BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS133C07

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       239   3e-71   Nicotiana tomentosiformis
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       239   7e-71   Nicotiana sylvestris
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       231   5e-68   Solanum tuberosum [potatoes]
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       229   1e-67   Solanum lycopersicum
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       229   2e-67   Solanum tuberosum [potatoes]
gb|AFU61111.1|  F-box protein                                           220   7e-64   Capsicum annuum
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       218   3e-63   Solanum lycopersicum
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       216   1e-62   Nicotiana tomentosiformis
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       211   1e-60   Nicotiana sylvestris
emb|CDP10419.1|  unnamed protein product                                205   3e-58   Coffea canephora [robusta coffee]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       177   4e-48   Sesamum indicum [beniseed]
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         170   1e-45   Jatropha curcas
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       167   1e-44   Nelumbo nucifera [Indian lotus]
ref|XP_002524506.1|  grr1, plant, putative                              167   2e-44   Ricinus communis
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       165   8e-44   Nelumbo nucifera [Indian lotus]
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       164   1e-43   
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       164   2e-43   Vitis vinifera
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       164   2e-43   Populus euphratica
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       163   3e-43   Pyrus x bretschneideri [bai li]
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg                162   5e-43   Erythranthe guttata [common monkey flower]
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             162   5e-43   Phaseolus vulgaris [French bean]
ref|XP_010086585.1|  hypothetical protein L484_002248                   160   4e-42   Morus notabilis
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   9e-42   Pyrus x bretschneideri [bai li]
gb|KJB54023.1|  hypothetical protein B456_009G017100                    159   1e-41   Gossypium raimondii
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       157   5e-41   Populus euphratica
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      157   6e-41   Gossypium arboreum [tree cotton]
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   9e-41   
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             156   1e-40   
gb|KJB55011.1|  hypothetical protein B456_009G058000                    154   4e-40   Gossypium raimondii
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      154   4e-40   Gossypium arboreum [tree cotton]
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         151   5e-39   Jatropha curcas
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       151   7e-39   Eucalyptus grandis [rose gum]
emb|CBI28209.3|  unnamed protein product                                150   1e-38   Vitis vinifera
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       151   1e-38   
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             148   6e-38   
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     148   6e-38   Eucalyptus grandis [rose gum]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       148   9e-38   Eucalyptus grandis [rose gum]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    147   2e-37   Gossypium raimondii
ref|XP_002515516.1|  grr1, plant, putative                              145   9e-37   Ricinus communis
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       145   1e-36   Vitis vinifera
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       144   5e-36   
ref|XP_007011864.1|  EIN3-binding F box protein 1                       143   6e-36   
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       142   8e-36   Cicer arietinum [garbanzo]
emb|CAN83761.1|  hypothetical protein VITISV_043743                     142   1e-35   Vitis vinifera
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       141   2e-35   Glycine max [soybeans]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    141   2e-35   
emb|CBI21043.3|  unnamed protein product                                140   3e-35   Vitis vinifera
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             140   5e-35   
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like       139   1e-34   Fragaria vesca subsp. vesca
gb|AFT92041.1|  EIN3 binding F-box 1                                    139   2e-34   Malus domestica [apple tree]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             139   2e-34   Prunus persica
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    139   2e-34   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    139   2e-34   
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       139   2e-34   Cucumis sativus [cucumbers]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             137   5e-34   
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       137   5e-34   Pyrus x bretschneideri [bai li]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             137   6e-34   Phaseolus vulgaris [French bean]
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       137   1e-33   Sesamum indicum [beniseed]
emb|CAN82790.1|  hypothetical protein VITISV_030601                     137   1e-33   Vitis vinifera
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      136   2e-33   Gossypium arboreum [tree cotton]
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       136   2e-33   Cucumis melo [Oriental melon]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  135   3e-33   Cucumis sativus [cucumbers]
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       136   3e-33   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       135   3e-33   
gb|KJB65824.1|  hypothetical protein B456_010G114900                    135   4e-33   Gossypium raimondii
gb|KJB65823.1|  hypothetical protein B456_010G114900                    135   4e-33   Gossypium raimondii
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     135   5e-33   Eucalyptus grandis [rose gum]
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   6e-33   
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    135   6e-33   Eucalyptus grandis [rose gum]
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                      134   7e-33   Gossypium arboreum [tree cotton]
gb|KJB82811.1|  hypothetical protein B456_013G215000                    134   7e-33   Gossypium raimondii
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   133   2e-32   Citrus sinensis [apfelsine]
gb|KJB07737.1|  hypothetical protein B456_001G042600                    133   2e-32   Gossypium raimondii
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    133   2e-32   Prunus mume [ume]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    133   4e-32   
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       132   4e-32   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       132   4e-32   Populus euphratica
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             132   5e-32   Citrus clementina [clementine]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       132   5e-32   Glycine max [soybeans]
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             132   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       131   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_002308665.2|  grr1 family protein                                130   2e-31   
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like       130   2e-31   Elaeis guineensis
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             130   3e-31   Phaseolus vulgaris [French bean]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       130   3e-31   Phoenix dactylifera
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    130   4e-31   
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                129   6e-31   Erythranthe guttata [common monkey flower]
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   6e-31   Glycine max [soybeans]
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   9e-31   
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   9e-31   Nicotiana tomentosiformis
