharacterized protein LOC100217...    203   2e-56    
emb|CDY63789.1|  BnaA08g31700D                                          202   2e-56    
ref|XP_010522184.1|  PREDICTED: uncharacterized protein LOC104800...    202   2e-56    
ref|XP_010522186.1|  PREDICTED: uncharacterized protein LOC104800...    202   2e-56    
ref|XP_008655589.1|  PREDICTED: uncharacterized protein LOC103634...    202   2e-56    
gb|KHG30683.1|  Protein EFR3 cmp44E                                     202   3e-56    
ref|XP_006303899.1|  hypothetical protein CARUB_v10008206mg             201   3e-56    
emb|CDX86545.1|  BnaC08g01580D                                          201   4e-56    
ref|XP_010475319.1|  PREDICTED: uncharacterized protein LOC104754751    201   7e-56    
gb|AFW84297.1|  hypothetical protein ZEAMMB73_469985                    199   8e-56    
ref|XP_008645036.1|  PREDICTED: uncharacterized protein LOC103626...    201   8e-56    
ref|XP_008645035.1|  PREDICTED: uncharacterized protein LOC103626...    201   8e-56    
gb|AFW69349.1|  hypothetical protein ZEAMMB73_015704                    201   9e-56    
gb|AAF80120.1|AC024174_2  Contains similarity to an unknown prote...    202   1e-55    
ref|XP_008240995.1|  PREDICTED: uncharacterized protein LOC103339476    201   1e-55    
ref|XP_004970911.1|  PREDICTED: uncharacterized protein LOC101769...    200   1e-55    
ref|XP_004970908.1|  PREDICTED: uncharacterized protein LOC101769...    200   1e-55    
gb|AFW84299.1|  hypothetical protein ZEAMMB73_469985                    199   2e-55    
ref|XP_002892313.1|  predicted protein                                  201   2e-55    
gb|AFW84298.1|  hypothetical protein ZEAMMB73_469985                    199   3e-55    
gb|KGN45115.1|  hypothetical protein Csa_7G426560                       199   3e-55    
ref|XP_004966105.1|  PREDICTED: uncharacterized protein LOC101758656    199   4e-55    
ref|XP_009111018.1|  PREDICTED: protein EFR3 homolog isoform X3         198   4e-55    
ref|XP_009111016.1|  PREDICTED: protein EFR3 homolog isoform X1         198   4e-55    
ref|XP_001767624.1|  predicted protein                                  197   6e-55    
emb|CDY10165.1|  BnaC05g04080D                                          197   8e-55    
ref|XP_008644201.1|  PREDICTED: uncharacterized protein LOC100501...    198   8e-55    
ref|XP_006645172.1|  PREDICTED: uncharacterized protein LOC102710074    197   1e-54    
ref|XP_009119100.1|  PREDICTED: uncharacterized protein LOC103844080    197   1e-54    
emb|CDY47707.1|  BnaA10g03960D                                          197   1e-54    
ref|XP_003564842.1|  PREDICTED: uncharacterized protein LOC100842...    197   2e-54    
ref|XP_010232687.1|  PREDICTED: uncharacterized protein LOC100842...    197   2e-54    
ref|XP_010232688.1|  PREDICTED: uncharacterized protein LOC100842...    197   2e-54    
gb|KDP42800.1|  hypothetical protein JCGZ_23742                         196   4e-54    
ref|XP_007052501.1|  Uncharacterized protein TCM_005862                 195   5e-54    
ref|XP_011033325.1|  PREDICTED: uncharacterized protein LOC105131...    196   6e-54    
ref|XP_002456786.1|  hypothetical protein SORBIDRAFT_03g042720          194   9e-54    
gb|EMS60662.1|  Protein EFR3-like protein                               194   1e-53    
ref|XP_008790620.1|  PREDICTED: uncharacterized protein LOC103707...    194   2e-53    
ref|XP_008790616.1|  PREDICTED: uncharacterized protein LOC103707...    194   2e-53    
emb|CDM85315.1|  unnamed protein product                                194   2e-53    
ref|XP_010557094.1|  PREDICTED: uncharacterized protein LOC104826...    192   6e-53    
gb|KHG08769.1|  Protein EFR3 B                                          192   7e-53    
gb|EMT06694.1|  Putative mitochondrial protein                          193   7e-53    
ref|NP_001154308.1|  ARM repeat superfamily protein                     190   6e-52    
gb|AAC02765.1|  hypothetical protein                                    185   3e-50    
gb|KHN32414.1|  Protein EFR3 like B                                     182   2e-49    
ref|XP_006287016.1|  hypothetical protein CARUB_v10000164mg             180   1e-48    
dbj|BAH57285.1|  AT5G26850                                              179   4e-48    
ref|XP_001770437.1|  predicted protein                                  179   4e-48    
emb|CDY48767.1|  BnaC04g02200D                                          178   1e-47    
gb|KJB46322.1|  hypothetical protein B456_007G360200                    177   2e-47    
ref|XP_008461315.1|  PREDICTED: uncharacterized protein LOC103499...    173   5e-46    
gb|EYU18743.1|  hypothetical protein MIMGU_mgv1a0012531mg               158   4e-45    
ref|XP_010523669.1|  PREDICTED: uncharacterized protein LOC104801...    169   2e-44    
ref|XP_008463089.1|  PREDICTED: uncharacterized protein LOC103501...    166   2e-43    
gb|KHN11423.1|  hypothetical protein glysoja_015318                     160   1e-41    
gb|KJB37958.1|  hypothetical protein B456_006G228200                    160   1e-41    
gb|KHN33312.1|  Protein EFR3 like B                                     159   3e-41    
gb|EPS74671.1|  hypothetical protein M569_00084                         142   2e-39    
ref|XP_010236037.1|  PREDICTED: uncharacterized protein LOC100837488    154   4e-39    
ref|XP_008354962.1|  PREDICTED: protein EFR3 homolog A-like             135   1e-36    
ref|XP_010557096.1|  PREDICTED: uncharacterized protein LOC104826...    145   3e-36    
ref|XP_008355520.1|  PREDICTED: uncharacterized protein LOC103419180    128   4e-34    
ref|XP_008350293.1|  PREDICTED: polygalacturonase ADPG2-like            132   6e-34    
emb|CAJ44368.1|  putative cyclin-related protein                        138   1e-33    
gb|AES61350.2|  cyclin-like protein                                     126   2e-33    
ref|XP_008387322.1|  PREDICTED: uncharacterized protein LOC103449776    130   5e-33    
ref|XP_010097525.1|  hypothetical protein L484_024736                   127   6e-33    
emb|CBI29857.3|  unnamed protein product                                136   7e-33    
gb|AFK33385.1|  unknown                                                 123   6e-32    
emb|CBI24919.3|  unnamed protein product                                131   4e-31    
gb|EEE57911.1|  hypothetical protein OsJ_08605                          130   9e-31    
gb|EEC74114.1|  hypothetical protein OsI_09170                          125   1e-30    
ref|XP_008463098.1|  PREDICTED: uncharacterized protein LOC103501...    128   3e-30    
ref|XP_006350205.1|  PREDICTED: protein EFR3 homolog B-like isofo...    126   2e-29    
ref|XP_010927191.1|  PREDICTED: uncharacterized protein LOC105049285    120   2e-27    
ref|XP_004168868.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    116   3e-26    
gb|KJB16446.1|  hypothetical protein B456_002G230500                    114   2e-25    
ref|XP_010932402.1|  PREDICTED: uncharacterized protein LOC105053...    111   2e-24    
ref|XP_010313083.1|  PREDICTED: uncharacterized protein LOC101250...    111   2e-24    
ref|XP_008443202.1|  PREDICTED: uncharacterized protein LOC103486...    111   2e-24    
gb|AFK46351.1|  unknown                                                 106   3e-24    
ref|XP_006648008.1|  PREDICTED: protein EFR3 homolog B-like isofo...    107   5e-23    
ref|XP_008655590.1|  PREDICTED: uncharacterized protein LOC103634...    106   1e-22    
ref|XP_010319194.1|  PREDICTED: uncharacterized protein LOC101246...    104   4e-22    
ref|XP_010092917.1|  hypothetical protein L484_004958                 97.4    5e-22    
ref|XP_008784322.1|  PREDICTED: uncharacterized protein LOC103703...    104   5e-22    
ref|XP_009610963.1|  PREDICTED: uncharacterized protein LOC104104...    103   8e-22    
gb|KEH43075.1|  cyclin, putative                                      95.5    1e-21    
gb|KDO83457.1|  hypothetical protein CISIN_1g035569mg                   102   2e-21    
ref|XP_008800011.1|  PREDICTED: uncharacterized protein LOC103714...    103   2e-21    
ref|XP_004160819.1|  PREDICTED: uncharacterized LOC101203725          95.9    2e-21    
ref|XP_009412884.1|  PREDICTED: uncharacterized protein LOC103994280    101   7e-21    
ref|XP_010650558.1|  PREDICTED: uncharacterized protein LOC100264...    100   1e-20    
ref|XP_008350700.1|  PREDICTED: uncharacterized protein LOC103414060  99.0    5e-20    
ref|XP_010313084.1|  PREDICTED: uncharacterized protein LOC101250...  97.1    2e-19    
gb|KHN07377.1|  hypothetical protein glysoja_012675                   95.9    6e-19    
gb|AFW70125.1|  hypothetical protein ZEAMMB73_889435                  94.4    1e-18    
gb|KDP26045.1|  hypothetical protein JCGZ_21078                       94.7    1e-18    
ref|XP_006597230.1|  PREDICTED: uncharacterized protein LOC100811...  94.7    1e-18    
gb|AFW70123.1|  hypothetical protein ZEAMMB73_889435                  94.4    2e-18    
gb|AFW70122.1|  hypothetical protein ZEAMMB73_889435                  94.4    2e-18    
gb|AFW70124.1|  hypothetical protein ZEAMMB73_889435                  94.4    2e-18    
gb|KJB71039.1|  hypothetical protein B456_011G101600                  88.2    2e-18    
ref|XP_006590941.1|  PREDICTED: uncharacterized protein LOC100817...  93.6    3e-18    
ref|XP_008369216.1|  PREDICTED: uncharacterized protein LOC103432787  93.2    3e-18    
ref|XP_008443203.1|  PREDICTED: uncharacterized protein LOC103486...  93.2    4e-18    
ref|XP_010069302.1|  PREDICTED: uncharacterized protein LOC104456...  92.4    7e-18    
gb|KJB71038.1|  hypothetical protein B456_011G101600                  86.3    1e-17    
gb|KDO81672.1|  hypothetical protein CISIN_1g0461821mg                91.3    2e-17    
ref|XP_008790621.1|  PREDICTED: uncharacterized protein LOC103707...  90.9    3e-17    
ref|XP_006482855.1|  PREDICTED: uncharacterized protein LOC102612183  84.7    3e-17    
ref|XP_010672160.1|  PREDICTED: uncharacterized protein LOC104888...  90.5    3e-17    
ref|XP_006478686.1|  PREDICTED: uncharacterized protein LOC102614...  90.1    4e-17    
ref|XP_010097526.1|  hypothetical protein L484_024737                 89.0    2e-16    
ref|XP_010653792.1|  PREDICTED: uncharacterized protein LOC100255...  86.3    9e-16    
ref|XP_004951915.1|  PREDICTED: uncharacterized protein LOC101783...  84.7    3e-15    
ref|XP_010233799.1|  PREDICTED: uncharacterized protein LOC100821...  82.8    1e-14    
ref|XP_008644202.1|  PREDICTED: uncharacterized protein LOC100501...  82.8    1e-14    
gb|KDO81671.1|  hypothetical protein CISIN_1g0461822mg                75.1    2e-14    
ref|XP_009142014.1|  PREDICTED: uncharacterized protein LOC103865...  82.0    2e-14    
ref|XP_007028782.1|  Uncharacterized protein isoform 2                80.5    5e-14    
ref|XP_010522187.1|  PREDICTED: uncharacterized protein LOC104800...  75.9    2e-12    
ref|XP_005846281.1|  hypothetical protein CHLNCDRAFT_135622           72.4    3e-12    
gb|EAZ45073.1|  hypothetical protein OsJ_29714                        70.9    6e-12    
ref|XP_006439087.1|  hypothetical protein CICLE_v10033334mg           73.9    1e-11    
ref|XP_004171248.1|  PREDICTED: uncharacterized LOC101219905          73.6    1e-11    
ref|XP_009111017.1|  PREDICTED: protein EFR3 homolog isoform X2       72.8    2e-11    
ref|XP_010557097.1|  PREDICTED: uncharacterized protein LOC104826...  70.5    1e-10    
ref|XP_002405516.1|  transmembrane protein cmp44E, putative           69.7    2e-10    
ref|XP_001689991.1|  predicted protein                                66.6    1e-09    
ref|XP_010092918.1|  hypothetical protein L484_004959                 66.6    1e-09    
ref|XP_002585860.1|  hypothetical protein BRAFLDRAFT_256891           65.9    2e-09    
ref|XP_005457730.1|  PREDICTED: protein EFR3 homolog A-like isofo...  63.5    4e-09    
ref|XP_005457731.1|  PREDICTED: protein EFR3 homolog A-like isofo...  63.2    6e-09    
ref|XP_006634590.1|  PREDICTED: protein EFR3 homolog A-like           64.7    8e-09    
ref|XP_008286006.1|  PREDICTED: protein EFR3 homolog A                64.7    8e-09    
ref|XP_003744820.1|  PREDICTED: protein EFR3 homolog B-like           64.7    9e-09    
ref|XP_010744204.1|  PREDICTED: protein EFR3 homolog A                64.7    9e-09    
ref|XP_008333292.1|  PREDICTED: protein EFR3 homolog A isoform X1     64.7    9e-09    
ref|XP_008461316.1|  PREDICTED: uncharacterized protein LOC103499...  64.7    9e-09    
ref|XP_008333293.1|  PREDICTED: protein EFR3 homolog A isoform X2     64.7    9e-09    
ref|XP_008432997.1|  PREDICTED: protein EFR3 homolog A isoform X5     64.3    1e-08    
ref|XP_008432999.1|  PREDICTED: protein EFR3 homolog A isoform X7     64.3    1e-08    
ref|XP_008433002.1|  PREDICTED: protein EFR3 homolog A isoform X10    64.3    1e-08    
ref|XP_008432998.1|  PREDICTED: protein EFR3 homolog A isoform X6     64.3    1e-08    
ref|XP_008432994.1|  PREDICTED: protein EFR3 homolog A isoform X3     64.3    1e-08    
ref|XP_008432992.1|  PREDICTED: protein EFR3 homolog A isoform X1     64.3    1e-08    
ref|XP_008433000.1|  PREDICTED: protein EFR3 homolog A isoform X8     64.3    1e-08    
ref|XP_008433001.1|  PREDICTED: protein EFR3 homolog A isoform X9     64.3    1e-08    
ref|XP_008172122.1|  PREDICTED: protein EFR3 homolog B isoform X3     63.9    1e-08    
ref|XP_010891293.1|  PREDICTED: protein EFR3 homolog A isoform X1     63.9    2e-08    
ref|XP_004359079.1|  hypothetical protein DFA_01104                   63.9    2e-08    
ref|XP_010891302.1|  PREDICTED: protein EFR3 homolog A isoform X2     63.9    2e-08    
gb|KFM73651.1|  Protein EFR3-like protein                             62.0    2e-08    
ref|XP_008432996.1|  PREDICTED: protein EFR3 homolog A isoform X4     63.5    2e-08    
ref|XP_008432993.1|  PREDICTED: protein EFR3 homolog A isoform X2     63.5    2e-08    
ref|XP_011457275.1|  PREDICTED: uncharacterized protein LOC101313...  63.5    2e-08    
ref|NP_957121.1|  protein EFR3 homolog A                              63.2    3e-08    
ref|XP_008119523.1|  PREDICTED: LOW QUALITY PROTEIN: protein EFR3...  63.2    3e-08    
ref|XP_004569517.1|  PREDICTED: protein EFR3 homolog A-like isofo...  62.8    4e-08    
ref|XP_004569518.1|  PREDICTED: protein EFR3 homolog A-like isofo...  62.8    4e-08    
gb|EFX83306.1|  hypothetical protein DAPPUDRAFT_315767                62.8    4e-08    
ref|XP_005934153.1|  PREDICTED: LOW QUALITY PROTEIN: protein EFR3...  62.4    4e-08    
ref|XP_005746415.1|  PREDICTED: LOW QUALITY PROTEIN: protein EFR3...  62.4    4e-08    
ref|XP_007577973.1|  PREDICTED: protein EFR3 homolog A isoform X1     62.4    5e-08    
ref|XP_007577974.1|  PREDICTED: protein EFR3 homolog A isoform X2     62.4    5e-08    
gb|ELV13761.1|  Protein EFR3 like protein B                           62.4    5e-08    
ref|XP_011484518.1|  PREDICTED: protein EFR3 homolog A isoform X4     62.0    6e-08    
ref|XP_011484517.1|  PREDICTED: protein EFR3 homolog A isoform X3     62.0    6e-08    
ref|XP_005024084.1|  PREDICTED: protein EFR3 homolog B isoform X1     62.0    6e-08    
ref|XP_007488407.1|  PREDICTED: protein EFR3 homolog A isoform X2     62.0    6e-08    
ref|XP_007488406.1|  PREDICTED: protein EFR3 homolog A isoform X1     62.0    6e-08    
ref|XP_011484516.1|  PREDICTED: protein EFR3 homolog A isoform X2     62.0    6e-08    



>ref|XP_009616023.1| PREDICTED: uncharacterized protein LOC104108647 [Nicotiana tomentosiformis]
Length=993

 Score =   357 bits (916),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDGS N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERC+KELRS H K +NVIAE YN+LLCMCKEQMACFA +LL++VVE+LD 
Sbjct  67   RIPKIAKYLEERCHKELRSEHIKFINVIAEVYNKLLCMCKEQMACFAASLLDMVVELLDD  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ IGC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE QK  LRASSL+C
Sbjct  127  SKRDAIRIIGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHQKCSLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFSHIFAD DEIVHVT
Sbjct  187  LSAMVWFMAEFSHIFADFDEIVHVT  211



>ref|XP_004230310.1| PREDICTED: uncharacterized protein LOC101249681 [Solanum lycopersicum]
Length=988

 Score =   357 bits (915),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 183/205 (89%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDGS N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRS H K +NVIAE YN+LLCMCKEQMA FA +LL++VVE+LD 
Sbjct  67   RIPKIAKYLEERCYKELRSEHIKFINVIAEVYNKLLCMCKEQMAYFAASLLDMVVELLDD  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DAV+  GC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE +KR LRASSL+C
Sbjct  127  SKKDAVRITGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHEKRSLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFSHIF D DEIVHVT
Sbjct  187  LSAMVWFMAEFSHIFVDFDEIVHVT  211



>ref|XP_006344767.1| PREDICTED: uncharacterized protein LOC102580046 [Solanum tuberosum]
Length=993

 Score =   354 bits (909),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 167/205 (81%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDGS N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGSPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRS H K +NVIAE YN+LLCMCKEQMA FA +LL++VVE+LD 
Sbjct  67   RIPKIAKYLEERCYKELRSEHIKFINVIAEVYNKLLCMCKEQMAYFAASLLDMVVELLDD  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DAV+  GC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE +KR LRASSL+C
Sbjct  127  SKKDAVRITGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHEKRSLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAE SHIF D DEIVHVT
Sbjct  187  LSAMVWFMAEVSHIFVDFDEIVHVT  211



>ref|XP_009783972.1| PREDICTED: uncharacterized protein LOC104232454 [Nicotiana sylvestris]
Length=991

 Score =   351 bits (901),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 166/205 (81%), Positives = 183/205 (89%), Gaps = 2/205 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPAC +MCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDGS N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACGNMCICCPAMRSRSRQPVKRYKKLLAEIFPKTPDGSPNDRKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERC+KELRS H K +NVIAE YN+LLCMCKEQMACFA +LL++VVE+LD 
Sbjct  67   RIPKIAKYLEERCHKELRSEHIKFINVIAEVYNKLLCMCKEQMACFAASLLDMVVELLDD  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ IGC T T+FIYSQVDGTYTYNIE LV KVCSLARETGEE Q   LRASSL+C
Sbjct  127  SKRDAIRIIGCQTLTRFIYSQVDGTYTYNIETLVPKVCSLARETGEEHQN--LRASSLQC  184

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFSHIF D DEIVHVT
Sbjct  185  LSAMVWFMAEFSHIFVDFDEIVHVT  209



>ref|XP_007208429.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
 gb|EMJ09628.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
Length=1000

 Score =   335 bits (860),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CKEQMA FAV+LL+VV E+LD 
Sbjct  67   RIPKIAKYLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKEQMAYFAVSLLSVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             K D ++ +GC T T+FI+SQ DGTYT+ IE+LV +VC LARE+GE+ QKRCLRASSL+C
Sbjct  127  PKQDPLRILGCQTLTRFIFSQTDGTYTHTIESLVHRVCKLARESGEDHQKRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMV FMAEFS+IF D DEIVHVT
Sbjct  187  LSAMVQFMAEFSYIFVDFDEIVHVT  211



>ref|XP_008246002.1| PREDICTED: uncharacterized protein LOC103344152 [Prunus mume]
Length=999

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CKEQMA FAV+LL+VV E+LD 
Sbjct  67   RIPKIAKYLEDRCYKELRLEHIKFINIVAEAYNKLLCLCKEQMAYFAVSLLSVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             K D +  +GC T T+FIYSQ DGTYT+ IE+LV +VC LARE+GE+ Q+RCLRASSL+C
Sbjct  127  PKQDPLGILGCQTLTRFIYSQTDGTYTHTIESLVHRVCKLARESGEDHQRRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMV FMAEFS+IF D DEIVHVT
Sbjct  187  LSAMVQFMAEFSYIFVDFDEIVHVT  211



>ref|XP_007031156.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY11658.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=1000

 Score =   334 bits (857),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI KLCEYAAKNPF
Sbjct  7    KIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E Y++LLCMCKEQMA FAVNLLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRHEHIKFINIVTEAYHKLLCMCKEQMAYFAVNLLNVVGELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ +GC T TKFIYSQ DGTYT+NIE  V KVC L+RE GEE Q+RCLRASSL+C
Sbjct  127  SKQDAMRILGCQTLTKFIYSQADGTYTHNIEKFVPKVCKLSREDGEEHQRRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++S+IFA  DE+VH T
Sbjct  187  LSAMVWFMAQYSYIFATLDEMVHAT  211



>ref|XP_007031155.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY11657.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1019

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI KLCEYAAKNPF
Sbjct  7    KIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDAPPNERKIAKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E Y++LLCMCKEQMA FAVNLLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRHEHIKFINIVTEAYHKLLCMCKEQMAYFAVNLLNVVGELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ +GC T TKFIYSQ DGTYT+NIE  V KVC L+RE GEE Q+RCLRASSL+C
Sbjct  127  SKQDAMRILGCQTLTKFIYSQADGTYTHNIEKFVPKVCKLSREDGEEHQRRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++S+IFA  DE+VH T
Sbjct  187  LSAMVWFMAQYSYIFATLDEMVHAT  211



>ref|XP_002318950.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
 gb|EEE94873.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
Length=994

 Score =   333 bits (853),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEYAAKNPF
Sbjct  7    NIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRSGH K +N++ E YN+LLCMCK+QMA FA++LLNVV E+L+ 
Sbjct  67   RIPKIAKYLEERCYKELRSGHVKFINIVTEAYNKLLCMCKDQMAYFAISLLNVVNELLEK  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D +  +GC T T+FIYSQ DGTY++NIE  V KVC+LARE G E+ K CLRASSL+C
Sbjct  127  SKQDPLMILGCQTLTRFIYSQADGTYSHNIEKFVHKVCNLARENGNENNKSCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFS+IFA  DEIVHVT
Sbjct  187  LSAMVWFMAEFSYIFAAFDEIVHVT  211



>gb|EYU40497.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
 gb|EYU40498.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
Length=987

 Score =   331 bits (848),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPK+PDG  N RKI+KLCEYA+KNPF
Sbjct  7    NIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKTPDGHPNDRKIVKLCEYASKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEE+CYKELRSG+ KLV ++AE YN+LLC CK+Q A FAV+L+NVV+E+LD 
Sbjct  67   RIPKIAKYLEEKCYKELRSGNIKLVGIVAEAYNKLLCSCKDQTAYFAVSLVNVVIELLDE  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D+V+ +GC T T F+Y QVDGTYT+NIEN V KVC LAR+T +E QKR LRASSLRC
Sbjct  127  SKQDSVQKMGCDTLTTFVYCQVDGTYTHNIENFVHKVCMLARKTEDEHQKRGLRASSLRC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFSH+F D ++IVH T
Sbjct  187  LSAMVWFMAEFSHVFDDFEKIVHAT  211



>ref|XP_011092150.1| PREDICTED: uncharacterized protein LOC105172430 [Sesamum indicum]
Length=995

 Score =   330 bits (847),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG +N RKI+KLCEYA+KNP 
Sbjct  7    KIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSHDGQSNERKIVKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRSG+ + V+++AE YN+LLC+CKEQMA F+ NLLN+V+E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRSGNIRFVSIVAETYNKLLCICKEQMAYFSFNLLNMVIELLDD  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA+  IGC T T FIY Q+DGTYT NIEN V KVC LAR+T +E QKR LRASSLRC
Sbjct  127  SKQDALLIIGCDTLTTFIYCQMDGTYTRNIENFVDKVCMLARKTEDEHQKRGLRASSLRC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFSHIFAD ++IVH T
Sbjct  187  LSAMVWFMAEFSHIFADFEKIVHAT  211



>gb|KJB45453.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
 gb|KJB45454.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
Length=1000

 Score =   330 bits (845),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDSPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCK QMA FAVNLLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRYEHIKFINIVTEAYNKLLCMCKAQMAYFAVNLLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ +GC T T FIYSQVDGTYT++IE  V KVC LARE GEE Q+RCL+ASSL+C
Sbjct  127  SKQDAMRILGCETLTSFIYSQVDGTYTHSIEKFVHKVCKLAREDGEEHQRRCLKASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++S+IFA  DE+V+ T
Sbjct  187  LSAMVWFMAQYSYIFAALDEMVYAT  211



>gb|KJB81105.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=847

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEYAA+NPF
Sbjct  7    KIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEYAARNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVVSELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLRASSL+C
Sbjct  127  SKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++S+IF+  DEIVH T
Sbjct  187  LSAMVWFMAQYSYIFSALDEIVHAT  211



>gb|KJB81106.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=870

 Score =   326 bits (835),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEYAA+NPF
Sbjct  7    KIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEYAARNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVVSELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLRASSL+C
Sbjct  127  SKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++S+IF+  DEIVH T
Sbjct  187  LSAMVWFMAQYSYIFSALDEIVHAT  211



>ref|XP_011023781.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023783.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023784.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
Length=994

 Score =   328 bits (840),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEYAAKNPF
Sbjct  7    NIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGHPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERC+KELRSGH K +N++ E YN+LLCMCK+QMA FA++LLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCFKELRSGHVKFINIVTEAYNKLLCMCKDQMAYFAISLLNVVNELLDK  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D +  +GC T T+FIYSQ DGTY++NIE  V KVC+LA E G E+ + CLRASSL+C
Sbjct  127  SKQDPLMILGCQTLTRFIYSQADGTYSHNIEKFVHKVCNLACENGNENNRSCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFS+IFA  DEIVHVT
Sbjct  187  LSAMVWFMAEFSYIFAAFDEIVHVT  211



>gb|KJB81104.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=996

 Score =   327 bits (837),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEYAA+NPF
Sbjct  7    KIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEYAARNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRYKHVKFINIVIEAYNKLLCMCKEQMAYFAVNLLNVVSELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLRASSL+C
Sbjct  127  SKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++S+IF+  DEIVH T
Sbjct  187  LSAMVWFMAQYSYIFSALDEIVHAT  211



>ref|XP_006394914.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32200.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=976

 Score =   326 bits (835),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+LD 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QKRCLRAS L+C
Sbjct  127  SKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREEGDEPQKRCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVWFM EFSHIFA  DEIVH
Sbjct  187  LSAMVWFMGEFSHIFAAVDEIVH  209



>ref|XP_006394915.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32201.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=983

 Score =   326 bits (835),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NIFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+LD 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QKRCLRAS L+C
Sbjct  127  SKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREEGDEPQKRCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVWFM EFSHIFA  DEIVH
Sbjct  187  LSAMVWFMGEFSHIFAAVDEIVH  209



>ref|XP_009373286.1| PREDICTED: uncharacterized protein LOC103962316 [Pyrus x bretschneideri]
Length=997

 Score =   326 bits (835),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 176/205 (86%), Gaps = 2/205 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPDG  N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR  H K +N++ E YN+LLC+CKEQMACFAV+L++VV E+LD 
Sbjct  67   RIPKIAKYLEDRCYKELRLEHIKFINIVVEAYNKLLCLCKEQMACFAVSLVHVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ +GC T T FIYSQ DGTYT+ IE+LV KVC LAR++GE  Q   LRASSL+C
Sbjct  127  SKQDAMRILGCQTLTNFIYSQTDGTYTHTIESLVHKVCKLARQSGEVHQ--SLRASSLQC  184

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMV FMAEFS+IF D DEIVHVT
Sbjct  185  LSAMVRFMAEFSYIFVDFDEIVHVT  209



>gb|KHG02153.1| Protein EFR3 [Gossypium arboreum]
Length=999

 Score =   325 bits (833),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPACESMC+CCPALRSRSRQPVKRYKKLL++IFPKSP    N RKI KLCEYAA+NPF
Sbjct  7    KIFPACESMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPGAPPNERKITKLCEYAARNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCKEQMA FAVNLLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRYKHVKFINIVTEAYNKLLCMCKEQMAYFAVNLLNVVSELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K +A + +GC T TKFIYSQ DGTYT+NIE  V KVC LA E GEE  + CLRASSL+C
Sbjct  127  SKQEATQILGCQTLTKFIYSQADGTYTHNIEKFVHKVCKLAHEDGEEHLRSCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++ +IF+  DEIVH T
Sbjct  187  LSAMVWFMAQYPYIFSALDEIVHAT  211



>ref|XP_008370375.1| PREDICTED: uncharacterized protein LOC103433867 [Malus domestica]
Length=997

 Score =   325 bits (832),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 177/205 (86%), Gaps = 2/205 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPK+PDG  N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKAPDGPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR GH K +N++A+ YN+LLC+CKEQMACFAV+L++VV E+LD 
Sbjct  67   RIPKIAKYLEDRCYKELRLGHIKFINIVADTYNKLLCLCKEQMACFAVSLVSVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D V+ +GC T T FIYSQ D TYT+ IE+LV KVC LAR++GE+ Q   LRASSL+C
Sbjct  127  SKQDTVRILGCQTLTNFIYSQTDCTYTHTIESLVHKVCKLARQSGEDQQ--SLRASSLQC  184

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMV FMAEFS+IF D DEI+HVT
Sbjct  185  LSAMVKFMAEFSYIFVDFDEIIHVT  209



>ref|NP_198037.3| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031947.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031948.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190405.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93613.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93614.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93615.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93616.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
Length=983

 Score =   324 bits (830),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 168/203 (83%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+LD 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLRAS L+C
Sbjct  127  SKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVW+M EFSHIFA  DEIVH
Sbjct  187  LSAMVWYMGEFSHIFATVDEIVH  209



>ref|XP_002872241.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48500.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
Length=983

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMC+CCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACESMCVCCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+LD 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLRAS L+C
Sbjct  127  SKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVW+M EFSHIFA  DEIVH
Sbjct  187  LSAMVWYMGEFSHIFATVDEIVH  209



>ref|XP_010546763.1| PREDICTED: uncharacterized protein LOC104818746 [Tarenaya hassleriana]
Length=989

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG+ N RKI+KLCEYAA+NP 
Sbjct  7    RVFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKSLDGAPNERKIVKLCEYAARNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRS   K ++++ E YN++LC+CKEQMA FA ++L+VV E+LD 
Sbjct  67   RIPKIAKFLEERCYKELRSEQIKFISIVTEAYNKMLCLCKEQMAYFATSVLSVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D+ K +GC T T+FIYSQVDG+YT+NIEN V KVCSLA E G+E QKRCLRAS L+C
Sbjct  127  SKQDSTKMLGCQTLTRFIYSQVDGSYTHNIENFVHKVCSLAHEDGDEHQKRCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVWFM EFS+IFA  DEIVH
Sbjct  187  LSAMVWFMGEFSYIFAAFDEIVH  209



>ref|XP_004302237.1| PREDICTED: uncharacterized protein LOC101313033 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1003

 Score =   323 bits (829),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MC+CCPA+RSRSRQPVKRYKKLLA+IFPKSPDG +N RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CK QMA FA ++LNVV E+LD 
Sbjct  67   RIPKIAKHLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKNQMAYFAGSVLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ IGC T T+FI SQ DGTYT+NIE+LV KVC LA E+GE+ QKRCLRASSL+C
Sbjct  127  SKQDALRIIGCQTLTRFISSQTDGTYTHNIESLVHKVCELAHESGEDIQKRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAM+ FM E S+IF D DEIVH T
Sbjct  187  LSAMIQFMTEVSYIFVDFDEIVHAT  211



>ref|XP_011466140.1| PREDICTED: uncharacterized protein LOC101313033 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1004

 Score =   323 bits (829),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MC+CCPA+RSRSRQPVKRYKKLLA+IFPKSPDG +N RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGNMCVCCPAMRSRSRQPVKRYKKLLAEIFPKSPDGPSNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR  H K +N++AE YN+LLC+CK QMA FA ++LNVV E+LD 
Sbjct  67   RIPKIAKHLEDRCYKELRLEHVKFINIVAEAYNKLLCLCKNQMAYFAGSVLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ IGC T T+FI SQ DGTYT+NIE+LV KVC LA E+GE+ QKRCLRASSL+C
Sbjct  127  SKQDALRIIGCQTLTRFISSQTDGTYTHNIESLVHKVCELAHESGEDIQKRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAM+ FM E S+IF D DEIVH T
Sbjct  187  LSAMIQFMTEVSYIFVDFDEIVHAT  211



>gb|KHG26707.1| Efr3b [Gossypium arboreum]
Length=1041

 Score =   324 bits (830),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI+KLCEYAAKNPF
Sbjct  48   KIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDSPPNERKIVKLCEYAAKNPF  107

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCK QMA FAVNLLNVV E+LD 
Sbjct  108  RIPKIAKYLEERCYKELRYEHIKFINIVTEAYNKLLCMCKAQMAYFAVNLLNVVTELLDN  167

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ +GC T T FIYSQVDGTYT++IE  V KVC LA E  EE Q+RCL+ASSL+C
Sbjct  168  SKQDAMRILGCETLTTFIYSQVDGTYTHSIEKFVHKVCKLAHEDREEHQRRCLKASSLQC  227

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++S+IFA  DE+V+ T
Sbjct  228  LSAMVWFMAQYSYIFAALDEMVYAT  252



>gb|KHG26706.1| Protein EFR3 B [Gossypium arboreum]
Length=1050

 Score =   323 bits (829),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRSRSRQPVKRYKKLL++IFPKSPD   N RKI+KLCEYAAKNPF
Sbjct  48   KIFPACGSMCVCCPALRSRSRQPVKRYKKLLSEIFPKSPDSPPNERKIVKLCEYAAKNPF  107

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ E YN+LLCMCK QMA FAVNLLNVV E+LD 
Sbjct  108  RIPKIAKYLEERCYKELRYEHIKFINIVTEAYNKLLCMCKAQMAYFAVNLLNVVTELLDN  167

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ +GC T T FIYSQVDGTYT++IE  V KVC LA E  EE Q+RCL+ASSL+C
Sbjct  168  SKQDAMRILGCETLTTFIYSQVDGTYTHSIEKFVHKVCKLAHEDREEHQRRCLKASSLQC  227

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA++S+IFA  DE+V+ T
Sbjct  228  LSAMVWFMAQYSYIFAALDEMVYAT  252



>ref|XP_010455044.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
 ref|XP_010455045.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
Length=984

 Score =   322 bits (824),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGTPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+L+ 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLEN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE GEE QK CLRAS L+C
Sbjct  127  SKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGEEHQKLCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFM EFSHIFA  DEIVH T
Sbjct  187  LSAMVWFMGEFSHIFAAVDEIVHAT  211



>dbj|BAC41892.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ89612.1| At5g26850 [Arabidopsis thaliana]
Length=970

 Score =   321 bits (822),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+LD 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLRAS L+C
Sbjct  127  SKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVW+M EFSHIFA  DEIV   
Sbjct  187  LSAMVWYMGEFSHIFATVDEIVQTN  211



>ref|XP_010421542.1| PREDICTED: uncharacterized protein LOC104706999 isoform X2 [Camelina 
sativa]
Length=984

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+L+ 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLEN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK CLRAS L+C
Sbjct  127  SKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFTLKVCALAREEGDEHQKLCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFM EFSHIFA  DEIVH T
Sbjct  187  LSAMVWFMGEFSHIFAAVDEIVHAT  211



>ref|XP_008359849.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
 ref|XP_008359850.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
Length=997

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 175/205 (85%), Gaps = 2/205 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPACESMCICCPA+RSRSRQPVKRYKKLLA+IFPKSPD   N RKI+KLCEYAAKNPF
Sbjct  7    KLFPACESMCICCPAMRSRSRQPVKRYKKLLAEIFPKSPDCPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR  H K +N++ E YN+LLC+CKEQMACFAV+L++VV E+LD 
Sbjct  67   RIPKIAKYLEDRCYKELRLEHIKFINIVVEAYNKLLCLCKEQMACFAVSLVHVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DA++ +GC T T FIYSQ DGTYT+ IE+LV KVC LAR++GE  Q   LRASSL+C
Sbjct  127  SKQDAMRILGCQTLTNFIYSQTDGTYTHTIESLVHKVCKLARQSGEVHQ--SLRASSLQC  184

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMV FMAEFS+IF D DEIVHVT
Sbjct  185  LSAMVRFMAEFSYIFVDFDEIVHVT  209



>ref|XP_010493942.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Camelina sativa]
Length=984

 Score =   320 bits (820),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGAPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+L+ 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLEN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK CLRAS L+C
Sbjct  127  SKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGDEHQKLCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFM EFSHIFA  DEIVH T
Sbjct  187  LSAMVWFMGEFSHIFAAVDEIVHAT  211



>gb|KEH43106.1| cyclin-like protein [Medicago truncatula]
Length=997

 Score =   319 bits (818),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPACESMC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   N RKI+KLCEYAAKNPF
Sbjct  7    KIFPACESMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDELPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRS H KLV +IAE +N+LL +CK Q+  FAV++LNV  E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRSEHIKLVKIIAESFNKLLSICKAQITYFAVDVLNVTSELLDY  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K +A++ +GC + T+FIY QVD TYT+NIE LV+KVC L++E GE  + RCLRASSL+C
Sbjct  127  SKDEAIQALGCQSLTRFIYCQVDSTYTHNIEKLVRKVCMLSQEPGETHENRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFM EFSHIFAD DEIV+ T
Sbjct  187  LSAMVWFMTEFSHIFADFDEIVYAT  211



>ref|XP_002282109.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 ref|XP_010659702.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 emb|CBI39597.3| unnamed protein product [Vitis vinifera]
Length=1002

 Score =   319 bits (817),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEYAAKNPF
Sbjct  7    RIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K + ++ E YN+LLCMCK+QMA FAV+LLNVV E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRCEHIKFIAIVTEAYNKLLCMCKDQMAYFAVSLLNVVSELLDK  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             K DA++ +GC T T+FIY Q D TYT+NIEN V+KVC LARE G+E Q   L+ASSL+C
Sbjct  127  PKKDAMRILGCQTLTRFIYCQADSTYTHNIENFVRKVCMLAREAGDEQQTSTLKASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFS IF+D DEIVHVT
Sbjct  187  LSAMVWFMAEFSLIFSDFDEIVHVT  211



>gb|KDP23388.1| hypothetical protein JCGZ_23221 [Jatropha curcas]
Length=997

 Score =   319 bits (817),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 173/205 (84%), Gaps = 1/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEYAAKNPF
Sbjct  7    KIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCEYAAKNPF  65

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRS H K +N++ E Y++LLCMCKEQM  FA++LLNVV E+LD 
Sbjct  66   RIPKIAKYLEERCYKELRSEHIKFINIVTETYDKLLCMCKEQMVYFAISLLNVVSELLDK  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + DA+  +GC T T+FI+SQ DGTYT+NIE  V KVC LARE G+E QK  LRASSL+C
Sbjct  126  PRQDALLILGCQTLTRFIFSQTDGTYTHNIEKFVHKVCKLAREHGDEHQKNRLRASSLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMA+FS+IFA  DEI+ VT
Sbjct  186  LSAMVWFMAQFSYIFAAFDEIMQVT  210



>emb|CDP18254.1| unnamed protein product [Coffea canephora]
Length=1034

 Score =   318 bits (815),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MC+CCPALRSRSRQPVKRYKKLLADIFPKSPD  +N RK++KLCEYAAKNPF
Sbjct  53   KVFPACGNMCVCCPALRSRSRQPVKRYKKLLADIFPKSPDSPSNERKVVKLCEYAAKNPF  112

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LE+RCYKELRS + K V ++ E YN+LL +CK+QMA FA+NLL++VVE+LD 
Sbjct  113  RIPKITKYLEDRCYKELRSQNIKFVEIVVEAYNKLLSICKDQMAYFAINLLSLVVELLDE  172

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K DAV+ IGC   T+FIYSQVDGTY+YN+E+LV KV  +A ETGEE QK  LRASSL+ 
Sbjct  173  SKQDAVRIIGCQMLTQFIYSQVDGTYSYNLESLVHKVSIIAHETGEEPQKHRLRASSLQS  232

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFM EFSHIFA  D+IVH T
Sbjct  233  LSAMVWFMGEFSHIFAAFDKIVHST  257



>emb|CDX87029.1| BnaC09g03440D [Brassica napus]
Length=982

 Score =   316 bits (809),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+L+ 
Sbjct  67   RIPKIAKILEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLEN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLRAS L+C
Sbjct  127  SKEDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREQGEEHQKKCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVWFM EFSHIFA  DEIVH
Sbjct  187  LSAMVWFMGEFSHIFAAFDEIVH  209



>ref|XP_002512512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49964.1| conserved hypothetical protein [Ricinus communis]
Length=972

 Score =   315 bits (808),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPACESMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEYAAKNPF
Sbjct  53   KIFPACESMCVCCPALRSRSRQPVKRYKKLLAEIFPKS-DGPPNERKIVKLCEYAAKNPF  111

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERC KELRS H K +N + E YN+LLC+CKEQMA FAV+LLNVV E+LD 
Sbjct  112  RIPKIAKYLEERCCKELRSEHIKFINTVTETYNKLLCVCKEQMAYFAVSLLNVVSELLDK  171

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             K DA+  +GC T T+FIYSQ DGTYT+NIE  VQKVC LARE G+E  K  LRASSL+C
Sbjct  172  PKQDALLILGCQTLTRFIYSQTDGTYTHNIEKFVQKVCKLAREHGDEHHKSRLRASSLQC  231

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEF +IF   DEIV VT
Sbjct  232  LSAMVWFMAEFLYIFGAFDEIVQVT  256



>ref|XP_010493940.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
 ref|XP_010493941.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
Length=986

 Score =   315 bits (807),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSP--DGSANGRKIMKLCEYAAKN  176
             +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSP  DG+ N RKI+KLCEYAAKN
Sbjct  7    NVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPVSDGAPNERKIVKLCEYAAKN  66

Query  177  PFRIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEML  356
            P RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+L
Sbjct  67   PIRIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELL  126

Query  357  DCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSL  536
            + +K D    +GC T T+FIYSQVDGTYT++IE    KVC+LARE G+E QK CLRAS L
Sbjct  127  ENSKLDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCALAREEGDEHQKLCLRASGL  186

Query  537  RCLSAMVWFMAEFSHIFADXDEIVHVT  617
            +CLSAMVWFM EFSHIFA  DEIVH T
Sbjct  187  QCLSAMVWFMGEFSHIFAAVDEIVHAT  213



>ref|XP_009111721.1| PREDICTED: protein EFR3 homolog B-like [Brassica rapa]
Length=982

 Score =   315 bits (806),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+L+ 
Sbjct  67   RIPKIAKILEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLEN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE G+E QK+CLRAS L+C
Sbjct  127  SKEDTPTILGCQTLTRFIYSQVDGTYTHSIEKFAHKVCSLAREQGDEHQKQCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVWFM EFSHIFA  DEIVH
Sbjct  187  LSAMVWFMGEFSHIFAAFDEIVH  209



>gb|AAB61061.1| Hypothetical protein F2P16.24 [Arabidopsis thaliana]
Length=907

 Score =   313 bits (802),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 168/221 (76%), Gaps = 18/221 (8%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACESMCICCPALRSRSRQPVKRYKKLL +IFPKSPDG  N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACESMCICCPALRSRSRQPVKRYKKLLGEIFPKSPDGGPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+LD 
Sbjct  67   RIPKIAKFLEERCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIYSQVDGTYT++IE    KVCSLARE GEE QK+CLRAS L+C
Sbjct  127  SKQDTPTILGCQTLTRFIYSQVDGTYTHSIEKFALKVCSLAREEGEEHQKQCLRASGLQC  186

Query  543  LSAM------------------VWFMAEFSHIFADXDEIVH  611
            LSAM                  VW+M EFSHIFA  DEIVH
Sbjct  187  LSAMVLELVLLIFQIQSILLPKVWYMGEFSHIFATVDEIVH  227



>ref|XP_003536043.1| PREDICTED: uncharacterized protein LOC100785587 isoform X1 [Glycine 
max]
 ref|XP_006589117.1| PREDICTED: uncharacterized protein LOC100785587 isoform X2 [Glycine 
max]
Length=997

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRS H KLVN+IAE +N+LL +CK Q+A FAV++LNV++E+L  
Sbjct  67   RIPKIAKYLEERCYKELRSEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVILELLSY  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + ++T+GC   ++FIY QVD TYT++IE LV+KVC L++E GE  +KRCLRASSL+C
Sbjct  127  SKDETIQTLGCQCLSRFIYCQVDATYTHSIEKLVRKVCMLSQEHGEAREKRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVWFMAEFSHIF D DEIVH
Sbjct  187  LSAMVWFMAEFSHIFVDFDEIVH  209



>ref|XP_006589118.1| PREDICTED: uncharacterized protein LOC100785587 isoform X3 [Glycine 
max]
 gb|KHN16056.1| Protein EFR3 like A [Glycine soja]
Length=996

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSERKIIKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRS H KLVN+IAE +N+LL +CK Q+A FAV++LNV++E+L  
Sbjct  67   RIPKIAKYLEERCYKELRSEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVILELLSY  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + ++T+GC   ++FIY QVD TYT++IE LV+KVC L++E GE  +KRCLRASSL+C
Sbjct  127  SKDETIQTLGCQCLSRFIYCQVDATYTHSIEKLVRKVCMLSQEHGEAREKRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVWFMAEFSHIF D DEIVH
Sbjct  187  LSAMVWFMAEFSHIFVDFDEIVH  209



>ref|XP_004495652.1| PREDICTED: uncharacterized protein LOC101508441 isoform X1 [Cicer 
arietinum]
 ref|XP_004495653.1| PREDICTED: uncharacterized protein LOC101508441 isoform X2 [Cicer 
arietinum]
 ref|XP_004495654.1| PREDICTED: uncharacterized protein LOC101508441 isoform X3 [Cicer 
arietinum]
 ref|XP_004495655.1| PREDICTED: uncharacterized protein LOC101508441 isoform X4 [Cicer 
arietinum]
Length=994

 Score =   312 bits (800),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRSRSRQPVKRY+KLL DIFPKSPD   N RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGSMCVCCPALRSRSRQPVKRYRKLLVDIFPKSPDELPNERKIIKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELRS H KLV ++AE +N+LL MCK Q+A FAV++LNV+ E+L  
Sbjct  67   RIPKIAKYLEERCYKELRSEHIKLVKIVAESFNKLLSMCKVQIAYFAVDVLNVISELLGY  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + ++T+GC + T+FIY QVD TYT+NIE LV+KVC L++E GE  +K CL+ASSL+C
Sbjct  127  SKDETIQTLGCQSLTRFIYCQVDATYTHNIEKLVRKVCMLSQEPGETHEKHCLKASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFM EFSHIF D DEIV+ T
Sbjct  187  LSAMVWFMTEFSHIFVDFDEIVYAT  211



>emb|CDY19753.1| BnaA09g04060D [Brassica napus]
Length=982

 Score =   312 bits (799),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 166/203 (82%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
             +FPACE+MC+CCPALR RS+ P KRYKKLL +IFPKSPDG+ N RKI+KLCEYAAKNP 
Sbjct  7    NVFPACETMCVCCPALRPRSKHPAKRYKKLLGEIFPKSPDGAPNERKIVKLCEYAAKNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEE+CYK+LRS   K +N++ E YN++LC CK+QMA FA +LLNVV E+L+ 
Sbjct  67   RIPKIAKILEEKCYKDLRSEQMKFINIVTEAYNKMLCHCKDQMAYFATSLLNVVTELLEN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K D    +GC T T+FIY+QVDGTYT++IE    KVCSLARE G+E QK+CLRAS L+C
Sbjct  127  SKEDTPTILGCQTLTRFIYNQVDGTYTHSIEKFAHKVCSLAREQGDEHQKQCLRASGLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAMVWFM EFSHIFA  DEIVH
Sbjct  187  LSAMVWFMGEFSHIFAAFDEIVH  209



>ref|XP_006433539.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
 gb|ESR46779.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
Length=999

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H KL+N++ E YN++LCMCK QMA FAV+LLNV  E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRCEHIKLINIVTEAYNKMLCMCKVQMAYFAVSLLNVATELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + V+ +GC T ++FIYSQ DGTYT+NIE  V+KVC LA E G E Q R LRASSL+C
Sbjct  127  SKQETVQILGCQTLSRFIYSQADGTYTHNIEKFVKKVCKLACENGVEHQ-RSLRASSLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFS IFAD DEIV  T
Sbjct  186  LSAMVWFMAEFSCIFADFDEIVSAT  210



>ref|XP_003555181.1| PREDICTED: uncharacterized protein LOC100788290 [Glycine max]
Length=995

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD S + RKI KLCEYAAKNPF
Sbjct  7    KIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H KLVN+IAE +N+LL +CK Q+A FAV++LNV++E+L  
Sbjct  67   RIPKIAKYLEERCYKELRYEHIKLVNIIAESFNKLLSICKVQIAYFAVDVLNVILELLSY  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + ++T+GC   +KFIY Q+D TYT+NIE LV KVC L+RE GE  +KRCLRASSL+C
Sbjct  127  SKDETIQTLGCQCLSKFIYCQMDATYTHNIEKLVPKVCMLSREHGEACEKRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFSHIF D DEIV  T
Sbjct  187  LSAMVWFMAEFSHIFVDFDEIVRAT  211



>ref|XP_010267987.1| PREDICTED: uncharacterized protein LOC104605067 isoform X2 [Nelumbo 
nucifera]
Length=989

 Score =   309 bits (791),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ P C +MC+CCPALRSRSRQP KRYKKLL++IFPKS DG  N RKI+KLCEYA++NP 
Sbjct  7    KVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEYASRNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELRS H K VNVI E YN+LLCMCKEQMA FA++LLNVV+E+LD 
Sbjct  67   RIPKIAKYLEQRIYKELRSEHIKFVNVIMEAYNKLLCMCKEQMAYFALSLLNVVIELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             K D V+ +GC    +FIYSQ D TYT+NIE LV KVCSLA E+GEE  K+CLRASSL+C
Sbjct  127  TKQDVVRILGCQILARFIYSQADSTYTHNIEGLVHKVCSLACESGEERSKQCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LS+M+WFM EFSH+F D DEIVH
Sbjct  187  LSSMMWFMGEFSHVFDDFDEIVH  209



>ref|XP_010267985.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267986.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
Length=1001

 Score =   309 bits (791),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 167/203 (82%), Gaps = 0/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ P C +MC+CCPALRSRSRQP KRYKKLL++IFPKS DG  N RKI+KLCEYA++NP 
Sbjct  7    KVLPVCGNMCVCCPALRSRSRQPTKRYKKLLSEIFPKSLDGPPNERKIVKLCEYASRNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELRS H K VNVI E YN+LLCMCKEQMA FA++LLNVV+E+LD 
Sbjct  67   RIPKIAKYLEQRIYKELRSEHIKFVNVIMEAYNKLLCMCKEQMAYFALSLLNVVIELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             K D V+ +GC    +FIYSQ D TYT+NIE LV KVCSLA E+GEE  K+CLRASSL+C
Sbjct  127  TKQDVVRILGCQILARFIYSQADSTYTHNIEGLVHKVCSLACESGEERSKQCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LS+M+WFM EFSH+F D DEIVH
Sbjct  187  LSSMMWFMGEFSHVFDDFDEIVH  209



>ref|XP_010024133.1| PREDICTED: uncharacterized protein LOC104414673 [Eucalyptus grandis]
 gb|KCW60561.1| hypothetical protein EUGRSUZ_H03293 [Eucalyptus grandis]
Length=993

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPA+RSRSRQPVKRYKKLLADIFPKSPDGS N RKI KLCEYAAKNPF
Sbjct  7    KIFPACGSMCVCCPAMRSRSRQPVKRYKKLLADIFPKSPDGSPNDRKIGKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELRS H K +N+  E YN+LL MCKEQM  FAV+LL VV E+LD 
Sbjct  67   RIPKIVKYLEERCYKELRSEHIKFINIAVEAYNKLLSMCKEQMVYFAVSLLTVVSELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             K D+++ +GC T TKFIYSQ D TY +NIE  V KVC LA+++GE  Q   LRASSL+C
Sbjct  127  GKQDSLQILGCQTLTKFIYSQSDSTYAHNIEKFVHKVCILAQKSGEGHQWCALRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFM EFS +F   DEIV VT
Sbjct  187  LSAMVWFMVEFSSMFDGFDEIVQVT  211



>ref|XP_007145003.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
 gb|ESW16997.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
Length=999

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD   + RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDEPPSDRKIIKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERC +EL+S H K+VN+I E +N+LL +CK Q+A FAV++LNV+ E+L  
Sbjct  67   RIPKIAKYLEERCSRELKSEHIKMVNIIMESFNKLLSICKVQIAYFAVDVLNVISEILSY  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + ++T+GC   ++FIY QVD TYTYNIE LV+KV  L+R+ GE  +KRCLRASSL+C
Sbjct  127  SKDETIQTLGCQCLSRFIYCQVDSTYTYNIEKLVRKVSMLSRDHGEASEKRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFSHIF D DEIVH T
Sbjct  187  LSAMVWFMAEFSHIFVDFDEIVHTT  211



>ref|XP_006472204.1| PREDICTED: uncharacterized protein LOC102623618 [Citrus sinensis]
Length=1000

 Score =   307 bits (787),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 169/205 (82%), Gaps = 1/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H KL+N++ E YN++LCMCK QMA FAV+LLNV  E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRCEHIKLINIVTEAYNKMLCMCKVQMAYFAVSLLNVATELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + V+ +GC T ++FIYSQ D TYT+NIE  V+KVC LA E G E  +R LRASSL+C
Sbjct  127  SKQETVQILGCQTLSRFIYSQADSTYTHNIEKFVKKVCKLACENGVE-HRRSLRASSLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFS IFAD DEIV  T
Sbjct  186  LSAMVWFMAEFSCIFADFDEIVSAT  210



>ref|XP_010092978.1| hypothetical protein L484_018915 [Morus notabilis]
 gb|EXB53031.1| hypothetical protein L484_018915 [Morus notabilis]
Length=1022

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 173/224 (77%), Gaps = 20/224 (9%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRS SR+PVKRYKKLLA+IFPKS DG  + RKI+KLCEYA++NP 
Sbjct  7    KIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEYASRNPV  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ + Y++LLC+CKEQMA FAV+LLNV+ E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRCEHIKFINIVTDTYSKLLCLCKEQMAYFAVSLLNVINELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQV--------------------DGTYTYNIENLVQKVCSL  482
            +K DAV+ +GC T T+FIYSQ+                    DGTYT+NIE+ V KVC L
Sbjct  127  SKQDAVRILGCQTLTRFIYSQIFVVIDFYHELMFNGLMYEQADGTYTHNIESFVHKVCLL  186

Query  483  ARETGEEDQKRCLRASSLRCLSAMVWFMAEFSHIFADXDEIVHV  614
            ARE G + Q+  LRASSL+CLSAMVWFMAEFS+IF D DEIVHV
Sbjct  187  ARERGGDHQRHSLRASSLQCLSAMVWFMAEFSNIFVDFDEIVHV  230



>ref|XP_006840435.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
 gb|ERN02110.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
Length=1003

 Score =   301 bits (771),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++FP C S+C+CCPALRSRSRQPVKRYKKLL+DIFPKS DG  N R+I KLCEYAAKNPF
Sbjct  7    RVFPVCGSICVCCPALRSRSRQPVKRYKKLLSDIFPKSLDGPPNERRITKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R +KEL   H K + +I + +N+LL MCKEQM  FA+ LLNV+ + LD 
Sbjct  67   RIPKIAKFLEQRSHKELHCDHFKYIEIIMQAFNKLLSMCKEQMPYFAIYLLNVISDHLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++   ++ +GC T T FIYSQ DGTYT+NIE LV+KVC LARE+GEE +KR LRASSL+C
Sbjct  127  SRPVTIQILGCQTLTNFIYSQADGTYTHNIEGLVRKVCVLARESGEESEKRRLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LSAMVWFMAEFSHIF D DEI++VT
Sbjct  187  LSAMVWFMAEFSHIFTDFDEIIYVT  211



>ref|XP_010674649.1| PREDICTED: protein EFR3 homolog A [Beta vulgaris subsp. vulgaris]
Length=998

 Score =   301 bits (770),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 166/204 (81%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFPAC SMC+CCPALRSRSRQPVKRYKKL+ADIFPKSPDG  N RK++KLCEYAAKNP 
Sbjct  7    KLFPACGSMCVCCPALRSRSRQPVKRYKKLIADIFPKSPDGQTNERKLVKLCEYAAKNPV  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEE+ ++ELR GH K+V ++ E Y++LLCMC +QMA FA +LL +  E+LD 
Sbjct  67   RIPKITKQLEEKFFRELRYGHLKIVGIVMEAYDKLLCMCGKQMAYFAASLLLLSDEVLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K  +V+ +GC T T+FIYSQ DGTY  NI   V KVC LA+ETGEE QKR LRASSL+C
Sbjct  127  SKEVSVQVVGCQTLTRFIYSQTDGTYARNIGTFVNKVCMLAKETGEEHQKRSLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVW+MAEFSHI+ + DE+V V
Sbjct  187  LSAMVWYMAEFSHIYNNVDEVVQV  210



>ref|XP_008453377.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453385.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453393.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453402.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
Length=995

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MCICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGNMCICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LE+RC KELR+   K + +IA+ YN+LL +CK QMA FA +LL V+VE+LD 
Sbjct  67   RIPKIVKYLEDRCCKELRNEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVIVELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            AK D ++ +GC T T FI++Q D TY +N+ENLV KVC LA E G++ +K+CLRASSL+C
Sbjct  127  AKHDDLRILGCQTLTNFIHNQADSTYMHNVENLVPKVCMLALERGDDHKKQCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            +SAMVWFM E+SHIF D DE+V V+
Sbjct  187  ISAMVWFMTEYSHIFPDFDEMVRVS  211



>ref|XP_008778937.1| PREDICTED: protein EFR3 homolog cmp44E-like [Phoenix dactylifera]
Length=352

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEYAAKNP 
Sbjct  7    KILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELRS H   V +I E Y++LL +CKEQMA FA++LLNV++E+LD 
Sbjct  67   RIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVIIELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+A+SL+C
Sbjct  127  KQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQAASLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E+S+IF D DEI+H
Sbjct  186  LSAMIWFMTEYSYIFTDFDEIIH  208



>ref|XP_004165925.1| PREDICTED: uncharacterized LOC101202927 [Cucumis sativus]
Length=995

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC ++CICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LE+RC KELRS   K + +IA+ YN+LL +CK QMA FA +LL V+VE+LD 
Sbjct  67   RIPKIVKYLEDRCCKELRSEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVIVELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            AK D ++ +GC T T FI++Q D TY + +ENLV KVC LA E GE+ +K+CLRASSL+C
Sbjct  127  AKHDDLRILGCQTLTNFIHNQADSTYMHTVENLVPKVCMLALERGEDHKKQCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            +SAMVWFM E+SHIF D DE+V V+
Sbjct  187  ISAMVWFMTEYSHIFLDFDEMVRVS  211



>ref|XP_004144747.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 gb|KGN61004.1| hypothetical protein Csa_2G034570 [Cucumis sativus]
Length=995

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC ++CICCPALRSRSRQPVKRYKKLLADIFPKS DG  + RKI+KLCEYAAKNPF
Sbjct  7    KIFPACGNICICCPALRSRSRQPVKRYKKLLADIFPKSLDGPQSERKIIKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LE+RC KELRS   K + +IA+ YN+LL +CK QMA FA +LL V+VE+LD 
Sbjct  67   RIPKIVKYLEDRCCKELRSEQVKCITIIADAYNKLLSLCKNQMAYFAGSLLKVIVELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            AK D ++ +GC T T FI++Q D TY + +ENLV KVC LA E GE+ +K+CLRASSL+C
Sbjct  127  AKHDDLRILGCQTLTNFIHNQADSTYMHTVENLVPKVCMLALERGEDHKKQCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            +SAMVWFM E+SHIF D DE+V V+
Sbjct  187  ISAMVWFMTEYSHIFLDFDEMVRVS  211



>emb|CDX80597.1| BnaC07g28470D [Brassica napus]
Length=951

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FPACE + +CCPA   RS  PVKRYK LL DIFPKSPDG++N RKI+KLCEYAAKNP  
Sbjct  8    VFPACERVFVCCPAYGPRSLHPVKRYKILLLDIFPKSPDGASNERKIVKLCEYAAKNPVH  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKIAKCLE  CYK+LRS   K +NV+ E YN +L  CK+ MA FA++LLNVV E+L  +
Sbjct  68   IPKIAKCLENMCYKDLRSRQMKFINVVTEAYNNMLFHCKDHMAYFAMSLLNVVTELLVNS  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            K DA   +GC T T+FIY+QVD TYT++IE    +VCSLARE G+E QKRCLRAS L+CL
Sbjct  128  KQDAPTILGCQTLTRFIYTQVDRTYTHSIEKFAHRVCSLAREEGDEHQKRCLRASGLQCL  187

Query  546  SAMVWFMAEFSHIFADXDEIVH  611
            SAMVWFM EFSHIFA  DEIVH
Sbjct  188  SAMVWFMGEFSHIFAAVDEIVH  209



>ref|XP_009384434.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384435.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384436.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=998

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KL PAC +MC+CCPAL   SR+PVKRYKKLLA++FPK+ DG  N RKIMKLCEYAA+NP 
Sbjct  7    KLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEYAARNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR+ H   V +I E Y++LL +CKEQMA FA++LL+V++E+LD 
Sbjct  67   RIPKIAKYLEQRCYKELRNEHINFVKIITEVYSKLLYICKEQMAYFAISLLDVIIELLDS  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D +K +GC T T+FI SQ D TYT+NIE LVQKVC LAR+ GEE QK  LRASSL+C
Sbjct  127  KQQDGIKILGCQTLTRFICSQADNTYTWNIEGLVQKVCMLARQNGEE-QKSLLRASSLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM+E  +IFA  DEI++
Sbjct  186  LSAMIWFMSEHPYIFAGLDEIIY  208



>ref|XP_009384437.1| PREDICTED: uncharacterized protein LOC103971984 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KL PAC +MC+CCPAL   SR+PVKRYKKLLA++FPK+ DG  N RKIMKLCEYAA+NP 
Sbjct  7    KLLPACGNMCVCCPALNPSSRRPVKRYKKLLAEVFPKNLDGLPNERKIMKLCEYAARNPI  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+RCYKELR+ H   V +I E Y++LL +CKEQMA FA++LL+V++E+LD 
Sbjct  67   RIPKIAKYLEQRCYKELRNEHINFVKIITEVYSKLLYICKEQMAYFAISLLDVIIELLDS  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D +K +GC T T+FI SQ D TYT+NIE LVQKVC LAR+ GEE QK  LRASSL+C
Sbjct  127  KQQDGIKILGCQTLTRFICSQADNTYTWNIEGLVQKVCMLARQNGEE-QKSLLRASSLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM+E  +IFA  DEI++
Sbjct  186  LSAMIWFMSEHPYIFAGLDEIIY  208



>gb|ABF95548.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
Length=729

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 161/203 (79%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEYAAKNP 
Sbjct  7    KLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+ E+L+ 
Sbjct  67   RIPKIAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVLTELLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R+ G E     LRA+SL+C
Sbjct  126  SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSRQQGVEHS--LLRAASLQC  183

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IF D DEIV 
Sbjct  184  LSAMIWFMKEHSYIFVDFDEIVQ  206



>ref|XP_010938251.1| PREDICTED: uncharacterized protein LOC105057345 isoform X2 [Elaeis 
guineensis]
Length=993

 Score =   282 bits (721),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PACE+MC+CCPALR  SR+PVKRYKKLL++IFPK+ DG  N RKI+KLCEYAA+NP 
Sbjct  7    KILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEYAARNPV  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELR GH   V +I E Y++LL +CKEQMA FA++LLNV++E+LD 
Sbjct  67   RIPKIAKFLEQRSYKELRCGHINFVKIITEAYSKLLYVCKEQMAYFAISLLNVIIELLDS  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             +   V+ +GC TFTKFIYSQ D TY  NIE+LVQKVC L+   G E QK  LRA+SL+C
Sbjct  127  KQQVRVQILGCQTFTKFIYSQADNTYARNIESLVQKVCMLSHGQG-EGQKSLLRAASLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E+S IF D DEI+H
Sbjct  186  LSAMIWFMTEYSCIFTDFDEIIH  208



>ref|XP_009151505.1| PREDICTED: uncharacterized protein LOC103874824 [Brassica rapa]
Length=767

 Score =   278 bits (712),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FPACE + +CCPA   RS  PVKRYK LL DIFPKSPDG+ N RKI+KLCEYAAKNP  
Sbjct  8    VFPACERVFVCCPAYGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIVKLCEYAAKNPVH  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKIAKCLE+ CYK+LRS   K + ++ E YN +L  CK+QM+ FA++LLNVV E+L  +
Sbjct  68   IPKIAKCLEKMCYKDLRSHQMKFIIIVTEAYNSMLFHCKDQMSYFAMSLLNVVTELLVNS  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            K D    +GC T T+FIYSQVDGTYT+++E   +KVCSL RE G+E Q   LRAS L+CL
Sbjct  128  KQDTPTILGCQTLTRFIYSQVDGTYTHSLEKFARKVCSLVREEGDEHQNLGLRASGLQCL  187

Query  546  SAMVWFMAEFSHIFADXDEIVH  611
            SAMVWFM EFSHIFA  DEIVH
Sbjct  188  SAMVWFMGEFSHIFAAVDEIVH  209



>ref|XP_010938250.1| PREDICTED: uncharacterized protein LOC105057345 isoform X1 [Elaeis 
guineensis]
Length=1003

 Score =   282 bits (721),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PACE+MC+CCPALR  SR+PVKRYKKLL++IFPK+ DG  N RKI+KLCEYAA+NP 
Sbjct  7    KILPACENMCVCCPALRPSSRRPVKRYKKLLSEIFPKTLDGPPNERKIIKLCEYAARNPV  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELR GH   V +I E Y++LL +CKEQMA FA++LLNV++E+LD 
Sbjct  67   RIPKIAKFLEQRSYKELRCGHINFVKIITEAYSKLLYVCKEQMAYFAISLLNVIIELLDS  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             +   V+ +GC TFTKFIYSQ D TY  NIE+LVQKVC L+   G E QK  LRA+SL+C
Sbjct  127  KQQVRVQILGCQTFTKFIYSQADNTYARNIESLVQKVCMLSHGQG-EGQKSLLRAASLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E+S IF D DEI+H
Sbjct  186  LSAMIWFMTEYSCIFTDFDEIIH  208



>ref|XP_008781115.1| PREDICTED: uncharacterized protein LOC103700980 isoform X2 [Phoenix 
dactylifera]
Length=993

 Score =   281 bits (720),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEYAAKNP 
Sbjct  7    KILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELRS H   V +I E Y++LL +CKEQMA FA++LLNV++E+LD 
Sbjct  67   RIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVIIELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+A+SL+C
Sbjct  127  KQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQAASLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E+S+IF D DEI+H
Sbjct  186  LSAMIWFMTEYSYIFTDFDEIIH  208



>emb|CDX88246.1| BnaA06g28370D [Brassica napus]
Length=963

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FPACE + +CCPAL  RS  PVKRYK LL DIFPKSPDG+ N RKI+KLCEYAAKNP  
Sbjct  8    VFPACERVFVCCPALGPRSLHPVKRYKLLLLDIFPKSPDGAPNERKIIKLCEYAAKNPVH  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKIAKCLE+ CYK+LRS   K + ++ E YN +L  CK+QM+ FA++LLNVV E+L  +
Sbjct  68   IPKIAKCLEKMCYKDLRSHQMKFIIIVTEAYNSMLFHCKDQMSYFAMSLLNVVTELLVNS  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            K D    +GC T T+FIYSQVDGTYT+++E   +KVCSL RE G+E Q   LRAS L+CL
Sbjct  128  KQDTPTILGCQTLTRFIYSQVDGTYTHSLEKFARKVCSLVREEGDEHQNLGLRASGLQCL  187

Query  546  SAMVWFMAEFSHIFADXDEIVH  611
            SAMVWFM EFSHIFA  DEIVH
Sbjct  188  SAMVWFMGEFSHIFAAVDEIVH  209



>ref|XP_008781114.1| PREDICTED: protein EFR3 homolog cmp44E-like isoform X1 [Phoenix 
dactylifera]
Length=1013

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 162/203 (80%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG+ N RKIMKLCEYAAKNP 
Sbjct  7    KILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGTPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELRS H   V +I E Y++LL +CKEQMA FA++LLNV++E+LD 
Sbjct  67   RIPKIAKFLEQRSYKELRSEHINFVKIITEVYSKLLYICKEQMAYFAISLLNVIIELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D+V+ +GC T TKFI SQ D TY  NIE LV+KVC LA   GEE QK  L+A+SL+C
Sbjct  127  KQRDSVQILGCQTLTKFICSQADSTYARNIECLVRKVCVLAYRQGEE-QKSLLQAASLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E+S+IF D DEI+H
Sbjct  186  LSAMIWFMTEYSYIFTDFDEIIH  208



>ref|XP_002465372.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
 gb|EER92370.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
Length=981

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 163/203 (80%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KL P+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEYAAKNP 
Sbjct  7    KLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+ E+L+ 
Sbjct  67   RIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLSICKEQMAYFAISLVNVLTELLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + +  +GC T   FI SQVD TY  NIE+LV KVC+L+R+ G+E   R LRA+SL+C
Sbjct  126  SKQENIHILGCQTLANFINSQVDNTYARNIESLVHKVCALSRQQGQE--HRLLRAASLQC  183

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IFAD DE+VH
Sbjct  184  LSAMIWFMKEHSYIFADFDEMVH  206



>ref|XP_006649970.1| PREDICTED: uncharacterized protein LOC102701065 [Oryza brachyantha]
Length=984

 Score =   280 bits (716),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 163/203 (80%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEYAAKNP 
Sbjct  7    KLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGPPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R +KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+ E+L+ 
Sbjct  67   RIPKIAKFLEQRSHKELRAAHVNFVKIITEAYSKLLFICKEQMAYFAISLVNVLTELLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC+L+R+ G E     LRA+SL+C
Sbjct  126  SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCALSRQQGVE--HSLLRAASLQC  183

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IFAD DEIV 
Sbjct  184  LSAMIWFMKEHSYIFADFDEIVQ  206



>ref|XP_008808672.1| PREDICTED: uncharacterized protein LOC103720646 isoform X2 [Phoenix 
dactylifera]
Length=986

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC +MC+C PALR  SR+PVKRYKKLLA+IFPK+ DG  N RKI+KLCEYAAKNP 
Sbjct  7    KILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEYAAKNPV  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELR  H   V +I E Y++LL +CKEQMA FA++LLNV++E+LD 
Sbjct  67   RIPKIAKFLEQRSYKELRCAHINFVKIITEVYSKLLYICKEQMAYFAISLLNVIIELLDS  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D+++ +GC TFTKFIYSQ D TY  NIE+LV+KVC LA    EE+QK  LRA+SL+C
Sbjct  127  KQQDSIQILGCQTFTKFIYSQADNTYARNIESLVRKVCMLAH-GQEEEQKSLLRAASLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E+S IF D DEI+H
Sbjct  186  LSAMIWFMTEYSCIFTDFDEIIH  208



>ref|XP_008808671.1| PREDICTED: uncharacterized protein LOC103720646 isoform X1 [Phoenix 
dactylifera]
Length=994

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC +MC+C PALR  SR+PVKRYKKLLA+IFPK+ DG  N RKI+KLCEYAAKNP 
Sbjct  7    KILPACGNMCVCFPALRPSSRRPVKRYKKLLAEIFPKTLDGPPNERKIIKLCEYAAKNPV  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELR  H   V +I E Y++LL +CKEQMA FA++LLNV++E+LD 
Sbjct  67   RIPKIAKFLEQRSYKELRCAHINFVKIITEVYSKLLYICKEQMAYFAISLLNVIIELLDS  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D+++ +GC TFTKFIYSQ D TY  NIE+LV+KVC LA    EE+QK  LRA+SL+C
Sbjct  127  KQQDSIQILGCQTFTKFIYSQADNTYARNIESLVRKVCMLAH-GQEEEQKSLLRAASLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E+S IF D DEI+H
Sbjct  186  LSAMIWFMTEYSCIFTDFDEIIH  208



>ref|XP_004984608.1| PREDICTED: uncharacterized protein LOC101782956 [Setaria italica]
Length=992

 Score =   280 bits (715),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 162/203 (80%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KL P+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKIMKLCEYAAKNP 
Sbjct  7    KLLPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+ E+L+ 
Sbjct  67   RIPKIAKFLEQRTHKELRSAHVSFVRIITEAYSKLLFICKEQMAYFAISLMNVLTELLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + +  +GC T   FI SQVD TY  NIE+LV+KVC L+R+ GEE   R LRA+SL+C
Sbjct  126  SKQENIHILGCQTLANFINSQVDNTYARNIESLVRKVCGLSRQQGEE--HRLLRAASLQC  183

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IFAD DE+V 
Sbjct  184  LSAMIWFMKEHSYIFADFDEVVQ  206



>ref|XP_010921489.1| PREDICTED: uncharacterized protein LOC105045026 [Elaeis guineensis]
Length=992

 Score =   279 bits (714),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 157/203 (77%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC +MC+CCPALR  SR+PVKRYKKLLA+IFPK+ DG  N RKIMKLCEYAAKNP 
Sbjct  7    KILPACGNMCVCCPALRPSSRRPVKRYKKLLAEIFPKNLDGPPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R YKELRS H   V +I E Y++LL +CKEQMA FA+ LLNV++E+LD 
Sbjct  67   RIPKIAKFLEQRSYKELRSEHINFVKIITETYSKLLYICKEQMAYFAIGLLNVIIELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D+V+ +GC T  KFIYSQ D TY  NIE+LV  VC LA   GEE Q   L+A+SL+C
Sbjct  127  KQRDSVQILGCQTLAKFIYSQADSTYARNIESLVGNVCVLAHGQGEE-QNSLLQAASLQC  185

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSA +WFM E+S+IF D DEI+H
Sbjct  186  LSATIWFMTEYSYIFTDFDEIIH  208



>emb|CAN82509.1| hypothetical protein VITISV_012725 [Vitis vinifera]
Length=1471

 Score =   282 bits (721),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++FPAC SMC+CCPALRSRSRQPVKRYKKLLA+IFPKS DG  N RKI+KLCEYAAKNPF
Sbjct  471  RIFPACGSMCVCCPALRSRSRQPVKRYKKLLAEIFPKSIDGPPNERKIVKLCEYAAKNPF  530

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K + ++ E YN+LLCMCK+QMA FAV+LLNVV E+LD 
Sbjct  531  RIPKIAKYLEERCYKELRCEHIKFIAIVTEAYNKLLCMCKDQMAYFAVSLLNVVSELLDK  590

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             K DA++ +GC T T+FIY Q D TYT+NIEN V+KVC LARE G+E Q   L+ASSL+C
Sbjct  591  PKKDAMRILGCQTLTRFIYCQADSTYTHNIENFVRKVCMLAREAGDEQQTSTLKASSLQC  650

Query  543  LSAMV  557
            LSAM+
Sbjct  651  LSAMI  655



>ref|XP_008646153.1| PREDICTED: uncharacterized protein LOC100384293 isoform X2 [Zea 
mays]
 tpg|DAA45028.1| TPA: hypothetical protein ZEAMMB73_794622 [Zea mays]
Length=982

 Score =   278 bits (711),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 162/203 (80%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KL P+CES+C+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEYAAKNP 
Sbjct  7    KLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+ E+L+ 
Sbjct  67   RIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLFICKEQMAYFAISLVNVLTELLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + V  +GC T   FI SQVD TY  NIE+LV KVC+L+R  GE+   R LRA+SL+C
Sbjct  126  SKQENVHILGCQTLANFINSQVDNTYARNIESLVHKVCALSRRQGED--HRLLRAASLQC  183

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IFAD DEIVH
Sbjct  184  LSAMIWFMKEHSYIFADFDEIVH  206



>ref|NP_001049903.1| Os03g0308200 [Oryza sativa Japonica Group]
 gb|ABF95547.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11817.1| Os03g0308200 [Oryza sativa Japonica Group]
 dbj|BAG93123.1| unnamed protein product [Oryza sativa Japonica Group]
Length=988

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 161/203 (79%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+PDG  N RKIMKLCEYAAKNP 
Sbjct  7    KLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+ E+L+ 
Sbjct  67   RIPKIAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVLTELLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R+ G E     LRA+SL+C
Sbjct  126  SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSRQQGVE--HSLLRAASLQC  183

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IF D DEIV 
Sbjct  184  LSAMIWFMKEHSYIFVDFDEIVQ  206



>gb|KHN23227.1| Protein EFR3 like cmp44E [Glycine soja]
Length=896

 Score =   275 bits (703),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC +MC+CCPALRSRSRQPVKRY+KLLADIFPKSPD S + RKI KLCEYAAKNPF
Sbjct  7    KIFPACGNMCVCCPALRSRSRQPVKRYRKLLADIFPKSPDESPSERKITKLCEYAAKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H KLVN+IAE +N+LL +CK Q+A FAV++LNV++E+L  
Sbjct  67   RIPKIAKYLEERCYKELRYEHLKLVNIIAESFNKLLSICKVQIAYFAVDVLNVILELLSY  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + ++T+GC   +KFIY Q+D TYT+NIE LV KVC L+RE GE  +KRCLRASSL+C
Sbjct  127  SKDETIQTLGCQCLSKFIYCQMDATYTHNIEKLVPKVCMLSREHGEACEKRCLRASSLQC  186

Query  543  LSAMVWFMAEFSHIFA  590
            LSAMV    E   I+A
Sbjct  187  LSAMVIEEIEKPEIWA  202



>ref|XP_010228707.1| PREDICTED: uncharacterized protein LOC100831072 isoform X1 [Brachypodium 
distachyon]
Length=995

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 160/203 (79%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK PDG  N RKIMKLCEYAAKNP 
Sbjct  7    KLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+ ++L+ 
Sbjct  67   RIPKIAKFLEQRSRKELRAAHVNYVKIITEAYSKLLFICKEQMAYFAISLVNVLTDLLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + +  +GC T  KFIYSQVD TY  N+E+LV KVC+L+R+ G E     LRA+SL+C
Sbjct  126  SKQENIHILGCQTLAKFIYSQVDNTYARNVESLVHKVCTLSRQQGVE--HNLLRAASLQC  183

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IFAD DEIV 
Sbjct  184  LSAMIWFMKEHSYIFADFDEIVQ  206



>ref|XP_003558072.1| PREDICTED: uncharacterized protein LOC100831072 isoform X2 [Brachypodium 
distachyon]
Length=994

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 160/203 (79%), Gaps = 3/203 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK PDG  N RKIMKLCEYAAKNP 
Sbjct  7    KLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKMPDGPPNERKIMKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R  KELR+ H   V +I E Y++LL +CKEQMA FA++L+NV+ ++L+ 
Sbjct  67   RIPKIAKFLEQRSRKELRAAHVNYVKIITEAYSKLLFICKEQMAYFAISLVNVLTDLLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + +  +GC T  KFIYSQVD TY  N+E+LV KVC+L+R+ G E     LRA+SL+C
Sbjct  126  SKQENIHILGCQTLAKFIYSQVDNTYARNVESLVHKVCTLSRQQGVE--HNLLRAASLQC  183

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IFAD DEIV 
Sbjct  184  LSAMIWFMKEHSYIFADFDEIVQ  206



>ref|XP_008646145.1| PREDICTED: uncharacterized protein LOC100384293 isoform X1 [Zea 
mays]
Length=983

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 162/204 (79%), Gaps = 4/204 (2%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KL P+CES+C+CCPALR  SR+PVKRYKKLLA+IFPK+PDG+ N RKI+KLCEYAAKNP 
Sbjct  7    KLLPSCESVCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGAPNERKIVKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE+R +KELRS H   V +I E Y++LL +CKEQMA FA++L+NV+ E+L+ 
Sbjct  67   RIPKIAKFLEQRSHKELRSAHVNFVRIITEAYSKLLFICKEQMAYFAISLVNVLTELLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYS-QVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLR  539
            +K + V  +GC T   FI S QVD TY  NIE+LV KVC+L+R  GE+   R LRA+SL+
Sbjct  126  SKQENVHILGCQTLANFINSQQVDNTYARNIESLVHKVCALSRRQGED--HRLLRAASLQ  183

Query  540  CLSAMVWFMAEFSHIFADXDEIVH  611
            CLSAM+WFM E S+IFAD DEIVH
Sbjct  184  CLSAMIWFMKEHSYIFADFDEIVH  207



>ref|XP_003591099.1| EFR3-like protein [Medicago truncatula]
Length=210

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 144/189 (76%), Gaps = 16/189 (8%)
 Frame = +3

Query  39   CPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFRIPKIAKCLEER  218
            CPALRSRSRQPVK Y+KLLADIFPKSP    N RKI+KLCEYAAKNP RIPKIAK LEER
Sbjct  26   CPALRSRSRQPVKCYRKLLADIFPKSP--LPNERKIVKLCEYAAKNPLRIPKIAKYLEER  83

Query  219  CYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCAKTDAVKTIGCL  398
            CYKELRS H KLV +IAE +N+LL +CK Q+  FAV++LNV  E+LD +K +A+      
Sbjct  84   CYKELRSEHIKLVKIIAESFNKLLSICKAQITYFAVDVLNVTSELLDYSKDEAI------  137

Query  399  TFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCLSAMVWFMAEFS  578
                    QVD TYT+NIE LV+KVC L++E GE  +  CLRASSL+CLSAMVW M EFS
Sbjct  138  --------QVDSTYTHNIEKLVRKVCMLSQEPGETHENGCLRASSLQCLSAMVWLMTEFS  189

Query  579  HIFADXDEI  605
            HIFAD DE+
Sbjct  190  HIFADFDEV  198



>ref|XP_010932401.1| PREDICTED: uncharacterized protein LOC105053077 isoform X1 [Elaeis 
guineensis]
Length=797

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    KVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  H   V V+   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  67   RIPKITNYLEQRCYKELRIEHFGSVKVVMCIYRKLLISCKEQMPLFASSLLTIICTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IG  TF  F+ SQ DGTY +N+E ++ K+C LA+E GE+++   LRA+ LR 
Sbjct  127  TRQDEMRIIGSHTFFDFVNSQRDGTYMFNLEGIIPKLCYLAQEMGEDERAHNLRAAGLRA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI A+ D +V V
Sbjct  187  LSSMVWFMGEYSHISAEFDNVVSV  210



>ref|XP_008798151.1| PREDICTED: uncharacterized protein LOC103713119 [Phoenix dactylifera]
Length=1043

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 149/204 (73%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CPALR+RSRQPVKRYKKLL +IFP++ D   N RKI KLCEYA++NP 
Sbjct  7    KVLPACGRLCFFCPALRARSRQPVKRYKKLLVEIFPRTQDEEPNDRKIGKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCY+ELR+ H     +I   Y++LL  C+EQM  FA +LL+VV  +LD 
Sbjct  67   RIPKITSYLEQRCYRELRNEHFSFAKIIMCIYHKLLLTCREQMPLFATSLLSVVHTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ SQVDGTY +N+E L+ ++C LA+E GE+++ + LRA++L+ 
Sbjct  127  TRQDEMQIIGCQTLFDFVNSQVDGTYQFNLEGLIPRLCHLAQEVGEDERAQHLRAAALQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM EFSHI A+ D +V +
Sbjct  187  LSSMVWFMGEFSHISAEFDNVVTI  210



>ref|XP_006838291.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
 gb|ERN00860.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
Length=1044

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 147/205 (72%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CP+LR+RSRQPVKRYKKLLADIFPKS D   N RKI KLCEYA+KNP 
Sbjct  7    KVLPACGRLCFFCPSLRARSRQPVKRYKKLLADIFPKSQDEEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKIA  LE+RCYKELR  H     V+   Y +LL  CKEQM   A +LL+V+  +LD 
Sbjct  67   RVPKIADYLEQRCYKELRIEHFGFAKVVMCIYRKLLFSCKEQMPLLASSLLSVIRTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   F+ +Q+DGTY +N+E+ V K+C LA+E GE+D+   LR+  L+ 
Sbjct  127  TRQDDMRVLGCQTLVDFVNNQMDGTYMFNLESFVPKLCQLAQEMGEDDRGCILRSFGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            LS+MVWFM E+SHI A+ DE+V VT
Sbjct  187  LSSMVWFMGEYSHISAEFDEVVSVT  211



>ref|XP_009405043.1| PREDICTED: uncharacterized protein LOC103988214 [Musa acuminata 
subsp. malaccensis]
Length=1022

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CP+LR+RSRQPVKRYKKLLADIFP S D   N RKI KLCEY ++NP 
Sbjct  7    KVLPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPHSQDEEPNDRKIGKLCEYTSRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCY+ELR+ H   V V+   Y +LL  C+EQM  FA +LL+++  + D 
Sbjct  67   RIPKITNYLEQRCYRELRNEHFGYVKVVMRIYWKLLIACREQMPLFASSLLSIIHTLFDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ IGC T   F+ SQVDGTY +N+E L+ ++CSLA+E GE++    LRA+ L+ 
Sbjct  127  SRHDEMQIIGCHTLFDFVNSQVDGTYQFNLEGLIPRLCSLAQEMGEDENACYLRAAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS++VWFM EFSHI A+ D IV
Sbjct  187  LSSLVWFMGEFSHISAEFDSIV  208



>ref|XP_008784321.1| PREDICTED: uncharacterized protein LOC103703292 isoform X3 [Phoenix 
dactylifera]
Length=1028

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    KVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  H   V ++   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  67   RIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTIIRTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LRA+ LR 
Sbjct  127  TRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLRAAGLRA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI  + D +V V
Sbjct  187  LSSMVWFMGEYSHISTEFDNVVSV  210



>ref|XP_008784320.1| PREDICTED: uncharacterized protein LOC103703292 isoform X2 [Phoenix 
dactylifera]
Length=1034

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    KVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  H   V ++   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  67   RIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTIIRTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LRA+ LR 
Sbjct  127  TRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLRAAGLRA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI  + D +V V
Sbjct  187  LSSMVWFMGEYSHISTEFDNVVSV  210



>ref|XP_008784316.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784317.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784318.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
 ref|XP_008784319.1| PREDICTED: protein EFR3 homolog isoform X1 [Phoenix dactylifera]
Length=1058

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP+LR+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    KVLPACGSLCFFCPSLRARSRQPVKRYKKLLSDIFPRSQDEEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  H   V ++   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  67   RIPKITNYLEQRCYKELRIEHFGSVKIVMCIYRKLLISCKEQMPLFASSLLTIIRTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + + ++ IGC TF  F+  Q D TY +N+E ++ K+C LA+E GE+++   LRA+ LR 
Sbjct  127  TRQEEMRIIGCNTFFDFVNGQRDSTYMFNLEGIIPKLCHLAQEMGEDERAHNLRAAGLRA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI  + D +V V
Sbjct  187  LSSMVWFMGEYSHISTEFDNVVSV  210



>dbj|BAK01387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1055

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CP LR+RSRQPVKRYKK+LA+IFP++PD   N R+I KLCEYAAKNP 
Sbjct  7    KVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTPDEEPNERRIGKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELR+       V+   Y  LL  CKEQM  FA +LL++V  +LD 
Sbjct  67   RVPKITVYLEQRIYKELRTEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIVHTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LRA++L+ 
Sbjct  127  KRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDERATSLRAAALQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM E SHI ++ D +V V
Sbjct  187  LSAMIWFMGELSHISSEFDNVVEV  210



>gb|EPS68493.1| hypothetical protein M569_06272 [Genlisea aurea]
Length=1007

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 143/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PACES+C  CP LR+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEYA+KNP 
Sbjct  11   QILPACESLCFFCPGLRTRSRQPVKRYKKLIADIFPRSQDEEPNYRKIEKLCEYASKNPM  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  + + V ++   Y +LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKIESSLEQRCYKELRVENIRSVKIVMSIYKKLLFTCKEQMPLFANSLLSIIYVLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
               D +   GC T   F+ +Q D TY +N+E L+ K+C +A+E G++D+   +RA+ L+ 
Sbjct  131  TNHDEMLISGCQTLFDFVNNQNDSTYMFNLEGLIPKLCQIAQEVGDDDRGENIRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E SHI AD D IV V
Sbjct  191  LSAMVWFMGETSHISADFDNIVSV  214



>ref|XP_010313082.1| PREDICTED: uncharacterized protein LOC101250362 isoform X1 [Solanum 
lycopersicum]
Length=994

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEYA++NP 
Sbjct  7    KVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE+RCYK+LR+ H   V V+   Y +LL  CKEQM  +A +LL ++  + + 
Sbjct  67   RIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGIIRTLFEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR++ ++ 
Sbjct  127  TQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLRSAGMQT  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ +VWFM E SHI  D D I+  T
Sbjct  187  LAVLVWFMGEQSHISIDFDHIITAT  211



>ref|XP_004250744.1| PREDICTED: uncharacterized protein LOC101250362 isoform X2 [Solanum 
lycopersicum]
Length=993

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEYA++NP 
Sbjct  7    KVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE+RCYK+LR+ H   V V+   Y +LL  CKEQM  +A +LL ++  + + 
Sbjct  67   RIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGIIRTLFEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR++ ++ 
Sbjct  127  TQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLRSAGMQT  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ +VWFM E SHI  D D I+  T
Sbjct  187  LAVLVWFMGEQSHISIDFDHIITAT  211



>ref|XP_006352098.1| PREDICTED: uncharacterized protein LOC102584417 isoform X1 [Solanum 
tuberosum]
Length=1000

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEYA++NP 
Sbjct  7    KVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE+RCYK+LR+ H   V V+   Y +LL  CKEQM  +A +LL ++  + + 
Sbjct  67   RIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGIIRTLFEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR++ ++ 
Sbjct  127  TQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLRSAGMQT  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ +VWFM E SHI  D D I+  T
Sbjct  187  LAVLVWFMGEQSHISIDFDHIITAT  211



>ref|XP_006352099.1| PREDICTED: uncharacterized protein LOC102584417 isoform X2 [Solanum 
tuberosum]
Length=999

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP+LR+RSRQPVKRYKKLL +IFPKS D   N RKI KLCEYA++NP 
Sbjct  7    KVVPACGSLCFFCPSLRARSRQPVKRYKKLLGEIFPKSQDAEPNDRKIAKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE+RCYK+LR+ H   V V+   Y +LL  CKEQM  +A +LL ++  + + 
Sbjct  67   RIPKITEYLEQRCYKDLRNEHLGSVKVVTMIYRKLLSSCKEQMPLYAASLLGIIRTLFEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LARE G++D+   LR++ ++ 
Sbjct  127  TQHDEMQILGCNTLVDFINSQMDGTYMFNLEGLIPKLCQLAREVGDDDRALRLRSAGMQT  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ +VWFM E SHI  D D I+  T
Sbjct  187  LAVLVWFMGEQSHISIDFDHIITAT  211



>ref|XP_009401306.1| PREDICTED: uncharacterized protein LOC103985362 [Musa acuminata 
subsp. malaccensis]
Length=1028

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CP+LR RSRQPVKRYKKLLADIFP++ D   N RKI KLCEYA++NP 
Sbjct  7    KVVPACGALCFLCPSLRERSRQPVKRYKKLLADIFPRAQDEEPNDRKIGKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKE+R+     V V+   Y +LL  C+EQM  FA +LL+++  + D 
Sbjct  67   RIPKITTYLEQRCYKEMRNERFGSVKVVMCIYRKLLIACREQMPLFASSLLSIIHTLFDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ SQVDGTY +N+E++V ++CSLA+E GE++    LRA+ L+ 
Sbjct  127  TRHDEMQIIGCYTLFDFVNSQVDGTYQFNLESMVPRLCSLAQEVGEDENAGSLRAAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+++WFM EFSHI ++ D IV
Sbjct  187  LSSLIWFMGEFSHISSEFDSIV  208



>ref|XP_008231409.1| PREDICTED: uncharacterized protein LOC103330592 [Prunus mume]
Length=1053

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 149/204 (73%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEYA+K P 
Sbjct  7    QVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEYASKTPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y +LL  CKEQM  FA ++L++V  +LD 
Sbjct  67   RIPKITTTLEQRCYKDLRTENFHSVKVVMCIYRKLLVSCKEQMPLFASSVLSIVQILLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ +GC T  +F+ +Q DGTY +N++ ++ K+C LA+E  E+  ++ LR++ L+ 
Sbjct  127  SRHDEIRILGCQTLFEFVNNQKDGTYMFNLDGMIPKLCLLAQEMREDGSEKHLRSAGLKT  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM EFSHI +D D +V V
Sbjct  187  LSSMVWFMGEFSHISSDFDNVVSV  210



>ref|XP_007218911.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
 gb|EMJ20110.1| hypothetical protein PRUPE_ppa000649mg [Prunus persica]
Length=1052

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 149/204 (73%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEYA+K P 
Sbjct  7    QVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEYASKTPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y +LL  CKEQM  FA ++L++V  +LD 
Sbjct  67   RIPKITTTLEQRCYKDLRTENFHSVKVVMCIYRKLLVSCKEQMPLFASSVLSIVQILLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ +GC T  +F+ +Q DGTY +N++ ++ K+C LA+E  E+  ++ LR++ L+ 
Sbjct  127  SRHDDIRILGCQTLFEFVNNQKDGTYMFNLDGMIPKLCLLAQEMREDGSEKHLRSAGLKT  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM EFSHI +D D +V V
Sbjct  187  LSSMVWFMGEFSHISSDFDNVVSV  210



>ref|XP_009391228.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391229.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391230.1| PREDICTED: uncharacterized protein LOC103977445 [Musa acuminata 
subsp. malaccensis]
Length=1033

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            + PACES+CI CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEY ++NP R
Sbjct  8    IMPACESLCIFCPSLRTRSRQPVKRYKKLLADIFPRSQDEEPNDRKISKLCEYVSRNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE++ YKELR  H   V V+   Y +LL  CKEQM  FA +LL ++  +LD  
Sbjct  68   IPKITSYLEQKFYKELRLEHFGTVKVVLCIYRKLLVSCKEQMPLFASSLLTIICTLLDQR  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D +  IGC T   F+  Q+DGTY +N+E L+ K+C LA+E GE+++   +RA+ LR L
Sbjct  128  RQDEMCIIGCHTIFDFVICQIDGTYMFNLEGLIPKLCELAQEMGEDERANDMRAAGLRAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+M+WFM E+SHI A+ D +V V
Sbjct  188  SSMIWFMGEYSHISAEFDNVVSV  210



>ref|XP_011078902.1| PREDICTED: uncharacterized protein LOC105162543 [Sesamum indicum]
Length=1009

 Score =   237 bits (604),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPALR RSRQPVKRYKKL++DIFPKS D   N RKI KLCEYAAKNP 
Sbjct  12   QVLPACGSLCFFCPALRERSRQPVKRYKKLISDIFPKSLDEEPNDRKIGKLCEYAAKNPL  71

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIA  LE+RCYKELR+ + + V V+   Y + L  CKEQM  FA +LL ++  +LD 
Sbjct  72   RIPKIANSLEQRCYKELRNENFRAVKVVMCIYRKFLSACKEQMPLFANSLLTIINTLLDQ  131

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
               D +  IGC +   F+ +Q DGTY +N+E L+ K+C LA+E G++++   LRA++L+ 
Sbjct  132  TSQDEMLVIGCHSVFDFVNNQNDGTYMFNLEGLIPKLCQLAQEPGDDERAENLRAAALQA  191

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E SHI  + D IV V
Sbjct  192  LSAMVWFMGENSHISVEFDNIVSV  215



>ref|XP_006858684.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
 gb|ERN20151.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
Length=1020

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+C  CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEYAAKNP 
Sbjct  7    RVLPVCGSLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNDRKICKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LE+RCY+ELR+ H   V V+   Y +LL   KEQM  FA +LL+++  +L+ 
Sbjct  67   RIPKITKYLEQRCYRELRNEHFGSVKVVLCIYRKLLASSKEQMPLFASSLLSIIRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D +  +GC T   FI SQVDGTY +N+E L+ K+C L++E GE+++   LR++ L+ 
Sbjct  127  TQQDEMLILGCNTLVDFINSQVDGTYMFNLEGLIPKLCQLSQEVGEDERAHNLRSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            ++ MVWFM E SHI  D D+IV V
Sbjct  187  IAFMVWFMGECSHISVDFDDIVSV  210



>ref|XP_010241226.1| PREDICTED: uncharacterized protein LOC104585894 isoform X1 [Nelumbo 
nucifera]
Length=1005

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ P C S+C  CPALR+RSRQPVKRYKKL+A+IFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    KVLPVCGSLCFFCPALRARSRQPVKRYKKLIAEIFPRSQDEEPNDRKISKLCEYASKNPM  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+    L  V+   Y +LL  CK+QM  FA +LL+++  +LD 
Sbjct  67   RIPKITSTLEQRCYKELRNEQFWLAKVVMCIYRKLLISCKDQMPLFASSLLSIINILLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q DGTY +N+E ++ K+C L++E G++++   LR++ L+ 
Sbjct  127  TRQDEIRIIGCQTLFDFVNNQTDGTYMFNLEGMIPKLCMLSQEVGQDERAEQLRSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI A+ D +V V
Sbjct  187  LSSMVWFMGEYSHISAEFDNVVSV  210



>ref|XP_011457274.1| PREDICTED: uncharacterized protein LOC101313176 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=984

 Score =   236 bits (602),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 146/205 (71%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP+LR+RSRQPVKRYKKLL+DIFP+  D   N RKI KLCEYA+KNP 
Sbjct  7    RVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE++CYK+LR+ H   V VI   Y +LL  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITELLEQKCYKDLRNEHFGSVKVILRIYRKLLSSCKEQMPLFASSLLEIIRILLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+DGT+ +N+E L+ K+C LA+E G++++   LR++ L+ 
Sbjct  127  TRHDEMQILGCNTLVDFINSQIDGTHMFNLEGLIPKLCELAQEMGDDERALHLRSAGLQS  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MVWFM E SHI  D D I+ VT
Sbjct  187  LAFMVWFMGEHSHISMDFDTIISVT  211



>ref|XP_009393518.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393521.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
Length=1021

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP+LR+RSRQPVKRYKKLL D+FP+SPDG  N R I KLCEYA+KNP 
Sbjct  7    RVLPACGNLCCFCPSLRARSRQPVKRYKKLLTDVFPRSPDGQPNDRMIGKLCEYASKNPM  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+G      V+   Y +LL  CKEQM  +A +LL++V  +LD 
Sbjct  67   RIPKITNYLEQRCYKELRNGQFNSAKVVPCIYRKLLASCKEQMPLYATSLLSIVRTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GCLT   F+ +QVD TY +N+E  + K+C L +E GE+D+   LR++ L+ 
Sbjct  127  TQQDDMRILGCLTLVDFLNNQVDSTYMFNVEGFIPKLCQLGQEIGEDDRGLRLRSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L++MV FM E+SHI  + D+IV V
Sbjct  187  LASMVLFMGEYSHISMNFDDIVSV  210



>ref|XP_002264735.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650556.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650557.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 emb|CBI36655.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 145/205 (71%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP+LR+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEYA+KN  
Sbjct  7    RVVPACGNLCFFCPSLRARSRQPVKRYKKLLADIFPRSQDAEPNERKIGKLCEYASKNAL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+GH     V+   Y +LL  CKEQM  +A +LL +V  +L+ 
Sbjct  67   RIPKITDYLEQRCYKDLRNGHFGSAKVVLCIYRKLLSSCKEQMPFYASSLLGMVRILLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+DGTY +N+E L+ K+C LA+E GE+++   LR++ L+ 
Sbjct  127  TRHDEMRILGCSTLVDFINSQMDGTYMFNLEGLIPKLCQLAQEPGEDERALSLRSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MVWFM E SHI  D D I+ VT
Sbjct  187  LAFMVWFMGEHSHISMDFDNIISVT  211



>ref|XP_009355500.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
 ref|XP_009355501.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
Length=1036

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 147/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY AKNP 
Sbjct  11   QVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYVAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   YN+LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q DGTYT+N+E  + K+C +A+E GE+++   LR+++L+ 
Sbjct  131  TRQDEMQIIGCQTLFNFVNNQTDGTYTFNLEGFIPKLCQIAQEPGEDERASNLRSAALQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E SHI  + D IV V
Sbjct  191  LSSMVWFMGENSHISVEFDNIVAV  214



>ref|XP_002968494.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
 gb|EFJ30748.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
Length=875

 Score =   234 bits (597),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C  +C+CCP LR+RSRQPVKRYKKLL+D+FPKS     N RKI KL +YA KNPF
Sbjct  7    RVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDYAVKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE R YKELR  H   V VI   + +L   CK+QM   AV+ LN++  +L+ 
Sbjct  67   RIPKIAKNLELRGYKELRHEHYGSVRVIMRTFFKLFSTCKDQMPLLAVSALNMIHVLLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC+T  +FIY QVD TY +N+++ + K C+LARETG E ++  LRA+ L+ 
Sbjct  126  QQNDEMRVLGCVTVVEFIYQQVDTTYMHNLDSFIPKFCALARETGPEPKRSILRAAGLQA  185

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+WFM EFSH+ +D DEIV
Sbjct  186  LSAMLWFMGEFSHMPSDFDEIV  207



>ref|XP_002975992.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
 gb|EFJ22897.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
Length=950

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C  +C+CCP LR+RSRQPVKRYKKLL+D+FPKS     N RKI KL +YA KNPF
Sbjct  7    RVLPLCGHLCVCCPGLRARSRQPVKRYKKLLSDLFPKSQAEQPNDRKISKLTDYAVKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LE R YKELR  H   V VI   + +L   CK+QM   AV+ LN++  +L+ 
Sbjct  67   RIPKIAKNLELRGYKELRHEHHGSVRVIMRTFFKLFSTCKDQMPLLAVSALNMIHVLLE-  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC+T  +FIY QVD TY +N+++ + K C+LARETG E ++  LRA+ L+ 
Sbjct  126  QQNDEMRVLGCVTVVEFIYQQVDTTYMHNLDSFIPKFCALARETGPEPKRSILRAAGLQA  185

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+WFM EFSH+ +D DEIV
Sbjct  186  LSAMLWFMGEFSHMPSDFDEIV  207



>ref|XP_008443197.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443199.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443200.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
 ref|XP_008443201.1| PREDICTED: uncharacterized protein LOC103486854 isoform X1 [Cucumis 
melo]
Length=1003

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYA KNP 
Sbjct  14   QVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYAGKNPL  73

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + + V V+   Y +LL  CKEQM  FA +L++++  ++D 
Sbjct  74   RIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQTLMDQ  133

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++    LR++ L+ 
Sbjct  134  TRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDEGAENLRSAGLQG  193

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI  + D IV V
Sbjct  194  LSSMVWFMGEYSHISTEFDNIVSV  217



>ref|XP_010523668.1| PREDICTED: protein EFR3 homolog isoform X2 [Tarenaya hassleriana]
Length=1019

 Score =   234 bits (598),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 142/203 (70%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYKKLL+DIFP+SPD   N RKI KLCEYAAKN  R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEYAAKNSLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI + LE+RCY++LR      V ++   Y +LL  CKEQM+ FA + L ++  +LD  
Sbjct  68   IPKITRSLEQRCYRDLRMEQFHSVKIVMCIYKKLLVSCKEQMSLFASSYLGLIHILLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ +Q DGT+ +N++ L+  +C LA E GEE++ R LR++ L+ L
Sbjct  128  RHDEIRILGCEALYDFVNNQTDGTHMFNLDGLIPNICPLAHEMGEEERPRNLRSAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+MVWFM EFSHI  + D +V V
Sbjct  188  SSMVWFMGEFSHISVEFDNVVSV  210



>ref|XP_010523667.1| PREDICTED: protein EFR3 homolog isoform X1 [Tarenaya hassleriana]
Length=1028

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 142/203 (70%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYKKLL+DIFP+SPD   N RKI KLCEYAAKN  R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKKLLSDIFPRSPDEQPNDRKISKLCEYAAKNSLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI + LE+RCY++LR      V ++   Y +LL  CKEQM+ FA + L ++  +LD  
Sbjct  68   IPKITRSLEQRCYRDLRMEQFHSVKIVMCIYKKLLVSCKEQMSLFASSYLGLIHILLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ +Q DGT+ +N++ L+  +C LA E GEE++ R LR++ L+ L
Sbjct  128  RHDEIRILGCEALYDFVNNQTDGTHMFNLDGLIPNICPLAHEMGEEERPRNLRSAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+MVWFM EFSHI  + D +V V
Sbjct  188  SSMVWFMGEFSHISVEFDNVVSV  210



>ref|XP_007203221.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
 gb|EMJ04420.1| hypothetical protein PRUPE_ppa000725mg [Prunus persica]
Length=1021

 Score =   234 bits (597),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC  +C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYAAKNP 
Sbjct  11   QVLPACGGLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   YN+LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITNFLEQRCYKELRNENFRSTKIVMCIYNKLLISCKEQMRLFASSLLSIMHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q DGTY +N+E  + K+C +A+E GE+++   LR+++L+ 
Sbjct  131  TRQDEMQIIGCQTLFNFVNNQKDGTYMFNLEGFIPKLCQIAQEPGEDERANNLRSAALQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E SHI  + D IV V
Sbjct  191  LSSMVWFMGEHSHISVEFDNIVAV  214



>ref|XP_010257179.1| PREDICTED: uncharacterized protein LOC104597386 isoform X1 [Nelumbo 
nucifera]
Length=1026

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ P C+ +C  CP++R+RSRQPVKRYKKL+ADIFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    KVLPICDGLCFLCPSMRTRSRQPVKRYKKLIADIFPRSQDEEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIA  LE+RCYKELR+   +L  V+   Y +LL  CK+QM  FA +LL+++  +LD 
Sbjct  67   RIPKIANSLEQRCYKELRNEQFRLAKVVMCIYRKLLISCKDQMPLFASSLLSIINTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             +   ++ IGC T   F+ SQ+DGTY +N+E L+ K+C  A+E G+++    LRA+ L+ 
Sbjct  127  TRQYEMRVIGCQTLFDFVNSQMDGTYMFNLEGLIPKICQTAQEIGDDEGTCQLRAAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI ++ D +V V
Sbjct  187  LSSMVWFMGEYSHISSEFDIVVSV  210



>ref|XP_004309822.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457272.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457273.1| PREDICTED: uncharacterized protein LOC101313176 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   234 bits (596),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 106/205 (52%), Positives = 146/205 (71%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP+LR+RSRQPVKRYKKLL+DIFP+  D   N RKI KLCEYA+KNP 
Sbjct  7    RVVPACGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRHQDAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE++CYK+LR+ H   V VI   Y +LL  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITELLEQKCYKDLRNEHFGSVKVILRIYRKLLSSCKEQMPLFASSLLEIIRILLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+DGT+ +N+E L+ K+C LA+E G++++   LR++ L+ 
Sbjct  127  TRHDEMQILGCNTLVDFINSQIDGTHMFNLEGLIPKLCELAQEMGDDERALHLRSAGLQS  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MVWFM E SHI  D D I+ VT
Sbjct  187  LAFMVWFMGEHSHISMDFDTIISVT  211



>ref|XP_010653791.1| PREDICTED: uncharacterized protein LOC100255472 isoform X2 [Vitis 
vinifera]
Length=993

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CPA+R RSRQP+KRYKKL++DIFP++ D   N RKI KLCEYAAKNP 
Sbjct  11   KVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELRS + +   V+   Y + L  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITNSLEQRCYKELRSENFRSAKVVMCIYRKFLVSCKEQMPLFASSLLSIIHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            A+ D ++ IGC T   F+ +Q DGTY  N+E  + K+C LA+E GE+++ + LR++ L  
Sbjct  131  ARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGFIPKLCQLAQEVGEDERAQHLRSAGLHA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E SHI A+ D +V V
Sbjct  191  LSSMVWFMGEHSHISAEIDNVVSV  214



>ref|XP_002277870.1| PREDICTED: uncharacterized protein LOC100255472 isoform X1 [Vitis 
vinifera]
Length=1017

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CPA+R RSRQP+KRYKKL++DIFP++ D   N RKI KLCEYAAKNP 
Sbjct  11   KVLPACGNLCFLCPAMRPRSRQPLKRYKKLISDIFPRAQDEEPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELRS + +   V+   Y + L  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITNSLEQRCYKELRSENFRSAKVVMCIYRKFLVSCKEQMPLFASSLLSIIHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            A+ D ++ IGC T   F+ +Q DGTY  N+E  + K+C LA+E GE+++ + LR++ L  
Sbjct  131  ARQDEMQIIGCQTLFDFVNNQRDGTYMCNLEGFIPKLCQLAQEVGEDERAQHLRSAGLHA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E SHI A+ D +V V
Sbjct  191  LSSMVWFMGEHSHISAEIDNVVSV  214



>ref|XP_009625862.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625864.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625865.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625866.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
Length=993

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 143/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEYA+KNPF
Sbjct  7    KVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEYASKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE+RCYK+LR+ H   V V+   Y +LL  CKE M  +A +LL ++  + + 
Sbjct  67   RIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGIIRTLFEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++ +   LR++ ++ 
Sbjct  127  TQHDEMQILGCNTLVDFINCQMDGTYMFNLEGLIPKMCQLAREIGDDGRALRLRSAGMQT  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ +VWFM E SHI  D D I+  T
Sbjct  187  LAVLVWFMGEQSHISMDVDHIITAT  211



>ref|XP_009625867.1| PREDICTED: protein EFR3 homolog isoform X2 [Nicotiana tomentosiformis]
Length=924

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 143/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEYA+KNPF
Sbjct  7    KVVPACGNLCFFCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEYASKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE+RCYK+LR+ H   V V+   Y +LL  CKE M  +A +LL ++  + + 
Sbjct  67   RIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGIIRTLFEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++ +   LR++ ++ 
Sbjct  127  TQHDEMQILGCNTLVDFINCQMDGTYMFNLEGLIPKMCQLAREIGDDGRALRLRSAGMQT  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ +VWFM E SHI  D D I+  T
Sbjct  187  LAVLVWFMGEQSHISMDVDHIITAT  211



>ref|XP_004304390.1| PREDICTED: uncharacterized protein LOC101298629 [Fragaria vesca 
subsp. vesca]
Length=1028

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CP LR+RSRQPVKRYKKL+ADIFPK+ +   N RKI KLCEYA+KNP 
Sbjct  11   QVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKNQEEGPNDRKIGKLCEYASKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y +LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITTSLEQRCYKELRNENFRSTKIVMCIYKKLLITCKEQMPLFASSLLSIMHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +QVDGTY +N+E  + K+C +A+E GE+++   LR+++L+ 
Sbjct  131  TRQDEMQIIGCQTLFDFVNNQVDGTYMFNLEGFIPKLCQIAQEPGEDERANNLRSAALQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM + SHI  + D IV V
Sbjct  191  LSSMVWFMGQNSHISVEFDNIVAV  214



>ref|XP_011075240.1| PREDICTED: uncharacterized protein LOC105159750 isoform X2 [Sesamum 
indicum]
Length=1011

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPALRSRSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNP 
Sbjct  11   QVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPM  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIA  LE+RCYKELR+ + + V ++   Y ++L  CKEQM  FA +++ ++  +LD 
Sbjct  71   RIPKIATSLEQRCYKELRNENFRSVKIVMCIYRKMLSSCKEQMPLFANSVMTIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            A  D +  IGC +   F+ +Q D TY +N+E  + K+C LA+E GE+++   LRA+ L+ 
Sbjct  131  ANQDEMLIIGCESLFDFVNNQNDATYMFNLEGFITKLCQLAQEVGEDERAEHLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E SHI  + D IV V
Sbjct  191  LSAMVWFMGENSHISVEFDNIVSV  214



>ref|XP_011075238.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
 ref|XP_011075239.1| PREDICTED: uncharacterized protein LOC105159750 isoform X1 [Sesamum 
indicum]
Length=1012

 Score =   233 bits (593),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPALRSRSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNP 
Sbjct  11   QVLPACGSLCFFCPALRSRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPM  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIA  LE+RCYKELR+ + + V ++   Y ++L  CKEQM  FA +++ ++  +LD 
Sbjct  71   RIPKIATSLEQRCYKELRNENFRSVKIVMCIYRKMLSSCKEQMPLFANSVMTIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            A  D +  IGC +   F+ +Q D TY +N+E  + K+C LA+E GE+++   LRA+ L+ 
Sbjct  131  ANQDEMLIIGCESLFDFVNNQNDATYMFNLEGFITKLCQLAQEVGEDERAEHLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E SHI  + D IV V
Sbjct  191  LSAMVWFMGENSHISVEFDNIVSV  214



>ref|XP_003605757.1| EFR3-like protein [Medicago truncatula]
 gb|AES87954.1| cyclin-like protein [Medicago truncatula]
Length=1028

 Score =   232 bits (592),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 102/203 (50%), Positives = 146/203 (72%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            ++P C S+C  CPALR RSR P+KRYKKLLADIFP++P+   N RKI KLCEYA+KNP R
Sbjct  8    IWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPEEEPNDRKISKLCEYASKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            +PKI   LE+RCYKELR+ + + V V+   Y +LL  C++QM  FA +LL+++  +LD +
Sbjct  68   VPKITSYLEQRCYKELRTENYQAVKVVICIYRKLLVSCRDQMPLFASSLLSIIQILLDQS  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D V+ +GC T   F+ +Q DGTY +N+++ + K+C LA++ G++ +   LRAS L+ L
Sbjct  128  RQDEVQILGCQTLFDFVNNQRDGTYMFNLDSFILKLCHLAQQVGDDGKVEHLRASGLQVL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+MVWFM EF+HI  + D +V V
Sbjct  188  SSMVWFMGEFTHISVEFDNVVSV  210



>ref|XP_004308677.1| PREDICTED: uncharacterized protein LOC101307642 [Fragaria vesca 
subsp. vesca]
Length=1047

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++FP CES+C  CPALR+RSR PVKRYKKLLA+IFP+SPD   N RKI KLCEYA+K P 
Sbjct  7    QVFPVCESLCFFCPALRARSRHPVKRYKKLLAEIFPRSPDEEPNDRKISKLCEYASKTPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y +LL  CK+QM  FA +LL +V  +LD 
Sbjct  67   RIPKITTTLEQRCYKDLRTENFHSVKVVMCVYRKLLISCKDQMPLFASSLLTIVQILLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ +GC T  +F+ +Q DGTY +N+++++ K+C +A+E  E+     +RA+ L+ 
Sbjct  127  SRHDEMRILGCQTLFEFVNNQKDGTYMFNLDSMIPKLCQIAQEMREDGTAMKVRAAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM EFSHI  + D +V V
Sbjct  187  LSSMVWFMGEFSHISTEFDNVVSV  210



>ref|XP_002517810.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44617.1| conserved hypothetical protein [Ricinus communis]
Length=1025

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 144/206 (70%), Gaps = 2/206 (1%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSA--NGRKIMKLCEYAAKN  176
            ++ PAC+S+C  CPALR+RSRQP+KRYKKLLADIFP++P G    N RKI KLCEYAAKN
Sbjct  7    QVMPACDSLCFFCPALRTRSRQPIKRYKKLLADIFPRAPVGEEQLNDRKIGKLCEYAAKN  66

Query  177  PFRIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEML  356
            P RIPKI   LE+RCYK+LRS   + V ++   Y +LL  CKEQM  FA +LL+++  +L
Sbjct  67   PLRIPKITSSLEQRCYKDLRSEQFQSVKIVMCIYRKLLISCKEQMPLFASSLLSIIHILL  126

Query  357  DCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSL  536
            D  + D ++ +GC     F+ +Q DGTY +N++ L+ K+C + +  GEE +   LR + L
Sbjct  127  DQTRHDDIRILGCQVLFDFVNNQRDGTYVFNLDGLIPKLCIIVQVIGEEGRVEQLRTAGL  186

Query  537  RCLSAMVWFMAEFSHIFADXDEIVHV  614
            + LS+MVWFM EFSHI  D D +V V
Sbjct  187  QALSSMVWFMGEFSHISTDFDTVVSV  212



>ref|XP_003540587.1| PREDICTED: uncharacterized protein LOC100816475 [Glycine max]
Length=1037

 Score =   232 bits (592),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 103/203 (51%), Positives = 146/203 (72%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            ++P C S+C  CPALR RSR P+KRYKKLLADIFP++PD   N R I KLCEYA+KNP R
Sbjct  8    IWPVCGSLCCFCPALRERSRHPIKRYKKLLADIFPRTPDEEPNERMISKLCEYASKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            +PKI   LE+RCY+ELR+ + + V V+   Y +LL  CK+QM  FA +LL+++  +LD  
Sbjct  68   VPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSIIQILLDQP  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LRA+ L+ L
Sbjct  128  RQDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQLLRAAGLQVL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+MVWFM EF+HI A+ D +V V
Sbjct  188  SSMVWFMGEFTHISAEFDNVVSV  210



>gb|KCW90195.1| hypothetical protein EUGRSUZ_A02368 [Eucalyptus grandis]
Length=1010

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYAAKNP 
Sbjct  11   QVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y +LL  CK+QM  FA +LL+++  +LD 
Sbjct  71   RIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIISTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA+ L+ 
Sbjct  131  TRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM E+SH   + D +V V
Sbjct  191  LSSMIWFMGEYSHFSGEFDNVVSV  214



>ref|XP_004166917.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224192, 
partial [Cucumis sativus]
Length=986

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYAAKNP 
Sbjct  11   QVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + + V V+   Y +LL  CKEQM  FA +L++++  ++D 
Sbjct  71   RIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQTLMDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++    L ++ L+ 
Sbjct  131  TRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDEGAENLCSAGLQG  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI  + D IV V
Sbjct  191  LSSMVWFMGEYSHISTEFDNIVSV  214



>gb|KGN59399.1| hypothetical protein Csa_3G816120 [Cucumis sativus]
Length=870

 Score =   231 bits (588),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYAAKNP 
Sbjct  14   QVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYAAKNPL  73

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + + V V+   Y +LL  CKEQM  FA +L++++  ++D 
Sbjct  74   RIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQTLMDQ  133

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++    L ++ L+ 
Sbjct  134  TRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDEGAENLCSAGLQG  193

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI  + D IV V
Sbjct  194  LSSMVWFMGEYSHISTEFDNIVSV  217



>ref|XP_002322714.1| cyclin-related family protein [Populus trichocarpa]
 gb|EEF04475.1| cyclin-related family protein [Populus trichocarpa]
Length=1020

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 143/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYAAKNP 
Sbjct  11   QVMPACGSLCFFCPAMRARSRQPVKRYKKLMADIFPRNQEEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  + +   ++   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  71   RIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEQMTLFASSLLGIINTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA+ L+ 
Sbjct  131  TRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM + SHI  + D +V V
Sbjct  191  LSSMVWFMGQHSHISVEFDNVVSV  214



>ref|XP_010057214.1| PREDICTED: uncharacterized protein LOC104445096 isoform X1 [Eucalyptus 
grandis]
Length=1045

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYAAKNP 
Sbjct  11   QVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y +LL  CK+QM  FA +LL+++  +LD 
Sbjct  71   RIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIISTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA+ L+ 
Sbjct  131  TRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM E+SH   + D +V V
Sbjct  191  LSSMIWFMGEYSHFSGEFDNVVSV  214



>ref|XP_010057221.1| PREDICTED: uncharacterized protein LOC104445096 isoform X2 [Eucalyptus 
grandis]
Length=1036

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+C  CPA+R+RSRQPVKRYKKL++DIFPK+ D   N RKI KLCEYAAKNP 
Sbjct  11   QVLPVCGSLCFFCPAMRARSRQPVKRYKKLISDIFPKNQDEEPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y +LL  CK+QM  FA +LL+++  +LD 
Sbjct  71   RIPKITSTLEQRCYKELRTENFRSAKIVMCIYRKLLVSCKDQMPLFASSLLSIISTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     F+ +Q DGTY +N+E  + K+C LA+E G++++ + LRA+ L+ 
Sbjct  131  TRQDEMQLIGCQNLFDFVNNQGDGTYMFNLEGFIPKLCQLAQELGQDERAQHLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM E+SH   + D +V V
Sbjct  191  LSSMIWFMGEYSHFSGEFDNVVSV  214



>ref|XP_009379627.1| PREDICTED: uncharacterized protein LOC103968023 isoform X1 [Pyrus 
x bretschneideri]
Length=1040

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY AKNP 
Sbjct  11   QVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYVAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   YN+LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q+DGTY +N+E  + K C +A+E GE++    LR+++L+ 
Sbjct  131  TRQDEMQIIGCQTLFNFVNNQMDGTYMFNLEGFIPKFCQIAQEPGEDEGASNLRSAALQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L++MVWFM E SHI  + D IV V
Sbjct  191  LASMVWFMGENSHISVEFDNIVAV  214



>ref|XP_004136762.1| PREDICTED: uncharacterized protein LOC101210251 [Cucumis sativus]
Length=1002

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+C  CPALR+RSRQPVKRYKKL+ADIFP++P+   N RKI KLCEYAAKNP 
Sbjct  11   QVLPVCGSLCFFCPALRARSRQPVKRYKKLIADIFPRNPEEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + + V V+   Y +LL  CKEQM  FA +L++++  ++D 
Sbjct  71   RIPKITTSLEQRCYKELRNENFQAVKVVMSIYRKLLVSCKEQMPLFASSLISIMQTLMDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             +   ++ IGC T   F+ SQ DGTY +N+E  + K+C +A+++G+++    L ++ L+ 
Sbjct  131  TRQKEMQIIGCQTLFSFVNSQSDGTYMFNLEAFIPKLCQIAQDSGDDEGAENLCSAGLQG  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM E+SHI  + D IV V
Sbjct  191  LSSMVWFMGEYSHISTEFDNIVSV  214



>ref|XP_009379628.1| PREDICTED: uncharacterized protein LOC103968023 isoform X2 [Pyrus 
x bretschneideri]
Length=1036

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEY AKNP 
Sbjct  11   QVLPACGSLCFFCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYVAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   YN+LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITTYLEQRCYKELRNENFRSAKIVMCIYNKLLISCKEQMPLFASSLLSIMHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q+DGTY +N+E  + K C +A+E GE++    LR+++L+ 
Sbjct  131  TRQDEMQIIGCQTLFNFVNNQMDGTYMFNLEGFIPKFCQIAQEPGEDEGASNLRSAALQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L++MVWFM E SHI  + D IV V
Sbjct  191  LASMVWFMGENSHISVEFDNIVAV  214



>ref|XP_009789125.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana sylvestris]
Length=973

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + LR   L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENAKHLRTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|NP_197607.5| uncharacterized protein [Arabidopsis thaliana]
 gb|AED92929.1| uncharacterized protein AT5G21080 [Arabidopsis thaliana]
Length=1025

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 136/203 (67%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEYAAKNP R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCYKELR      V ++   Y +LL  C EQM  FA + L ++  +LD  
Sbjct  68   IPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMLLFASSYLGLIHILLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEED    L A+ L+ L
Sbjct  128  RYDEMRILGCEALYDFVTSQAEGTYMFNLDGLIPKICPLAHELGEEDSTTNLCAAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S++VWFM EFSHI  + D +V V
Sbjct  188  SSLVWFMGEFSHISVEFDNVVSV  210



>ref|XP_006657548.1| PREDICTED: uncharacterized protein LOC102712271 [Oryza brachyantha]
Length=1071

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 142/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CPALR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY ++NP 
Sbjct  7    KVLPACGSLCYFCPALRARSRQPVKRYKTILAEIFPKTQDEEPNERRIGKLCEYCSRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELR+       V+   Y  LL  CKEQM  FA +LL++V  +LD 
Sbjct  67   RVPKITVFLEQRIYKELRTEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIVHTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LRA++L+ 
Sbjct  127  KRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEVGEDEKTITLRAAALQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            +SAM+WFM E SHI ++ D +V V
Sbjct  187  ISAMIWFMGELSHISSEFDNVVQV  210



>ref|XP_009789120.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
 ref|XP_009789121.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana sylvestris]
Length=1012

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + LR   L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENAKHLRTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_009789124.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana sylvestris]
Length=1008

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + LR   L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENAKHLRTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_009789122.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana sylvestris]
Length=1010

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + LR   L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEENAKHLRTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_010241506.1| PREDICTED: uncharacterized protein LOC104586087 isoform X1 [Nelumbo 
nucifera]
Length=998

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    RVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LE+RCYK+LR+ H   V V+   Y +LL  CK+QM  FA ++L +V  +L+ 
Sbjct  67   RIPKITKYLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKDQMPLFASSILCIVRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ +GC T   FI SQ D TY +N+E L+ K+C LA+E G+ ++   +RA+ L+ 
Sbjct  127  SRQDEMRILGCQTLVDFINSQTDSTYMFNLEGLIPKLCELAQEFGDSERTLSVRAAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L+ MVWFM E+SHI  D D I+ V
Sbjct  187  LAFMVWFMGEYSHISMDFDNIISV  210



>ref|XP_010241507.1| PREDICTED: uncharacterized protein LOC104586087 isoform X2 [Nelumbo 
nucifera]
Length=997

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKKLL+DIFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    RVVPVCGNLCFFCPSMRARSRQPVKRYKKLLSDIFPRSQDAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LE+RCYK+LR+ H   V V+   Y +LL  CK+QM  FA ++L +V  +L+ 
Sbjct  67   RIPKITKYLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKDQMPLFASSILCIVRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ +GC T   FI SQ D TY +N+E L+ K+C LA+E G+ ++   +RA+ L+ 
Sbjct  127  SRQDEMRILGCQTLVDFINSQTDSTYMFNLEGLIPKLCELAQEFGDSERTLSVRAAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L+ MVWFM E+SHI  D D I+ V
Sbjct  187  LAFMVWFMGEYSHISMDFDNIISV  210



>ref|XP_002874031.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50290.1| hypothetical protein ARALYDRAFT_489019 [Arabidopsis lyrata subsp. 
lyrata]
Length=1027

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 138/203 (68%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEYAAKNP R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCYKELR      V ++   Y +LL  C EQM+ FA + L ++  +LD  
Sbjct  68   IPKITTYLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLIHILLDQN  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA E GEED+   L A+ L+ L
Sbjct  128  RYDEMRILGCEALYDFVTNQAEGTYMFNLDGLIPKICPLAHELGEEDRTTNLCAAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+MVWFM EFSHI  + D +V V
Sbjct  188  SSMVWFMGEFSHISVEFDNVVSV  210



>ref|XP_011048039.1| PREDICTED: uncharacterized protein LOC105142218 [Populus euphratica]
Length=1022

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 143/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYAAKNP 
Sbjct  11   QVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  + +   ++   Y +LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITSSLEQRCYKELRIENFQSAKIVMCIYRKLLITCKEQMPLFASSLLSIISTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q DGT+ +N+E  + K+C   +E G+++ ++ LRA+ L+ 
Sbjct  131  TRQDDIQVIGCETLFDFVNNQNDGTFMFNLEGFIPKLCQFTQEEGKDESEKSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM + SHI  + D IV V
Sbjct  191  LSSMIWFMGQHSHISVEFDNIVSV  214



>ref|XP_006286974.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
 gb|EOA19872.1| hypothetical protein CARUB_v10000121mg [Capsella rubella]
Length=1026

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 138/203 (68%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEYAAKNP R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKISKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCYKELR      V ++   Y +LL  C EQM+ FA + L ++  +LD  
Sbjct  68   IPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLIHILLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   L A+ L+ L
Sbjct  128  RYDEMRILGCEALYDFVTSQAEGTYMFNLDGLIPKICPLAHELGEEERTTNLCAAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S++VWFM EFSHI  + D +V V
Sbjct  188  SSLVWFMGEFSHISVEFDNVVSV  210



>ref|XP_006587694.1| PREDICTED: uncharacterized protein LOC100808352 [Glycine max]
Length=1036

 Score =   229 bits (584),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 102/203 (50%), Positives = 145/203 (71%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            ++P C S+C  CPALR RSR P+KRYKK LADIFP++PD   N R I KLCEYA+KNP R
Sbjct  8    IWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEYASKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            +PKI   LE+RCY+ELR+ + + V V+   Y +LL  CK+QM  FA +LL+++  +LD  
Sbjct  68   VPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSIIQILLDQP  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LRA+ L+ L
Sbjct  128  RHDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQHLRAAGLQVL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+MVWFM EF+HI A+ D +V V
Sbjct  188  SSMVWFMGEFTHISAEFDNVVSV  210



>gb|EMS53000.1| Protein EFR3-like protein B [Triticum urartu]
Length=1041

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 140/204 (69%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CP LR+RSRQPVKRYKK+LA+IFP++ D   N R+I KLCEYAAKNP 
Sbjct  7    KVLPACGALCYFCPGLRARSRQPVKRYKKILAEIFPRTQDEEPNERRIGKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELR+       V+   Y  LL  CKEQM   A +LL++V  +LD 
Sbjct  67   RVPKITVYLEQRIYKELRAEQYGFAKVVMLIYRRLLVSCKEQMPLLASSLLSIVHTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ I C T   F  +QVDGTY +N+E LV ++C LA+E GE+++   LRA+ L+ 
Sbjct  127  KRQDDMRIIACETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDERATSLRAAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM E SHI ++ D +V V
Sbjct  187  LSAMIWFMGELSHISSEFDNVVEV  210



>ref|XP_010555004.1| PREDICTED: uncharacterized protein LOC104824606 [Tarenaya hassleriana]
Length=1042

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 145/216 (67%), Gaps = 12/216 (6%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPD------------GSANGRKI  146
            ++ P C S+C+ CPALR+RSRQPVKRYKKL+ADIFP++ +            G+    KI
Sbjct  11   QVLPVCGSLCVFCPALRARSRQPVKRYKKLIADIFPRNQEQLGVSLPMRKSFGNGAKWKI  70

Query  147  MKLCEYAAKNPFRIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAV  326
             KLC+YAAKNP R+PKI+  LE+RCYKELR+ + +   ++   Y +LL  CKEQM  FA 
Sbjct  71   GKLCDYAAKNPLRMPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMTLFAS  130

Query  327  NLLNVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEED  506
             LL  V  +LD  + D ++ IGC T   F+ +Q DG+Y  N+E  + K+C LARE G++D
Sbjct  131  GLLRAVQALLDQTRQDEMQIIGCQTLFDFVNNQKDGSYINNLEGFIPKLCQLAREVGDDD  190

Query  507  QKRCLRASSLRCLSAMVWFMAEFSHIFADXDEIVHV  614
            + R LRA+ L+ LS+MVW M E+SHIF+D D +V V
Sbjct  191  RSRNLRAAGLQALSSMVWLMGEYSHIFSDFDNVVAV  226



>ref|XP_010420957.1| PREDICTED: uncharacterized protein LOC104706460 [Camelina sativa]
Length=1024

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 138/203 (68%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEYAAKNP R
Sbjct  8    MFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCYKELR      V ++   Y +LL  C EQM+ FA + L ++  +LD  
Sbjct  68   IPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLIHILLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   + A+ L+ L
Sbjct  128  RYDEMRMLGCEALYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTTNMCAAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S++VWFM EFSHI  + D +V V
Sbjct  188  SSLVWFMGEFSHISVEFDNVVSV  210



>ref|XP_010493228.1| PREDICTED: uncharacterized protein LOC104770495 [Camelina sativa]
Length=1024

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 138/203 (68%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEYAAKNP R
Sbjct  8    MFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSQDEQPNDRKIGKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCYKELR      V ++   Y +LL  C EQM+ FA + L ++  +LD  
Sbjct  68   IPKITTSLEQRCYKELRMEQFHSVKIVMSIYKKLLVSCNEQMSLFASSYLGLIHILLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   + A+ L+ L
Sbjct  128  RYDEMRMLGCEALYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTTNMCAAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S++VWFM EFSHI  + D +V V
Sbjct  188  SSLVWFMGEFSHISVEFDNVVSV  210



>ref|XP_002529611.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32756.1| conserved hypothetical protein [Ricinus communis]
Length=985

 Score =   228 bits (582),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQP+KRYKKL+A+IFP++PD   N R I +LCEYAAKNP 
Sbjct  11   QVLPACGSLCFFCPAMRARSRQPIKRYKKLIANIFPRNPDDGPNDRMIGRLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y +LL  C+EQM  FA +LL+++  +LD 
Sbjct  71   RIPKITNSLEQRCYKELRNENFQSAKIVMCIYRKLLISCREQMPLFASSLLSIMHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   F+ +Q DGTY +N++  + K+C  A+E G++++ + LRA++L+ 
Sbjct  131  TRQDELQIVGCETLFDFVTNQKDGTYLFNLDGFIPKLCQSAQEVGDDERAKNLRAAALQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVW M E SHI  D D IV V
Sbjct  191  LSSMVWLMGEHSHISVDFDSIVSV  214



>emb|CDY09095.1| BnaA02g05210D [Brassica napus]
Length=996

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 140/203 (69%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK+LLADIFP+SPD   N RKI KLCEYAAKNP R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCYKELR      V  +   Y +LL  C EQM+ FA + L ++  +LD +
Sbjct  68   IPKITTYLEQRCYKELRLEQFHSVKTVMCIYKKLLVACNEQMSLFASSYLGLIHILLDQS  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   L ++ L+ L
Sbjct  128  RHDEMRVLGCEAIYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTIHLCSAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S++VWFM EFSHI  + D +V V
Sbjct  188  SSLVWFMGEFSHISVEFDNVVSV  210



>ref|XP_007028783.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY09285.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=706

 Score =   226 bits (575),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 147/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL+A+IFP++ +  AN RKI KLC+YA+KNP 
Sbjct  11   QVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYASKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI+  LE+RCYKELR+ + +   ++   Y +LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVSCKEQMTLFASSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   F+ +Q DGT+ +N+E  + K+C LA+E GE +++R L ++ L+ 
Sbjct  131  TRQDEMRIMGCQTLFDFVNNQKDGTFMFNLEGFIPKLCQLAQEIGEGERERKLCSAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM E SHI  + D IV V
Sbjct  191  LSSMIWFMGEHSHISVEFDNIVSV  214



>ref|XP_009789840.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Nicotiana 
sylvestris]
Length=1028

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 142/201 (71%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEYA+KNP 
Sbjct  6    RIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEYASKNPL  65

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCY+ELR+ +   V V+   Y +LL  CK+QM  FA + L+++  +LD 
Sbjct  66   RIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSIIHILLDQ  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC     FI +Q D TY +N E L+ K+C LA+E GE+++   LR + L+ 
Sbjct  126  TRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVLKLRCAGLQA  185

Query  543  LSAMVWFMAEFSHIFADXDEI  605
            LSAM+WFM EF H+ A+ D +
Sbjct  186  LSAMIWFMGEFCHMPAEFDSV  206



>ref|XP_009789839.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Nicotiana 
sylvestris]
Length=1029

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 142/201 (71%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEYA+KNP 
Sbjct  6    RIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEYASKNPL  65

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCY+ELR+ +   V V+   Y +LL  CK+QM  FA + L+++  +LD 
Sbjct  66   RIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSIIHILLDQ  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC     FI +Q D TY +N E L+ K+C LA+E GE+++   LR + L+ 
Sbjct  126  TRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVLKLRCAGLQA  185

Query  543  LSAMVWFMAEFSHIFADXDEI  605
            LSAM+WFM EF H+ A+ D +
Sbjct  186  LSAMIWFMGEFCHMPAEFDSV  206



>ref|XP_009124331.1| PREDICTED: uncharacterized protein LOC103849280 [Brassica rapa]
Length=1024

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 140/203 (69%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK+LLADIFP+SPD   N RKI KLCEYAAKNP R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKQLLADIFPRSPDEQPNDRKISKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCYKELR      V  +   Y +LL  C EQM+ FA + L ++  +LD +
Sbjct  68   IPKITTYLEQRCYKELRLEQFHSVKTVMCIYKKLLVACNEQMSLFASSYLGLIHILLDQS  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ SQ +GTY +N++ L+ K+C LA E GEE++   L ++ L+ L
Sbjct  128  RHDEMRVLGCEAIYDFVTSQTEGTYMFNLDGLIPKICPLAHELGEEERTIHLCSAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S++VWFM EFSHI  + D +V V
Sbjct  188  SSLVWFMGEFSHISVEFDNVVSV  210



>ref|XP_010319193.1| PREDICTED: protein EFR3 homolog B isoform X3 [Solanum lycopersicum]
Length=973

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEE+CYKELR+ + +   V+   Y +L+  CKE M  FA +LL+V+  +LD 
Sbjct  71   RIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSVLQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+    LR   L+ 
Sbjct  131  SRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAIKLRTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_006345431.1| PREDICTED: uncharacterized protein LOC102584593 [Solanum tuberosum]
Length=1017

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEYA+KNP 
Sbjct  6    QIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNERMINKLCEYASKNPL  65

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCY+ELR+ +   V V+   Y +LL  CK+QM  FA + L+++  +LD 
Sbjct  66   RIPKITTVLEQRCYRELRNENLGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSIIHILLDQ  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++T+GC     FI +Q D TY +N E L+ K+C LA+E GE+++   +R + L+ 
Sbjct  126  MRHDEMRTVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVIKMRCAGLQA  185

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+WFM EF H+ A+ D + 
Sbjct  186  LSAMIWFMGEFCHMPAEFDSVT  207



>ref|XP_004229640.1| PREDICTED: protein EFR3 homolog B-like [Solanum lycopersicum]
Length=1018

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEYA+KNP 
Sbjct  6    QIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNERMINKLCEYASKNPL  65

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCY+ELR+ +   V V+   Y +LL  CK+QM  FA + L+++  +LD 
Sbjct  66   RIPKITTVLEQRCYRELRNENLGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSIIHILLDQ  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++T+GC     FI +Q D TY +N E L+ K+C LA+E GE+++   +R + L+ 
Sbjct  126  MRHDEMRTVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVIKMRCAGLQA  185

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+WFM EF H+ A+ D + 
Sbjct  186  LSAMIWFMGEFCHMPAEFDSVT  207



>emb|CDP18636.1| unnamed protein product [Coffea canephora]
Length=1027

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNP 
Sbjct  11   QVLPACGSLCFFCPAMRARSRQPVKRYKKLISDIFPRSQEEEPNERKISKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKE+R+ + + V ++   Y +LL  CKEQM  FA +LL+++  +L+ 
Sbjct  71   RIPKITTSLEQRCYKEIRNENFRSVKIVMSIYRKLLISCKEQMPLFANSLLSIIHTLLEQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D +   GC +   F+ +Q DGTY +N+E  + K+C  A+E G++++ + LRA+ L+ 
Sbjct  131  TRQDDILITGCQSLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEVGDDERAKHLRAAGLQS  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L+A+VWFM E+ HI A+ D IV V
Sbjct  191  LAALVWFMGEYCHISAEFDNIVSV  214



>ref|XP_006421414.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
 gb|ESR34654.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
Length=1027

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 142/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA KNP 
Sbjct  11   KVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYANKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  71   RIPKITTSLEQRCYKELRNENFQFAKIVMCIYRKLLISCKEQMPLFASSLLTIIHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C LA+E GE ++ R +R++ L+ 
Sbjct  131  TRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLAQEVGENERARSIRSAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MV FM E SHI  + D +V V
Sbjct  191  LSSMVRFMGEHSHISVEFDNVVSV  214



>ref|XP_010319191.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
 ref|XP_010319192.1| PREDICTED: protein EFR3 homolog B isoform X1 [Solanum lycopersicum]
Length=1012

 Score =   228 bits (581),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEE+CYKELR+ + +   V+   Y +L+  CKE M  FA +LL+V+  +LD 
Sbjct  71   RIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSVLQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+    LR   L+ 
Sbjct  131  SRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAIKLRTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_004236620.1| PREDICTED: protein EFR3 homolog B isoform X2 [Solanum lycopersicum]
Length=1008

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEE+CYKELR+ + +   V+   Y +L+  CKE M  FA +LL+V+  +LD 
Sbjct  71   RIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSVLQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+    LR   L+ 
Sbjct  131  SRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAIKLRTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>gb|EMT11310.1| hypothetical protein F775_16040 [Aegilops tauschii]
Length=1041

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 138/204 (68%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ P C ++C  CP LR+RSRQPVKRYKK+LA+IFP+S D   N R+I KLCEYAAKNP 
Sbjct  7    KVLPVCGALCYFCPGLRARSRQPVKRYKKILAEIFPRSQDEEPNERRIGKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELR+       V+   Y  LL  CKEQM   A +LL++V  +LD 
Sbjct  67   RVPKITVYLEQRIYKELRAEQYGFAKVVMLIYRRLLVSCKEQMPLLASSLLSIVHTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ I C T   F  +QVDGTY +N+E LV ++C LA+E GE+ +   LRA+ L+ 
Sbjct  127  KRQDDMRIIACETLFDFAVNQVDGTYQFNLEGLVPRLCELAQEAGEDQRATSLRAAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM E SHI ++ D +V V
Sbjct  187  LSAMIWFMGELSHISSEFDNVVEV  210



>ref|XP_009610957.1| PREDICTED: protein EFR3 homolog B isoform X5 [Nicotiana tomentosiformis]
Length=975

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + L    L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAKHLHTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>gb|KHN11694.1| Protein EFR3 like B [Glycine soja]
Length=1010

 Score =   228 bits (580),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 101/203 (50%), Positives = 145/203 (71%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            ++P C S+C  CPAL+ RSR P+KRYKK LADIFP++PD   N R I KLCEYA+KNP R
Sbjct  8    IWPVCGSLCCFCPALQERSRHPIKRYKKFLADIFPRTPDEEPNERMIGKLCEYASKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            +PKI   LE+RCY+ELR+ + + V V+   Y +LL  CK+QM  FA +LL+++  +LD  
Sbjct  68   VPKITSYLEQRCYRELRTENYQSVKVVICIYRKLLISCKDQMPLFASSLLSIIQILLDQP  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+E G++ + + LRA+ L+ L
Sbjct  128  RHDEVQILGCQTLFDFVNNQRDGTYMFNLDGFILKLCNLAQEMGDDAKVQHLRAAGLQVL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+MVWFM EF+HI A+ D +V V
Sbjct  188  SSMVWFMGEFTHISAEFDNVVSV  210



>ref|XP_009610937.1| PREDICTED: protein EFR3 homolog B isoform X2 [Nicotiana tomentosiformis]
Length=1012

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + L    L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAKHLHTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_009610919.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610926.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009610931.1| PREDICTED: protein EFR3 homolog B isoform X1 [Nicotiana tomentosiformis]
Length=1014

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + L    L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAKHLHTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_010930207.1| PREDICTED: uncharacterized protein LOC105051451 [Elaeis guineensis]
Length=1016

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 143/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKL+AD FPK+P+G  N R I KLCEYA KNP 
Sbjct  7    QVLPACGNLCFLCPSMRARSRQPVKRYKKLIADSFPKTPEGEPNNRMIGKLCEYACKNPM  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI +CLE++ YK LR+ H  L  V+   Y  LL  CKEQM  FA +LL+V+  + D 
Sbjct  67   RIPKITECLEQKFYKALRNEHFSLAKVVPCIYRTLLASCKEQMPLFAPSLLSVIRTLFDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   F+ SQ D T+ +N+E L+ K+C L +E G +++   LR++ L+ 
Sbjct  127  TRQDDMRILGCHTVVDFLNSQKDSTFMFNLEGLIPKLCQLGQELGGDERGLRLRSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++M+WFM E+SHI  D D+IV VT
Sbjct  187  LASMMWFMGEYSHISVDFDDIVSVT  211



>ref|XP_009610949.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana tomentosiformis]
Length=1008

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + L    L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAKHLHTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_009610943.1| PREDICTED: protein EFR3 homolog B isoform X3 [Nicotiana tomentosiformis]
Length=1010

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGNLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEERCYKELR+ + +   V+   Y +L+  CKE M  FA +LL+++  +LD 
Sbjct  71   RIPKITKSLEERCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC     F+ +Q DGTY ++++  + K+C LA++ GEE+  + L    L+ 
Sbjct  131  SRENDMLIVGCEALFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAKHLHTVGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>gb|KEH23652.1| cyclin-like protein [Medicago truncatula]
Length=990

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C CCP+LR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLC+Y AKNP 
Sbjct  11   QVLPACGSLCFCCPSLRTRSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCDYVAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ +     ++   Y + L  CKEQM  FA ++L+++  +LD 
Sbjct  71   RIPKIVTALEQRCYKELRNENIHSTRIVMCIYKKFLSSCKEQMPLFASSILSIIQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     F+ +QVDGTY +N+E ++ K+C L +ETGE++  R  R++ L+ 
Sbjct  131  TRQDEMRVIGCNILFDFVNNQVDGTYLFNLEGVIPKLCQLTQETGEDESARIRRSAGLKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+MV FM E SHI  + D IV
Sbjct  191  LSSMVRFMGEHSHISVEFDNIV  212



>ref|XP_011033323.1| PREDICTED: uncharacterized protein LOC105131844 isoform X1 [Populus 
euphratica]
Length=1018

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 143/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYAAKNP 
Sbjct  11   QVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  + +   ++   Y +LL  CKE M  FA +LL ++  +LD 
Sbjct  71   RIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIINTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA+ L+ 
Sbjct  131  TRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS++VWFM++ SHI  + D +V V
Sbjct  191  LSSVVWFMSQHSHISVEFDNVVSV  214



>emb|CDP16550.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 145/214 (68%), Gaps = 9/214 (4%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CP++R+RSRQPVKRYKKLLADIFP+S D   N RKI KLCEYA+KNP 
Sbjct  7    KVVPACGNLCFFCPSMRARSRQPVKRYKKLLADIFPRSQDAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPK---------IAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLL  335
            RIPK         I + LE++ YK+LR+ H   V V+   Y +LL  CKEQM  FA +LL
Sbjct  67   RIPKASLIHLFALITEYLEQKFYKDLRNEHFGSVKVVLRIYRKLLSSCKEQMPLFASSLL  126

Query  336  NVVVEMLDCAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKR  515
             +V  +LD  + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++D+  
Sbjct  127  GMVRTLLDLPQYDELQILGCNTLVDFINGQLDGTYMFNLEGLIPKLCQLAREVGDDDRAL  186

Query  516  CLRASSLRCLSAMVWFMAEFSHIFADXDEIVHVT  617
            CLR++ ++ L+ +V FM + SHI  D D I+ VT
Sbjct  187  CLRSAGMQVLAVLVHFMGKNSHISMDFDHIITVT  220



>ref|XP_006350206.1| PREDICTED: protein EFR3 homolog B-like isoform X3 [Solanum tuberosum]
Length=969

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEE+CYKELR+ + +   V+   Y +L+  CKE M  FA +LL+V+  +LD 
Sbjct  71   RIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSVLQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+    LR   ++ 
Sbjct  131  SRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAINLRTVGVKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_011033324.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Populus euphratica]
Length=1010

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 143/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYAAKNP 
Sbjct  11   QVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  + +   ++   Y +LL  CKE M  FA +LL ++  +LD 
Sbjct  71   RIPKITCSLEQRCYKELRIENFQSAKIVMCIYRKLLVTCKEHMTLFASSLLGIINTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q DGTY +N+E  + K+C  A+E GE+++ + LRA+ L+ 
Sbjct  131  TRQDDIQVIGCETLFDFVNNQKDGTYMFNLEGFIPKLCQFAQEEGEDERAKSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS++VWFM++ SHI  + D +V V
Sbjct  191  LSSVVWFMSQHSHISVEFDNVVSV  214



>ref|XP_006350204.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Solanum tuberosum]
Length=1008

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL++DIFP+S +   N RKI KLCEYAAKNPF
Sbjct  11   QVLPACGSLCFFCPAMRTRSRQPVKRYKKLISDIFPRSQEEEPNDRKIGKLCEYAAKNPF  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI K LEE+CYKELR+ + +   V+   Y +L+  CKE M  FA +LL+V+  +LD 
Sbjct  71   RIPKITKSLEEKCYKELRNENFRSAKVVMCIYKKLVVSCKEHMPLFANSLLSVLQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ + +  +GC +   F+ +Q DGTY ++++  + K+C LA++ GEE+    LR   ++ 
Sbjct  131  SRENDMLIVGCESLFDFVNNQKDGTYMFHLDGFIPKLCQLAQQIGEEESAINLRTVGVKA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E+SH+ A+ D IV V
Sbjct  191  LSAMVWFMGEYSHVSAEFDNIVSV  214



>ref|XP_010666756.1| PREDICTED: uncharacterized protein LOC104883885 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 142/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CP LR+RSRQPVKRYKKL+ADIFPK+ D   N R I KLCEYAA+NP 
Sbjct  11   QVLPACGSLCFFCPGLRARSRQPVKRYKKLIADIFPKTQDEGPNDRMIGKLCEYAARNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+RCYKELR+ +   V ++   Y  LL  CK+QM  FA +L++++  +LD 
Sbjct  71   RVPKITNNLEQRCYKELRNQNFNAVKIVMSIYRRLLVSCKDQMPLFASSLVSIMHILLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
               D ++ IGC     F+ +Q DGT+ +N+E+ + K+C LA+E GE+++   LRA+ L+ 
Sbjct  131  TGQDELRVIGCQALFVFVNNQKDGTFIFNLEDFIPKLCLLAQEVGEDERGFRLRAAGLQT  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM E SH+ A+ D +V V
Sbjct  191  LSSMIWFMGEHSHMLAEFDNVVSV  214



>ref|XP_004506319.1| PREDICTED: uncharacterized protein LOC101489771 [Cicer arietinum]
Length=1032

 Score =   226 bits (577),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 101/203 (50%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            ++P C S+C  CPALR RSR P+KRYKKLLA+IFP++ +   N RKI KLCEYA++NP R
Sbjct  8    IWPVCGSLCCFCPALRERSRHPIKRYKKLLAEIFPRTQEEEPNDRKISKLCEYASRNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            +PKI   LE+RCY+ELRS + + V V+   Y +LL  C++QM  FA +LL+++  +LD  
Sbjct  68   VPKITSYLEQRCYRELRSENYQAVKVVICIYRKLLVSCRDQMPLFASSLLSIIQILLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D V+ +GC T   F+ +Q DGTY +N++  + K+C LA++ GE+ + + LRAS L+ L
Sbjct  128  RHDEVQILGCQTLFDFVNNQRDGTYMFNLDMFILKLCQLAQQMGEDAKIQHLRASGLQVL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+MVWFM EFSHI  + D +V V
Sbjct  188  SSMVWFMGEFSHISVEFDNVVSV  210



>ref|XP_007131432.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
 gb|ESW03426.1| hypothetical protein PHAVU_011G013000g [Phaseolus vulgaris]
Length=1037

 Score =   226 bits (577),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            ++P C S+C  CPALR RSR P+KRYKK LADIFP++P    N R I KLCEYAA+NP R
Sbjct  8    IWPVCGSLCCFCPALRERSRHPIKRYKKFLADIFPRTPGEEPNERMIGKLCEYAARNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            +PKI   LE+RCY+ELR+ + + V V+   Y +LL  CK+QM  FA +LL ++  +LD +
Sbjct  68   VPKITSYLEQRCYRELRTENYQSVKVVILIYRKLLISCKDQMPLFASSLLGIIQILLDQS  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQK-RCLRASSLRC  542
            + D V+ +GC T   F+ +Q DGTY +N++  + K+C+LA+ETG++D K + LRA+ L+ 
Sbjct  128  RHDEVQILGCQTLFDFVNNQKDGTYMFNLDAFIVKLCNLAQETGDDDFKIQQLRAAGLQV  187

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MVWFM EF+HI  + D +V V
Sbjct  188  LSSMVWFMGEFTHISVEFDNVVSV  211



>ref|XP_007028781.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY09283.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1023

 Score =   226 bits (576),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 147/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL+A+IFP++ +  AN RKI KLC+YA+KNP 
Sbjct  11   QVLPACGSLCFFCPAMRARSRQPVKRYKKLIAEIFPRNQEEGANDRKIGKLCDYASKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI+  LE+RCYKELR+ + +   ++   Y +LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKISNSLEQRCYKELRNENFQSAKIVMCIYRKLLVSCKEQMTLFASSLLSIIQTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   F+ +Q DGT+ +N+E  + K+C LA+E GE +++R L ++ L+ 
Sbjct  131  TRQDEMRIMGCQTLFDFVNNQKDGTFMFNLEGFIPKLCQLAQEIGEGERERKLCSAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM E SHI  + D IV V
Sbjct  191  LSSMIWFMGEHSHISVEFDNIVSV  214



>gb|KFK26320.1| hypothetical protein AALP_AA8G232400 [Arabis alpina]
Length=1061

 Score =   226 bits (576),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 138/203 (68%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEYAAKNP R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSVDEQPNDRKIGKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCY+ELR      V ++   Y +LL  C EQM+ FA + L ++  +LD  
Sbjct  68   IPKITTSLEQRCYRELRMEQFHSVKIVMCIYKKLLVACNEQMSLFASSYLGLIHILLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA E GEED+   L A+ L+ L
Sbjct  128  RHDEMRILGCEALYDFVTNQAEGTYMFNLDGLIPKICPLAHELGEEDRTTNLCAAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S++VWFM EFSHI  + D +V V
Sbjct  188  SSLVWFMGEFSHISVEFDNVVSV  210



>gb|EAY92960.1| hypothetical protein OsI_14753 [Oryza sativa Indica Group]
Length=279

 Score =   213 bits (542),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 141/204 (69%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC S+C  CP LR+RSRQPVKRYK +LA+IFPK+ D   N R+I KLCEY ++NP 
Sbjct  7    KVLPACGSLCYFCPGLRARSRQPVKRYKSILAEIFPKTQDEEPNERRIGKLCEYCSRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELRS       V+   Y  LL  CKEQM  FA +LL++V  +LD 
Sbjct  67   RVPKITVSLEQRIYKELRSEQYGFAKVVMLIYRRLLVSCKEQMPLFASSLLSIVHTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F  +QVDGTY +N+E LV ++C L++E GE++Q   LRA++L+ 
Sbjct  127  KRQDDMRIIGCETLFDFAVNQVDGTYQFNLEGLVPRLCELSQEVGEDEQTIALRAAALQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM E SHI ++ D +V V
Sbjct  187  LSAMIWFMGELSHISSEFDNVVQV  210



>ref|XP_006489936.1| PREDICTED: uncharacterized protein LOC102624456 [Citrus sinensis]
Length=1039

 Score =   226 bits (575),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 142/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA KNP 
Sbjct  11   KVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYANKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  71   RIPKITTSLEQRCYKELRNENFQSAKIVMCIYRKLLISCKEQMPLFASSLLTIIHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C L++E GE ++ R +R++ L+ 
Sbjct  131  TRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLSQEVGENERARSIRSAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+MV FM E SHI  + D +V V
Sbjct  191  LSSMVRFMGEHSHISVEFDNVVSV  214



>ref|XP_007225374.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
 gb|EMJ26573.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
Length=997

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKLL DIFP++ D   N RKI KLCEYA KNP 
Sbjct  7    RIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEYALKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ H   V V+   Y +LL  CKEQM  FA +LL +V  +L+ 
Sbjct  67   RIPKITDSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIVRILLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+D T+ +++E L+ K+C +A+E G+ ++   LR++ L+ 
Sbjct  127  NRHDEMRILGCNTLVDFINSQIDSTHMFSLEGLIPKLCQMAQEVGDNERALRLRSAGLQS  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MVWFM E SHI  D D I+ VT
Sbjct  187  LAFMVWFMGEHSHISMDFDTIISVT  211



>ref|XP_008222533.1| PREDICTED: uncharacterized protein LOC103322398 [Prunus mume]
Length=997

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKLL DIFP++ D   N RKI KLCEYA KNP 
Sbjct  7    RIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDIFPRNQDAEPNDRKIGKLCEYALKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ H   V V+   Y +LL  CKEQM  FA +LL +V  +L+ 
Sbjct  67   RIPKITGSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIVRILLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ+D T+ +++E L+ K+C +A+E G+ ++   LR++ L+ 
Sbjct  127  NRHDEMRILGCNTLVDFINSQIDSTHMFSLEGLIPKLCQMAQEVGDNERALRLRSAGLQS  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MVWFM E SHI  D D I+ VT
Sbjct  187  LAFMVWFMGEHSHISMDFDTIISVT  211



>ref|XP_006648302.1| PREDICTED: uncharacterized protein LOC102704216 [Oryza brachyantha]
Length=1039

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 139/204 (68%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CP LR+RSRQPVKRYKK+LADIFP + +   N R+I KLCEY AKNP 
Sbjct  17   KVLPACGGLCYLCPGLRARSRQPVKRYKKILADIFPATQEEEPNVRRIGKLCEYVAKNPH  76

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+RCYKELR+     V V+   Y +LL  CK+QM   A ++L+++  +LD 
Sbjct  77   RVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKDQMPLLASSVLSIISTLLDQ  136

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F  SQVDGTY +N+E LV ++C LA+    E++   LR+S+L+ 
Sbjct  137  TRRDDLRIIGCETLFDFTVSQVDGTYQFNLEELVPRICELAQIVKIEEKDNTLRSSALQA  196

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM E SHI ++ D ++ V
Sbjct  197  LSAMIWFMGELSHISSEFDTVIQV  220



>ref|XP_004158232.1| PREDICTED: protein EFR3 homolog cmp44E-like [Cucumis sativus]
Length=798

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 143/203 (70%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            + P CES+C  CPALR+RSR P+KRYKKLL+DIFP+S D   N RKI KLCEYA+KNPFR
Sbjct  9    MMPVCESLCFFCPALRARSRHPIKRYKKLLSDIFPRSQDEEPNDRKISKLCEYASKNPFR  68

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+R Y+ELR+     V VI     +LL  CKEQM  FA +LL ++  +LD A
Sbjct  69   IPKITSYLEQRFYRELRNEQLHSVKVIICICRKLLSSCKEQMPLFASSLLGIIHILLDQA  128

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     FI +Q DGTY +N++ +V K+C L +E GEE +++ +R++ L+ L
Sbjct  129  RHDEMRILGCQALFDFINNQRDGTYMFNLDGMVPKLCLLTQEIGEERREKQMRSAGLQAL  188

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+++WFM EFS+I A+ D ++ V
Sbjct  189  SSLIWFMGEFSNISAEFDNVISV  211



>ref|XP_008461314.1| PREDICTED: uncharacterized protein LOC103499940 isoform X1 [Cucumis 
melo]
Length=1053

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            + P CES+C  CPALR+RSR P+KRYKKLL+DIFP+S D   N RKI KLCEYA+KNPFR
Sbjct  9    MMPVCESLCFFCPALRARSRHPIKRYKKLLSDIFPRSQDEVPNDRKISKLCEYASKNPFR  68

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+R Y+ELR+     V VI     +LL  CKEQM  FA +LL ++  +LD A
Sbjct  69   IPKIMSYLEQRFYRELRNEQLHSVKVIICICRKLLSSCKEQMPLFASSLLGIIHILLDQA  128

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     FI +Q DGTY +N++ ++ K+C L +ETGEE +++ +R++ L+ L
Sbjct  129  RHDEMRILGCQALFDFINNQRDGTYMFNLDGMIPKLCLLTQETGEERREKQMRSAGLQAL  188

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+M+WFM EFS++ A+ D ++ V
Sbjct  189  SSMIWFMGEFSNVSAEFDNVISV  211



>ref|XP_010546486.1| PREDICTED: uncharacterized protein LOC104818426 isoform X2 [Tarenaya 
hassleriana]
Length=1025

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 139/202 (69%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            +L PAC  +CI CPALR+RSRQPVKRYKKL+A+IFP++     N RKI KLCEYAAKNP 
Sbjct  11   QLLPACGDLCIFCPALRARSRQPVKRYKKLIAEIFPRNQAEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI+  LE+R YKELR+ + +   ++   Y +LL  CKEQM  FA  LL  +  +LD 
Sbjct  71   RMPKISNSLEQRFYKELRNENFQSAKIVMCIYRKLLVTCKEQMTLFASGLLRAIQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++  GC T  +F+ +Q D +Y  N+E  + K+C LARE G+ D+ R LRA+ L+ 
Sbjct  131  SQQDDMQITGCQTLFEFVNNQKDSSYINNLEGFIPKLCQLAREVGDNDRSRNLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+MVW M E+SHI  D D +V
Sbjct  191  LSSMVWLMGEYSHISNDFDNVV  212



>ref|XP_009765963.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765964.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765965.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
 ref|XP_009765966.1| PREDICTED: protein EFR3 homolog cmp44E-like [Nicotiana sylvestris]
Length=214

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 132/185 (71%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC ++C  CP+LR+RSRQPVKRYKKLLA+IFPKS D   N RKI KLCEYA+KNPF
Sbjct  7    KVVPACGNLCFLCPSLRARSRQPVKRYKKLLAEIFPKSQDAEPNDRKIAKLCEYASKNPF  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE+RCYK+LR+ H   V V+   Y +LL  CKE M  +A +LL ++  + + 
Sbjct  67   RIPKITEYLEQRCYKDLRNEHLGSVKVVTVIYRKLLSSCKEHMPLYATSLLGIIRTLFEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI  Q+DGTY +N+E L+ K+C LARE G++D+   LR++ ++ 
Sbjct  127  TQHDEMQILGCNTLVDFINWQMDGTYMFNLEGLIPKMCQLAREIGDDDRALSLRSAGMQT  186

Query  543  LSAMV  557
            L+ +V
Sbjct  187  LAVLV  191



>gb|KGN64805.1| hypothetical protein Csa_1G108300 [Cucumis sativus]
Length=931

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CPAL +RSRQP+KRYKKLLADIFP+S +   N RKI KLCEYA+KNPF
Sbjct  5    QVLPVCGTLCFFCPALSTRSRQPIKRYKKLLADIFPRSQEEEPNDRKIGKLCEYASKNPF  64

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELR+     V V+   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  65   RVPKITTYLEQRFYKELRNEQLHSVKVVICIYRKLLFSCKEQMPLFASSLLGIIHILLDQ  124

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            A+ D ++ +GC     F+ +Q D TY +N++ ++ K+C LA+E GEE +++ +R++SL+ 
Sbjct  125  ARHDEMRILGCEALFDFVNNQRDSTYMFNLDGMIPKLCLLAQELGEEGREKQMRSASLQA  184

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM EFS+I A+ D ++ V
Sbjct  185  LSAMVWFMGEFSNISAEFDNVISV  208



>ref|XP_002308951.2| cyclin-related family protein [Populus trichocarpa]
 gb|EEE92474.2| cyclin-related family protein [Populus trichocarpa]
Length=901

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 143/204 (70%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPA+R+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYAAKNP 
Sbjct  11   QVMPACGSLCFFCPAMRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR  + +   ++   Y +LL  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKITSSLEQRCYKELRIENFQSAKIVMCIYRKLLITCKEQMPLFASSLLSIISTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +Q DGT+ +N+E  + K+C   +E G++++++ L A+ L+ 
Sbjct  131  TRQDDIQVIGCETLFDFVNNQNDGTFMFNLEGFIPKLCQFTQEEGKDEREKSLCAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM + SHI  + D IV V
Sbjct  191  LSSMIWFMGQHSHISVEFDNIVSV  214



>ref|XP_004147289.1| PREDICTED: uncharacterized protein LOC101219905 [Cucumis sativus]
Length=1065

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CPAL +RSRQP+KRYKKLLADIFP+S +   N RKI KLCEYA+KNPF
Sbjct  5    QVLPVCGTLCFFCPALSTRSRQPIKRYKKLLADIFPRSQEEEPNDRKIGKLCEYASKNPF  64

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELR+     V V+   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  65   RVPKITTYLEQRFYKELRNEQLHSVKVVICIYRKLLFSCKEQMPLFASSLLGIIHILLDQ  124

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            A+ D ++ +GC     F+ +Q D TY +N++ ++ K+C LA+E GEE +++ +R++SL+ 
Sbjct  125  ARHDEMRILGCEALFDFVNNQRDSTYMFNLDGMIPKLCLLAQELGEEGREKQMRSASLQA  184

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM EFS+I A+ D ++ V
Sbjct  185  LSAMVWFMGEFSNISAEFDNVISV  208



>ref|XP_004951914.1| PREDICTED: uncharacterized protein LOC101783143 isoform X1 [Setaria 
italica]
Length=1032

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 140/204 (69%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CP+LR RSRQPVKRYKK++ADIFP S +   N R+I KLCEY A+NP 
Sbjct  14   KVLPACGGLCYLCPSLRPRSRQPVKRYKKIIADIFPSSQEDEPNERRIGKLCEYVARNPQ  73

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+RCYKELRS H     V+   Y  LL  CKEQ+   A +LL+++  +LD 
Sbjct  74   RVPKITDYLEQRCYKELRSEHYGYAKVVVLIYRRLLVSCKEQIPLLASSLLSIIQTLLDQ  133

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ IGC     F+ +QVDGTY +N+E LV ++C L++   E+++   LRA++L+ 
Sbjct  134  SRQDDMRIIGCEALFDFVVTQVDGTYQFNLEELVPRLCKLSQVVREDEKANALRAAALQS  193

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L AMVWFM E SHI ++ D++V V
Sbjct  194  LCAMVWFMGELSHISSEFDDVVQV  217



>ref|XP_006293443.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
 gb|EOA26341.1| hypothetical protein CARUB_v10022560mg [Capsella rubella]
Length=1027

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 138/202 (68%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ D   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQDEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI+  LE+RCYKELR+ +  L  +    Y  LL  CKEQM  F+   L  V  +LD 
Sbjct  71   RMPKISDSLEQRCYKELRNENFHLAKIAMCIYRRLLVTCKEQMPLFSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA+ L+ 
Sbjct  131  TRQDEMQIIGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLGLEGGDDDRLRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>ref|XP_007033971.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033972.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033973.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033974.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04897.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04898.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04899.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04900.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=985

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKKLLADIFP++ D   N RKI KLCEYA +NP 
Sbjct  7    RVVPVCGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAEPNDRKIGKLCEYALRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y +LL  CKEQ+  FA +LL ++  +L+ 
Sbjct  67   RIPKITGQLEQRCYKDLRNENFGSVKVVLCIYRKLLSACKEQIPLFASSLLGIIRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC    +FI SQVDGTY +N+E L+ K+C LA+E G++D+   LR++ L+ 
Sbjct  127  TRQDEMQILGCNALVEFINSQVDGTYMFNLEGLIPKLCQLAQEDGDDDRALRLRSAGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++MV FM E SHI  D D I+ VT
Sbjct  187  LASMVCFMGEHSHISMDFDSIISVT  211



>ref|XP_007033975.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY04901.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
Length=984

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKKLLADIFP++ D   N RKI KLCEYA +NP 
Sbjct  7    RVVPVCGNLCFFCPSMRARSRQPVKRYKKLLADIFPRNQDAEPNDRKIGKLCEYALRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y +LL  CKEQ+  FA +LL ++  +L+ 
Sbjct  67   RIPKITGQLEQRCYKDLRNENFGSVKVVLCIYRKLLSACKEQIPLFASSLLGIIRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC    +FI SQVDGTY +N+E L+ K+C LA+E G++D+   LR++ L+ 
Sbjct  127  TRQDEMQILGCNALVEFINSQVDGTYMFNLEGLIPKLCQLAQEDGDDDRALRLRSAGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++MV FM E SHI  D D I+ VT
Sbjct  187  LASMVCFMGEHSHISMDFDSIISVT  211



>ref|XP_004136123.1| PREDICTED: uncharacterized protein LOC101211879 [Cucumis sativus]
Length=1054

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 143/203 (70%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            + P CES+C  CPALR+RSR P+KRYKKLL+DIFP+S D   N RKI KLCEYA+KNPFR
Sbjct  9    MMPVCESLCFFCPALRARSRHPIKRYKKLLSDIFPRSQDEEPNDRKISKLCEYASKNPFR  68

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+R Y+ELR+     V VI     +LL  CKEQM  FA +LL ++  +LD A
Sbjct  69   IPKITSYLEQRFYRELRNEQLHSVKVIICICRKLLSSCKEQMPLFASSLLGIIHILLDQA  128

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     FI +Q DGTY +N++ +V K+C L +E GEE +++ +R++ L+ L
Sbjct  129  RHDEMRILGCQALFDFINNQRDGTYMFNLDGMVPKLCLLTQEIGEERREKQMRSAGLQAL  188

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            S+++WFM EFS+I A+ D ++ V
Sbjct  189  SSLIWFMGEFSNISAEFDNVISV  211



>ref|XP_004493504.1| PREDICTED: uncharacterized protein LOC101511203 isoform X1 [Cicer 
arietinum]
Length=1013

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 144/202 (71%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLC+YAAKNP 
Sbjct  12   QVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYAAKNPL  71

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y + L  CKEQM  FA +LL+++  +LD 
Sbjct  72   RIPKIVNALEQRCYKELRNENFRSTRIVMCIYKKFLSSCKEQMPLFASSLLSIIHTLLDQ  131

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     F+ +QVDG+Y +++E ++ K+C LA+ETGE+++ R  R++ L+ 
Sbjct  132  TRQDEMRVIGCNILFDFVNNQVDGSYLFSLEGVIPKLCQLAQETGEDERARTRRSAGLKA  191

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+MV FM E SHI  + D IV
Sbjct  192  LSSMVRFMGEHSHISVEFDNIV  213



>ref|XP_004493505.1| PREDICTED: uncharacterized protein LOC101511203 isoform X2 [Cicer 
arietinum]
Length=1012

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 144/202 (71%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CPALR+RSRQPVKRYKKL+A+IFP++ +   N RKI KLC+YAAKNP 
Sbjct  12   QVLPACGSLCFFCPALRARSRQPVKRYKKLIAEIFPRNQEEGLNDRKIGKLCDYAAKNPL  71

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y + L  CKEQM  FA +LL+++  +LD 
Sbjct  72   RIPKIVNALEQRCYKELRNENFRSTRIVMCIYKKFLSSCKEQMPLFASSLLSIIHTLLDQ  131

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     F+ +QVDG+Y +++E ++ K+C LA+ETGE+++ R  R++ L+ 
Sbjct  132  TRQDEMRVIGCNILFDFVNNQVDGSYLFSLEGVIPKLCQLAQETGEDERARTRRSAGLKA  191

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+MV FM E SHI  + D IV
Sbjct  192  LSSMVRFMGEHSHISVEFDNIV  213



>ref|XP_009363645.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
 ref|XP_009363646.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
Length=997

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 139/205 (68%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKLL DI P++ D   N RKI KLC+YA KNP 
Sbjct  7    RIVPACGNLCFFCPSMRARSRQPVKRYKKLLTDILPRNQDAEPNDRKIGKLCDYAMKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ H   V V+   Y +LL  CKEQM  FA +LL +V  +L+ 
Sbjct  67   RIPKITDSLEQRCYKDLRNEHFGSVKVVLCIYRKLLSSCKEQMPLFASSLLGIVRILLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   FI SQ D T+ +++E L+ KVC +A E G+ ++   LR++ L+ 
Sbjct  127  TRHDEMRILGCNTLVDFIQSQTDSTHMFSLEGLIPKVCQMAEEVGDNERALRLRSAGLQS  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MVWFM E SHI  D D I+ VT
Sbjct  187  LAFMVWFMGEHSHISMDFDTIISVT  211



>ref|XP_002277709.2| PREDICTED: uncharacterized protein LOC100265428 [Vitis vinifera]
Length=1012

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 144/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ P C S+C  CP++RSRSRQPVKRYKKLLA+IFP+S +   N RKI KLCEYA++NP 
Sbjct  7    KVMPVCGSLCFFCPSMRSRSRQPVKRYKKLLAEIFPRSREEEPNDRKIGKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+     V V+   Y +LL  CKEQM  FA +LL+++  +LD 
Sbjct  67   RIPKITTYLEQRCYKELRTERFHHVKVVMCIYRKLLISCKEQMPLFAGSLLSIIHILLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     F+ +Q D TY +N++ L+ K+C +A+E G++++ + L ++ L+ 
Sbjct  127  TRQDELRIIGCQALFDFVNNQGDSTYMFNLDGLIPKLCLVAQEMGDDERVQQLHSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS+M+WFM EFSHI A+ D +V V
Sbjct  187  LSSMIWFMGEFSHISAEFDNVVGV  210



>ref|XP_010094723.1| hypothetical protein L484_003597 [Morus notabilis]
 gb|EXB56843.1| hypothetical protein L484_003597 [Morus notabilis]
Length=570

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 129/172 (75%), Gaps = 9/172 (5%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+FPAC SMC+CCPALRS SR+PVKRYKKLLA+IFPKS DG  + RKI+KLCEYA++NP 
Sbjct  7    KIFPACGSMCVCCPALRSSSRKPVKRYKKLLAEIFPKSLDGPPSERKIVKLCEYASRNPV  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKIAK LEERCYKELR  H K +N++ + Y++LLC+CKEQMA FAV+LLNV+ E+LD 
Sbjct  67   RIPKIAKYLEERCYKELRCEHIKFINIVTDTYSKLLCLCKEQMAYFAVSLLNVINELLDN  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRC  518
            +K DAV+ +GC T T+FIYSQ+      N E             GEED +R 
Sbjct  127  SKKDAVRILGCQTLTRFIYSQIVHVILDNYEPDTH---------GEEDDERA  169



>ref|XP_006400678.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
 gb|ESQ42131.1| hypothetical protein EUTSA_v10012553mg [Eutrema salsugineum]
Length=1020

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 140/203 (69%), Gaps = 0/203 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            +FP CES+C  CPALR+RSR PVKRYK LLADIFP+S D   N RKI KLCEYAAKNP R
Sbjct  8    VFPVCESLCCFCPALRARSRHPVKRYKHLLADIFPRSLDEQPNDRKISKLCEYAAKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE+RCY+ELR+     V ++   Y +LL  C EQM+ FA + L ++  +LD +
Sbjct  68   IPKITTSLEQRCYRELRTEQFHSVKIVMCIYKKLLVSCNEQMSLFASSYLGLIHILLDQS  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D ++ +GC     F+ +Q +GTY +N++ L+ K+C LA E GEE++   L ++ L+ L
Sbjct  128  RHDEMRVLGCEALYDFVTNQTEGTYMFNLDALIPKICPLAHELGEEERTTNLCSAGLQAL  187

Query  546  SAMVWFMAEFSHIFADXDEIVHV  614
            +++VWFM EFSHI  + D +V V
Sbjct  188  ASLVWFMGEFSHISVEFDNVVSV  210



>ref|XP_010546363.1| PREDICTED: uncharacterized protein LOC104818426 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546433.1| PREDICTED: uncharacterized protein LOC104818426 isoform X1 [Tarenaya 
hassleriana]
Length=1026

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSA-NGRKIMKLCEYAAKNP  179
            +L PAC  +CI CPALR+RSRQPVKRYKKL+A+IFP++      N RKI KLCEYAAKNP
Sbjct  11   QLLPACGDLCIFCPALRARSRQPVKRYKKLIAEIFPRNQQAEGPNDRKIGKLCEYAAKNP  70

Query  180  FRIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLD  359
             R+PKI+  LE+R YKELR+ + +   ++   Y +LL  CKEQM  FA  LL  +  +LD
Sbjct  71   LRMPKISNSLEQRFYKELRNENFQSAKIVMCIYRKLLVTCKEQMTLFASGLLRAIQALLD  130

Query  360  CAKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLR  539
             ++ D ++  GC T  +F+ +Q D +Y  N+E  + K+C LARE G+ D+ R LRA+ L+
Sbjct  131  QSQQDDMQITGCQTLFEFVNNQKDSSYINNLEGFIPKLCQLAREVGDNDRSRNLRAAGLQ  190

Query  540  CLSAMVWFMAEFSHIFADXDEIV  608
             LS+MVW M E+SHI  D D +V
Sbjct  191  ALSSMVWLMGEYSHISNDFDNVV  213



>ref|XP_008463083.1| PREDICTED: uncharacterized protein LOC103501308 isoform X2 [Cucumis 
melo]
Length=1064

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CPAL +RSRQP+KRYKKLLADIFP+S +   N RKI KLCEYA+KNPF
Sbjct  5    QVLPVCGTLCFFCPALSTRSRQPIKRYKKLLADIFPRSLEEEPNDRKIGKLCEYASKNPF  64

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELR+     V V+   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  65   RVPKITTYLEQRFYKELRNEQLHSVKVVICIYRKLLFSCKEQMPLFASSLLGIIHILLDQ  124

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            A+ D ++ +GC     F+ +Q D TY +N++ ++ K+C LA+E GEE +++ +R++SL+ 
Sbjct  125  ARHDEMRILGCEALFDFVNNQRDSTYMFNLDGMIPKLCLLAQELGEEGREKQMRSASLQA  184

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM EFS+I ++ D ++ V
Sbjct  185  LSAMVWFMGEFSNISSEFDNVISV  208



>dbj|BAK04246.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1037

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 141/204 (69%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CP+LR+RSRQPVKRYKK+LA+IFP + +   N R+I KLC+Y A+NP 
Sbjct  32   KVLPACGGLCYFCPSLRARSRQPVKRYKKILAEIFPATQEEEPNERRIGKLCDYVARNPH  91

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI + LE+RCYKELR      V V+   Y +LL  CK+QM   A +LL+++  +LD 
Sbjct  92   RVPKITEYLEQRCYKELRKEQYGFVKVVVLIYRKLLVSCKDQMPLLASSLLSIICTLLDR  151

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F+ +QVDGTY +N+E LV K+C LA+    +++   LRAS+L+ 
Sbjct  152  MRHDDMRIIGCETLFDFVVTQVDGTYQFNLEELVPKLCELAQVVKVQEKSNALRASALQA  211

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM E SHI ++ D +V V
Sbjct  212  LSAMIWFMGELSHISSEFDTVVQV  235



>gb|EYU27043.1| hypothetical protein MIMGU_mgv1a000818mg [Erythranthe guttata]
Length=974

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 138/202 (68%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C+S+CICCPA+R RSR PVKRYKKLLADIFP++     N R+I KLCEY +KNP 
Sbjct  7    RMMPFCDSLCICCPAMRPRSRHPVKRYKKLLADIFPRNMGDEPNDRQISKLCEYVSKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LEERCY+ELR+ +   V VI   Y +L+  C++QM  FA + LNV+  +LD 
Sbjct  67   RVPKITSLLEERCYRELRNANVNRVKVIMCIYRKLIISCQQQMPLFAGSFLNVINTLLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     FI +Q DGTY +N+E L+ K+C LA+E G++++   L  + L+ 
Sbjct  127  TRNDEMRIIGCQALFDFINNQRDGTYMFNLEGLIPKLCLLAQEMGDDERILRLHCAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+ +WFM EF HI  D D +V
Sbjct  187  LSSTIWFMGEFCHISTDFDNVV  208



>ref|XP_008463075.1| PREDICTED: uncharacterized protein LOC103501308 isoform X1 [Cucumis 
melo]
Length=1065

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CPAL +RSRQP+KRYKKLLADIFP+S +   N RKI KLCEYA+KNPF
Sbjct  5    QVLPVCGTLCFFCPALSTRSRQPIKRYKKLLADIFPRSLEEEPNDRKIGKLCEYASKNPF  64

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+R YKELR+     V V+   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  65   RVPKITTYLEQRFYKELRNEQLHSVKVVICIYRKLLFSCKEQMPLFASSLLGIIHILLDQ  124

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            A+ D ++ +GC     F+ +Q D TY +N++ ++ K+C LA+E GEE +++ +R++SL+ 
Sbjct  125  ARHDEMRILGCEALFDFVNNQRDSTYMFNLDGMIPKLCLLAQELGEEGREKQMRSASLQA  184

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM EFS+I ++ D ++ V
Sbjct  185  LSAMVWFMGEFSNISSEFDNVISV  208



>ref|XP_008799995.1| PREDICTED: uncharacterized protein LOC103714504 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008800004.1| PREDICTED: uncharacterized protein LOC103714504 isoform X1 [Phoenix 
dactylifera]
Length=1015

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 141/205 (69%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKL+AD FPK+  G  N R I KLCEYA+KNP 
Sbjct  7    QVLPACGNLCFLCPSMRARSRQPVKRYKKLIADSFPKTQGGEPNNRMIGKLCEYASKNPM  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE++ YK LR     L  V+   Y +LL  CKEQM  FA +LL+V+  + D 
Sbjct  67   RIPKITEFLEQKFYKALRKEDFSLAKVVPCIYRKLLASCKEQMPLFAPSLLSVIRTLFDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T   F+ SQ D TY +N+E LV K+C L +E GE+++   LR++ L+ 
Sbjct  127  TRQDDMQILGCHTLVDFLNSQKDSTYMFNLEGLVPKLCQLGQELGEDERGLRLRSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++M+WFM E+SHI  D D+IV VT
Sbjct  187  LASMMWFMGEYSHISVDFDDIVSVT  211



>emb|CDY06905.1| BnaA04g24100D [Brassica napus]
Length=1020

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI++ LE+RCYKELR+ + +   ++   Y +LL  CKEQM  ++   L  V  +LD 
Sbjct  71   RMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA+E G++D+ R LRA+ L+ 
Sbjct  131  TRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLAQEGGDDDRSRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>ref|XP_006597228.1| PREDICTED: uncharacterized protein LOC100811354 isoform X1 [Glycine 
max]
 ref|XP_006597229.1| PREDICTED: uncharacterized protein LOC100811354 isoform X2 [Glycine 
max]
Length=967

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 141/204 (69%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C+ CP+LR+RSRQPVKRYKK +ADIFP++     N RKI KLCEYA+KNP 
Sbjct  7    RVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQAAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y +LL  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITDNLEQRCYKDLRNENYGSVKVVLCIYRKLLSTCKEQMPLFANSLLGIIRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T  +FI SQ DGTY +N+E  + K+C LA+E G+ +Q   LR++ L+ 
Sbjct  127  TRADEMQILGCNTLVEFIDSQTDGTYMFNLEGFIPKLCQLAQEVGDNEQALLLRSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS MV FM E SH+  D D+I+ V
Sbjct  187  LSHMVQFMVEHSHLSMDFDKIISV  210



>emb|CDY14788.1| BnaC04g47850D [Brassica napus]
Length=1020

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI++ LE+RCYKELR+ + +   ++   Y +LL  CKEQM  ++   L  V  +LD 
Sbjct  71   RMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMLLYSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA+E G++D+ R LRA+ L+ 
Sbjct  131  TRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLAQEGGDDDRSRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>ref|NP_001045867.1| Os02g0143200 [Oryza sativa Japonica Group]
 dbj|BAD13233.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF07781.1| Os02g0143200 [Oryza sativa Japonica Group]
Length=1035

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 137/204 (67%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY A+N  
Sbjct  17   KVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYVARNHH  76

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+RCYKELR+     V V+   Y +LL  CK+QM   A + L+++  +LD 
Sbjct  77   RVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIICTLLDQ  136

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+    E++   LRAS+L+ 
Sbjct  137  TRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQIVKAEEKDNMLRASTLQA  196

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM EFSHI +  D ++ V
Sbjct  197  LSAMIWFMGEFSHISSAFDNVIQV  220



>ref|XP_006411452.1| hypothetical protein EUTSA_v10016171mg [Eutrema salsugineum]
 gb|ESQ52905.1| hypothetical protein EUTSA_v10016171mg [Eutrema salsugineum]
Length=1037

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 140/202 (69%), Gaps = 1/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ +G  N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEG-PNDRKIGKLCEYAAKNAV  69

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI+  LE+RCYKELR+ + +   ++   Y  LL  CKEQM  F+   L  V  +LD 
Sbjct  70   RMPKISDSLEQRCYKELRNENFQSAKIVMCIYRRLLVTCKEQMPLFSSGFLRTVQALLDQ  129

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G +D+ R LRA+ L+ 
Sbjct  130  TRQDEMQRVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGGDDRSRSLRAAGLQA  189

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  190  LSAMIWLMGEYSHIPSDFDNVV  211



>gb|EEE56284.1| hypothetical protein OsJ_05346 [Oryza sativa Japonica Group]
Length=1056

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 137/204 (67%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY A+N  
Sbjct  17   KVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYVARNHH  76

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+RCYKELR+     V V+   Y +LL  CK+QM   A + L+++  +LD 
Sbjct  77   RVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIICTLLDQ  136

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+    E++   LRAS+L+ 
Sbjct  137  TRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQIVKAEEKDNMLRASTLQA  196

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM EFSHI +  D ++ V
Sbjct  197  LSAMIWFMGEFSHISSAFDNVIQV  220



>gb|EEC72466.1| hypothetical protein OsI_05818 [Oryza sativa Indica Group]
Length=1056

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 137/204 (67%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CP LR+RSRQPVKRYKK++ADIFP + D   N R+I KLCEY A+N  
Sbjct  17   KVLPACGGLCYFCPGLRARSRQPVKRYKKIIADIFPATQDEEPNERRIGKLCEYVARNHH  76

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE+RCYKELR+     V V+   Y +LL  CK+QM   A + L+++  +LD 
Sbjct  77   RVPKITAYLEQRCYKELRNEQYGFVKVVVLIYRKLLVSCKKQMPLLASSALSIICTLLDQ  136

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC T   F  SQVDGTY +N+E LV K+C LA+    E++   LRAS+L+ 
Sbjct  137  TRRDDMRIIGCETLFDFTVSQVDGTYQFNLEELVPKLCELAQIVKAEEKDNMLRASALQA  196

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAM+WFM EFSHI +  D ++ V
Sbjct  197  LSAMIWFMGEFSHISSAFDNVIQV  220



>ref|XP_006648006.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Oryza brachyantha]
Length=997

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PACE +C  CP+LR+RSR PVKRYKKLL++IFPKS D   N RKI KLCEY ++NP 
Sbjct  9    EVLPACERLCFLCPSLRTRSRHPVKRYKKLLSEIFPKSQDEEPNDRKIGKLCEYISRNPL  68

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE++ YKELR+ H   V V+   Y +++C C+EQ+  FA +LLN++  +L+ 
Sbjct  69   RVPKITVYLEQKFYKELRAEHFGSVKVVMAIYRKVICSCQEQLPLFANSLLNIIEALLEQ  128

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++TI C T   F+ +QVD TY +N+E+ + K+C LA+E GE ++   + A+ L+ 
Sbjct  129  NRHDDLRTIACQTLFYFVNNQVDSTYMFNLESQIPKLCHLAQEIGENEKTSIVHAAGLQA  188

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+MVWFM E SHI ++ D +V
Sbjct  189  LSSMVWFMGEHSHISSELDNVV  210



>ref|NP_001048304.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAD19529.1| cyclin-like protein [Oryza sativa Japonica Group]
 dbj|BAF10218.1| Os02g0780500 [Oryza sativa Japonica Group]
 dbj|BAH00340.1| unnamed protein product [Oryza sativa Japonica Group]
Length=997

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PACE +C  CP+LR+RSR PVKRYKKLL++IFPKS D   N RKI KLCEY ++NP 
Sbjct  9    EVLPACERLCFLCPSLRTRSRHPVKRYKKLLSEIFPKSQDEEPNDRKIGKLCEYISRNPL  68

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LE++ YKELR  H   V V+   Y +++C C+EQ+  FA +LLN+V  +L+ 
Sbjct  69   RVPKITVYLEQKFYKELRVEHFGSVKVVMAIYRKVICSCQEQLPLFANSLLNIVEALLEQ  128

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++TI C T   F+ +QVD TY +N+E+ + K+C LA+E GE+++   + A+ L+ 
Sbjct  129  NRQDDLRTIACRTLFYFVNNQVDSTYMFNLESQIPKLCQLAQEMGEKEKISIVHAAGLQA  188

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+MVWFM E SHI A+ D +V
Sbjct  189  LSSMVWFMGEHSHISAELDNVV  210



>gb|EYU20743.1| hypothetical protein MIMGU_mgv1a000711mg [Erythranthe guttata]
Length=1009

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 146/204 (72%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC S+C  CP LR+RSRQPVKRYKKL+++IFP+S +   N RKI KLCEYAAKNP 
Sbjct  11   QVLPACGSLCFFCPGLRARSRQPVKRYKKLISEIFPRSQEEEPNDRKIGKLCEYAAKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPK+A  LE+RCYKELR+ + + V V+   Y + L  CKEQM  FA +LL+++  +LD 
Sbjct  71   RIPKMANSLEQRCYKELRNENFRAVKVVMCIYRKFLFSCKEQMPLFANSLLSILYILLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
               D +  IGC +   F+ +Q DGTY +N+E L+ K+C LA+E G++++ + LRA++L+ 
Sbjct  131  TSQDEILVIGCHSLFDFVNNQNDGTYMFNLEGLIPKLCQLAQEVGDDERVQQLRAAALQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LSAMVWFM E SHI  + D IV V
Sbjct  191  LSAMVWFMGENSHISVEFDNIVSV  214



>gb|KJB49179.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
Length=906

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEYA+KNP R
Sbjct  8    VMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEYASKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE++ YK+LR+     V VI   Y +L+  CKEQM  FA + L ++  +LD  
Sbjct  68   IPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTIIQVLLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+E GE+ +   LR++ L+ L
Sbjct  128  RMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQEMGEDGRVHHLRSAGLQTL  187

Query  546  SAMVWFMAEFSHIFADXDEIV  608
            S++VWFM EFSH+ A+ D +V
Sbjct  188  SSVVWFMGEFSHVSAEFDNVV  208



>ref|XP_010505973.1| PREDICTED: uncharacterized protein LOC104782671 [Camelina sativa]
Length=1022

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 138/202 (68%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI+  LE+RCYKELR+ +     +    Y  LL  CKEQM  F+   L  V  +LD 
Sbjct  71   RMPKISDSLEQRCYKELRNENFHSAKIAMCIYRRLLVTCKEQMPLFSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ +GC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA+ L+ 
Sbjct  131  SRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLGLEGGDDDRSRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>ref|XP_009142008.1| PREDICTED: uncharacterized protein LOC103865904 isoform X1 [Brassica 
rapa]
 ref|XP_009142009.1| PREDICTED: uncharacterized protein LOC103865904 isoform X1 [Brassica 
rapa]
Length=1049

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI++ LE+RCYKELR+ + +   ++   Y +LL  CKEQM  ++   L  V  +LD 
Sbjct  71   RMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G++D+ R LRA+ L+ 
Sbjct  131  TRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGDDDRSRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>ref|XP_009142010.1| PREDICTED: uncharacterized protein LOC103865904 isoform X2 [Brassica 
rapa]
Length=1046

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI++ LE+RCYKELR+ + +   ++   Y +LL  CKEQM  ++   L  V  +LD 
Sbjct  71   RMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G++D+ R LRA+ L+ 
Sbjct  131  TRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGDDDRSRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>ref|XP_010508669.1| PREDICTED: uncharacterized protein LOC104785201 isoform X1 [Camelina 
sativa]
 ref|XP_010508670.1| PREDICTED: uncharacterized protein LOC104785201 isoform X2 [Camelina 
sativa]
Length=1026

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 138/202 (68%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPALR+RSRQPVKRYKKL+ADIFP++ +   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPALRARSRQPVKRYKKLIADIFPRNQEEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI+  LE+RCYKELR+ +     +    Y  LL  CKEQM  F+   L  V  +LD 
Sbjct  71   RMPKISDSLEQRCYKELRNENFHSAKIAMCIYRRLLVTCKEQMPLFSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ +GC +  +F+ +Q DG+  +N+E  + K+C L  E G++D+ R LRA+ L+ 
Sbjct  131  SRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLGLEGGDDDRSRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>ref|XP_009142012.1| PREDICTED: uncharacterized protein LOC103865904 isoform X4 [Brassica 
rapa]
Length=1039

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI++ LE+RCYKELR+ + +   ++   Y +LL  CKEQM  ++   L  V  +LD 
Sbjct  71   RMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G++D+ R LRA+ L+ 
Sbjct  131  TRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGDDDRSRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>ref|XP_010069300.1| PREDICTED: protein EFR3 homolog B isoform X1 [Eucalyptus grandis]
 ref|XP_010069301.1| PREDICTED: protein EFR3 homolog B isoform X1 [Eucalyptus grandis]
 gb|KCW57603.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
 gb|KCW57604.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
 gb|KCW57605.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=995

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKKLLA+IFPK+ +   N RKI KLCEYA KNP 
Sbjct  7    RVVPVCGNLCFMCPSMRARSRQPVKRYKKLLANIFPKNQEAEPNDRKIGKLCEYALKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LEERCYK+LR+ +   V V+   Y +LL  CKEQM+ FA +LL +V  +L+ 
Sbjct  67   RIPKITNYLEERCYKDLRNENYGSVKVVLCIYRKLLSSCKEQMSLFAGSLLGIVRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC+T  +F+ +QVDGTY +N+E L+ K+C +A E G++++   LR+S ++ 
Sbjct  127  TQQDELRILGCMTLVEFMNNQVDGTYMFNLEGLIPKLCQMAEEVGDDERILPLRSSGMQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L+ MV FM + SHI  D D+I+ V
Sbjct  187  LACMVLFMGKHSHISMDFDKIMSV  210



>gb|KHG10450.1| Protein EFR3 [Gossypium arboreum]
Length=955

 Score =   220 bits (561),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEYA+KNP R
Sbjct  8    VMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEYASKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE++ YK+LR+     V VI   Y +L+  CKEQM  FA + L ++  +LD  
Sbjct  68   IPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTIIQVLLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+E GE+ +   LR++ L+ L
Sbjct  128  RMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQEMGEDGRVHHLRSAGLQTL  187

Query  546  SAMVWFMAEFSHIFADXDEIV  608
            S++VWFM EFSH+ A+ D +V
Sbjct  188  SSVVWFMGEFSHVSAEFDNVV  208



>ref|XP_009142011.1| PREDICTED: uncharacterized protein LOC103865904 isoform X3 [Brassica 
rapa]
Length=1042

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C S+CI CPA R+RSRQPVKRYKKL++DIFP++ +   N RKI KLCEYAAKN  
Sbjct  11   QVLPVCGSLCILCPAFRARSRQPVKRYKKLISDIFPRNQEEGPNDRKIGKLCEYAAKNAV  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI++ LE+RCYKELR+ + +   ++   Y +LL  CKEQM  ++   L  V  +LD 
Sbjct  71   RMPKISESLEQRCYKELRNENFQSAKIVMCIYRKLLVTCKEQMPLYSSGFLRTVQALLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC +  +F+ +Q DG+  +N+E  + K+C LA E G++D+ R LRA+ L+ 
Sbjct  131  TRQDEMQIVGCQSLFEFVNNQKDGSSLFNLEGFLPKLCQLALEGGDDDRSRSLRAAGLQA  190

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAM+W M E+SHI +D D +V
Sbjct  191  LSAMIWLMGEYSHIPSDFDNVV  212



>gb|KJB49180.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
 gb|KJB49181.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
Length=996

 Score =   220 bits (561),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEYA+KNP R
Sbjct  8    VMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEYASKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE++ YK+LR+     V VI   Y +L+  CKEQM  FA + L ++  +LD  
Sbjct  68   IPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTIIQVLLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+E GE+ +   LR++ L+ L
Sbjct  128  RMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQEMGEDGRVHHLRSAGLQTL  187

Query  546  SAMVWFMAEFSHIFADXDEIV  608
            S++VWFM EFSH+ A+ D +V
Sbjct  188  SSVVWFMGEFSHVSAEFDNVV  208



>gb|KCW57602.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=1017

 Score =   220 bits (561),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKKLLA+IFPK+ +   N RKI KLCEYA KNP 
Sbjct  7    RVVPVCGNLCFMCPSMRARSRQPVKRYKKLLANIFPKNQEAEPNDRKIGKLCEYALKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LEERCYK+LR+ +   V V+   Y +LL  CKEQM+ FA +LL +V  +L+ 
Sbjct  67   RIPKITNYLEERCYKDLRNENYGSVKVVLCIYRKLLSSCKEQMSLFAGSLLGIVRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC+T  +F+ +QVDGTY +N+E L+ K+C +A E G++++   LR+S ++ 
Sbjct  127  TQQDELRILGCMTLVEFMNNQVDGTYMFNLEGLIPKLCQMAEEVGDDERILPLRSSGMQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            L+ MV FM + SHI  D D+I+ V
Sbjct  187  LACMVLFMGKHSHISMDFDKIMSV  210



>gb|KDO47318.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=979

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEYA+KNP 
Sbjct  7    RVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y + L  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGIIRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+E G +++   LR++ L+ 
Sbjct  127  TRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQEMGNDERALRLRSAGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MV FM E SH+  D D+I+ VT
Sbjct  187  LAYMVKFMGEQSHMSMDFDKIISVT  211



>gb|KJB49178.1| hypothetical protein B456_008G105100 [Gossypium raimondii]
Length=1035

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  6    LFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPFR  185
            + P C S+C  CPAL +RSR PVKRYKK LADIFP+SPD   N R I KLCEYA+KNP R
Sbjct  8    VMPVCGSLCFFCPALSTRSRHPVKRYKKFLADIFPRSPDEQPNERMIGKLCEYASKNPLR  67

Query  186  IPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDCA  365
            IPKI   LE++ YK+LR+     V VI   Y +L+  CKEQM  FA + L ++  +LD  
Sbjct  68   IPKITSALEQKFYKDLRTEQFHSVKVIMLVYKKLIISCKEQMPLFASSFLTIIQVLLDQT  127

Query  366  KTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRCL  545
            + D  + +GC   + F+ +Q DGTY +N++ L+ K+C LA+E GE+ +   LR++ L+ L
Sbjct  128  RMDDTRVLGCQALSVFVNNQRDGTYMFNLDGLIPKLCLLAQEMGEDGRVHHLRSAGLQTL  187

Query  546  SAMVWFMAEFSHIFADXDEIV  608
            S++VWFM EFSH+ A+ D +V
Sbjct  188  SSVVWFMGEFSHVSAEFDNVV  208



>gb|KJB37960.1| hypothetical protein B456_006G228200 [Gossypium raimondii]
Length=778

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 141/205 (69%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP+LR+RSRQPVKRYKKLL+DIFP++ +   N RKI KLCEYAAKNP 
Sbjct  7    RVLPVCGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRNQEPVPNDRKIGKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RC+K LR+     V VI   Y +LL  CKEQMA FA +LL ++  +L+ 
Sbjct  67   RIPKITSNLEQRCFKGLRNEKFGCVKVILCVYTKLLSTCKEQMALFASSLLGIIQTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D +  IGC    +F+ SQ+D T+ + +E L+ K+C LA E G++D+   LR++ L+ 
Sbjct  127  TRLDEMLIIGCDALAEFVNSQMDSTHMFQLEGLIPKLCQLAEEDGDDDRALRLRSAGLKV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++MVWFM E SHI  + D I+ VT
Sbjct  187  LASMVWFMGEQSHISLEFDSIISVT  211



>gb|KDO47319.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=985

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEYA+KNP 
Sbjct  7    RVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y + L  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGIIRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+E G +++   LR++ L+ 
Sbjct  127  TRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQEMGNDERALRLRSAGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MV FM E SH+  D D+I+ VT
Sbjct  187  LAYMVKFMGEQSHMSMDFDKIISVT  211



>gb|KDO47320.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47321.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47322.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=1000

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP++R+RSRQPVKRYKK+LADIFP++ D   N RKI KLCEYA+KNP 
Sbjct  7    RVLPVCGNLCFFCPSMRARSRQPVKRYKKMLADIFPRNQDAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y + L  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITTLLEQRCYKDLRNENFGSVKVVVCIYKKFLSSCKEQMPLFASSLLGIIRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + + ++ +GC T   FI SQ DGTY +N+E L+ K+C LA+E G +++   LR++ L+ 
Sbjct  127  TRQEEMQILGCGTLVNFIDSQTDGTYMFNLEGLIPKLCQLAQEMGNDERALRLRSAGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L+ MV FM E SH+  D D+I+ VT
Sbjct  187  LAYMVKFMGEQSHMSMDFDKIISVT  211



>gb|EAZ26671.1| hypothetical protein OsJ_10574 [Oryza sativa Japonica Group]
Length=963

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 140/203 (69%), Gaps = 28/203 (14%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            KLFP+CESMC+CCPALR  SR+PVKRYKKLLA+IFPK+P                     
Sbjct  7    KLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTP---------------------  45

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
                IAK LE+R +KELRS H   + +I E Y++LL +CKEQMA FA++L+NV+ E+L+ 
Sbjct  46   ----IAKFLEQRSHKELRSAHVNFIKIITEAYSKLLFICKEQMAYFAISLVNVLTELLE-  100

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            +K + +  +GC T  KFIYSQVD TY  NIE+LV+KVC L+R+ G E     LRA+SL+C
Sbjct  101  SKQENIHILGCQTLAKFIYSQVDNTYARNIESLVRKVCVLSRQQGVE--HSLLRAASLQC  158

Query  543  LSAMVWFMAEFSHIFADXDEIVH  611
            LSAM+WFM E S+IF D DEIV 
Sbjct  159  LSAMIWFMKEHSYIFVDFDEIVQ  181



>gb|KJB71806.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=778

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 143/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEYA++NP 
Sbjct  7    RVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RC+K+LR+ +   V  +   Y +LL  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGIIRALLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+E G++D+   LR+S L+ 
Sbjct  127  NRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQEYGDDDRALHLRSSGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++MV FM E SHI  D D I+ VT
Sbjct  187  LASMVCFMGEHSHISMDFDSIISVT  211



>gb|KJB37959.1| hypothetical protein B456_006G228200 [Gossypium raimondii]
Length=963

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 141/205 (69%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP+LR+RSRQPVKRYKKLL+DIFP++ +   N RKI KLCEYAAKNP 
Sbjct  7    RVLPVCGNLCFFCPSLRARSRQPVKRYKKLLSDIFPRNQEPVPNDRKIGKLCEYAAKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RC+K LR+     V VI   Y +LL  CKEQMA FA +LL ++  +L+ 
Sbjct  67   RIPKITSNLEQRCFKGLRNEKFGCVKVILCVYTKLLSTCKEQMALFASSLLGIIQTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D +  IGC    +F+ SQ+D T+ + +E L+ K+C LA E G++D+   LR++ L+ 
Sbjct  127  TRLDEMLIIGCDALAEFVNSQMDSTHMFQLEGLIPKLCQLAEEDGDDDRALRLRSAGLKV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++MVWFM E SHI  + D I+ VT
Sbjct  187  LASMVWFMGEQSHISLEFDSIISVT  211



>ref|XP_011087843.1| PREDICTED: uncharacterized protein LOC105169196 [Sesamum indicum]
Length=1011

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 139/202 (69%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C+S+CICCP +R RSR PVKRYKKLLADI+PK+ +   N RKI KLCEYA+KNP 
Sbjct  7    RMMPVCDSLCICCPGMRPRSRHPVKRYKKLLADIYPKNMEEEPNDRKISKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            R+PKI   LEERCY+ELR+ +   V V+   Y +L+  C++QM  FA + L+++  +LD 
Sbjct  67   RVPKITSLLEERCYRELRNENINCVKVVMCIYRKLVVSCQQQMPLFAGSFLSIIHILLDQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC     FI +Q DGTY +N+E L+ K+C +A+E G +++   LR + L+ 
Sbjct  127  TRHDEMRIIGCHALFDFINNQRDGTYMFNLEGLIPKLCLIAQEMGNDERMLRLRCAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LS+ +WFM EF HI  D D +V
Sbjct  187  LSSTIWFMGEFCHISTDFDNVV  208



>gb|KJB71809.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=926

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 143/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEYA++NP 
Sbjct  7    RVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RC+K+LR+ +   V  +   Y +LL  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGIIRALLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+E G++D+   LR+S L+ 
Sbjct  127  NRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQEYGDDDRALHLRSSGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++MV FM E SHI  D D I+ VT
Sbjct  187  LASMVCFMGEHSHISMDFDSIISVT  211



>ref|XP_009626575.1| PREDICTED: protein EFR3 homolog B-like [Nicotiana tomentosiformis]
Length=204

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 131/185 (71%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC+ +C+CCPA+R+RSRQPVKRYKKL++D FP+SPDG  N R I KLCEYA+KNP 
Sbjct  6    RIMPACDQLCVCCPAMRTRSRQPVKRYKKLISDSFPRSPDGEPNDRMINKLCEYASKNPL  65

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCY+ELR+ +   V V+   Y +LL  CK+QM  FA + L+++  +LD 
Sbjct  66   RIPKITSVLEQRCYRELRNENIGSVKVVMCIYRKLLTSCKQQMPLFAGSFLSIIHILLDQ  125

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC     FI +Q D TY +N E L+ K+C LA+E GE+++   LR + L+ 
Sbjct  126  TRHDEMRIVGCQALFDFIINQRDSTYMFNFEGLIPKICLLAQEMGEDERVLKLRCAGLQA  185

Query  543  LSAMV  557
            LSAMV
Sbjct  186  LSAMV  190



>gb|KJB71808.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=975

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 143/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEYA++NP 
Sbjct  7    RVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RC+K+LR+ +   V  +   Y +LL  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGIIRALLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+E G++D+   LR+S L+ 
Sbjct  127  NRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQEYGDDDRALHLRSSGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++MV FM E SHI  D D I+ VT
Sbjct  187  LASMVCFMGEHSHISMDFDSIISVT  211



>ref|XP_007162229.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
 gb|ESW34223.1| hypothetical protein PHAVU_001G134800g [Phaseolus vulgaris]
Length=978

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 145/202 (72%), Gaps = 0/202 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C  CP+LR+RSRQPVKRYKKL+ADIFP++ +  AN R+I KLC+YAA+NP 
Sbjct  12   QVLPVCGNLCFFCPSLRARSRQPVKRYKKLIADIFPRNQEDGANDRQIGKLCDYAARNPL  71

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI + LE+RCY+ELR+ + +   ++   Y + L  CKEQM  FA +LL+++  +LD 
Sbjct  72   RIPKIMQALEQRCYRELRNENIRSAKIVMCIYKKFLFSCKEQMPLFANSLLSIIHTLLDQ  131

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
            ++ D ++ IGC     F+ +Q DG+Y +N+E ++ K+C LA+ETG++++ R  R++ L+ 
Sbjct  132  SRQDEMRIIGCQILFDFVNNQSDGSYLFNLEAVIPKLCQLAQETGDDERARMSRSTGLKA  191

Query  543  LSAMVWFMAEFSHIFADXDEIV  608
            LSAMV FM E SH+  + D IV
Sbjct  192  LSAMVRFMGENSHMSVEFDNIV  213



>gb|KJB71804.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71805.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71807.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71810.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71811.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=974

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 143/205 (70%), Gaps = 0/205 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ PAC ++C  CP++R+RSRQPVKRYKKLLA+IFP++ D   N RKI KLCEYA++NP 
Sbjct  7    RVVPACGNLCFFCPSMRARSRQPVKRYKKLLAEIFPRNQDAEPNDRKIGKLCEYASRNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RC+K+LR+ +   V  +   Y +LL  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITSNLEQRCFKDLRNENFGCVKAVLCIYRKLLSSCKEQMPLFASSLLGIIRALLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC     FI SQ+DGT+ + +E L+ K+C LA+E G++D+   LR+S L+ 
Sbjct  127  NRQDEMRILGCNALVDFINSQMDGTHMFQLEGLIPKLCQLAQEYGDDDRALHLRSSGLQV  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHVT  617
            L++MV FM E SHI  D D I+ VT
Sbjct  187  LASMVCFMGEHSHISMDFDSIISVT  211



>ref|XP_006595061.1| PREDICTED: uncharacterized protein LOC100806860 isoform X2 [Glycine 
max]
 ref|XP_003542058.2| PREDICTED: uncharacterized protein LOC100806860 isoform X1 [Glycine 
max]
Length=965

 Score =   218 bits (554),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 139/204 (68%), Gaps = 0/204 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            ++ P C ++C+ CP+LR+RSRQPVKRYKK +ADIFP++     N RKI KLCEYA+KNP 
Sbjct  7    RVVPVCGNLCVFCPSLRARSRQPVKRYKKFIADIFPRNQVAEPNDRKIGKLCEYASKNPL  66

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYK+LR+ +   V V+   Y +LL  CKEQM  FA +LL ++  +L+ 
Sbjct  67   RIPKITDNLEQRCYKDLRNENFGSVKVVLCIYRKLLSTCKEQMPLFANSLLGIIRTLLEQ  126

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ +GC T  +FI  Q DGTY +N+E  + K+C LA+E G  +Q   LR++ L+ 
Sbjct  127  TRADEMQILGCNTLVEFIDCQTDGTYMFNLEGFIPKLCQLAQEVGNNEQALLLRSAGLQA  186

Query  543  LSAMVWFMAEFSHIFADXDEIVHV  614
            LS MV FM E SH+  D D+I+ V
Sbjct  187  LSHMVQFMGEHSHLSMDFDKIISV  210



>gb|KDO53678.1| hypothetical protein CISIN_1g0359231mg, partial [Citrus sinensis]
Length=194

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    KLFPACESMCICCPALRSRSRQPVKRYKKLLADIFPKSPDGSANGRKIMKLCEYAAKNPF  182
            K+ PAC  +C  CPA+R+RSRQPVKRYKKL++DIFP++ D   N RKI KLCEYA KNP 
Sbjct  11   KVLPACGRLCFFCPAMRARSRQPVKRYKKLISDIFPRNQDEGPNDRKIGKLCEYANKNPL  70

Query  183  RIPKIAKCLEERCYKELRSGHTKLVNVIAEFYNELLCMCKEQMACFAVNLLNVVVEMLDC  362
            RIPKI   LE+RCYKELR+ + +   ++   Y +LL  CKEQM  FA +LL ++  +LD 
Sbjct  71   RIPKITTSLEQRCYKELRNENFQSAKIVMCIYRKLLISCKEQMPLFASSLLTIIHTLLDQ  130

Query  363  AKTDAVKTIGCLTFTKFIYSQVDGTYTYNIENLVQKVCSLARETGEEDQKRCLRASSLRC  542
             + D ++ IGC+T   F+ +Q DGTY +N+E  + K+C LA+E GE ++ R +R++ L+ 
Sbjct  131  TRQDEIQIIGCMTLFDFVNNQKDGTYMFNLECFIPKLCQLAQEVGENERARSIRSAGLQA  190

Query  543  LSAM  554
            LS+M
Sbjct  191  LSSM  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520