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    129   9e-31   Glycine max [soybeans]
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            129   1e-30   Nicotiana sylvestris
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   1e-30   
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    128   2e-30   
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   2e-30   Elaeis guineensis
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   2e-30   Citrus sinensis [apfelsine]
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            127   3e-30   Sesamum indicum [beniseed]
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   5e-30   Phoenix dactylifera
ref|XP_003588766.1|  Ein3-binding f-box protein                         125   2e-29   Medicago truncatula
gb|KHN33913.1|  EIN3-binding F-box protein 1                            124   3e-29   Glycine soja [wild soybean]
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   9e-29   Solanum tuberosum [potatoes]
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   1e-28   Cicer arietinum [garbanzo]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          122   1e-28   Amborella trichopoda
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       121   4e-28   Fragaria vesca subsp. vesca
gb|AES91540.2|  EIN3-binding F-box-like protein                         119   4e-27   Medicago truncatula
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like       118   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like       118   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003609343.1|  Ein3-binding f-box protein                         119   8e-27   
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   4e-26   
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            115   5e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_565597.1|  EIN3-binding F-box protein 1                          114   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            114   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    114   1e-25   Glycine max [soybeans]
gb|KHN07078.1|  EIN3-binding F-box protein 1                            114   2e-25   Glycine soja [wild soybean]
gb|EPS63879.1|  f-box family protein                                    114   2e-25   Genlisea aurea
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       114   2e-25   
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       113   3e-25   Populus euphratica
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       113   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like       113   4e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             112   5e-25   Eutrema salsugineum [saltwater cress]
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            112   5e-25   Tarenaya hassleriana [spider flower]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   7e-25   Cucumis sativus [cucumbers]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH20224.1|  AT2G25490                                              111   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            111   1e-24   Cucumis melo [Oriental melon]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            111   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       111   2e-24   Tarenaya hassleriana [spider flower]
gb|KJB07621.1|  hypothetical protein B456_001G033400                    110   2e-24   Gossypium raimondii
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like       110   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH32121.1|  EIN3-binding F-box-like protein                         110   4e-24   Medicago truncatula
ref|XP_003609344.1|  Ein3-binding f-box protein                         110   5e-24   
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             109   6e-24   Phaseolus vulgaris [French bean]
gb|KEH32122.1|  EIN3-binding F-box-like protein                         110   6e-24   Medicago truncatula
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       109   8e-24   Tarenaya hassleriana [spider flower]
ref|XP_002880682.1|  ein3-binding F box protein 1                       108   1e-23   
ref|XP_002874252.1|  ein3-binding F box protein 2                       108   2e-23   
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             108   2e-23   Capsella rubella
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             107   4e-23   Capsella rubella
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    107   5e-23   Arabis alpina [alpine rockcress]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                105   1e-22   Erythranthe guttata [common monkey flower]
gb|ABK25485.1|  unknown                                                 104   2e-22   Picea sitchensis
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       104   5e-22   Camelina sativa [gold-of-pleasure]
ref|NP_197917.1|  EIN3-binding F-box protein 2                          103   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       103   8e-22   Brassica rapa
gb|ACB59221.1|  F-box protein                                           103   9e-22   Brassica oleracea
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g             102   1e-21   Phaseolus vulgaris [French bean]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            102   3e-21   Camelina sativa [gold-of-pleasure]
emb|CDY19807.1|  BnaA09g04600D                                          101   5e-21   Brassica napus [oilseed rape]
emb|CDX87090.1|  BnaC09g04050D                                          100   7e-21   
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   1e-20   Cucumis melo [Oriental melon]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like       100   1e-20   Cucumis sativus [cucumbers]
ref|XP_003603398.1|  Ein3-binding f-box protein                       99.8    2e-20   
gb|AES73649.2|  EIN3-binding F-box-like protein                       99.8    2e-20   Medicago truncatula
gb|EPS63568.1|  ein3-binding f-box protein 3                          99.0    2e-20   Genlisea aurea
gb|AEK81539.1|  EIN3 binding F-box 1                                  99.0    4e-20   Dianthus caryophyllus [carnation]
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     98.2    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.9    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.9    4e-19   Tarenaya hassleriana [spider flower]
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg           93.2    3e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.4    5e-18   Tarenaya hassleriana [spider flower]
emb|CDY35358.1|  BnaA04g14890D                                        92.4    6e-18   Brassica napus [oilseed rape]
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          91.3    1e-17   Brassica rapa
emb|CDX88173.1|  BnaA06g27640D                                        91.3    1e-17   
emb|CDX76980.1|  BnaC04g37750D                                        90.5    2e-17   
emb|CDX80503.1|  BnaC07g29410D                                        88.6    1e-16   
ref|NP_001237471.1|  grr1 protein                                     87.4    3e-16   
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like     87.0    4e-16   Brachypodium distachyon [annual false brome]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          86.7    5e-16   Brassica rapa
dbj|BAJ88579.1|  predicted protein                                    82.8    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT19526.1|  hypothetical protein F775_07091                       81.6    3e-14   
dbj|BAD15849.1|  putative F-box protein                               80.9    5e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84905.1|  hypothetical protein OsI_06273                        79.3    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1          78.6    3e-13   Brachypodium distachyon [annual false brome]
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like     77.4    7e-13   
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1        76.6    1e-12   
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like     73.9    7e-12   Setaria italica
dbj|BAD35544.1|  putative F-box protein Fbl2                          70.5    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01599.1|  hypothetical protein OsI_23635                        70.5    1e-10   Oryza sativa Indica Group [Indian rice]
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                  66.6    2e-09   
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870        65.9    3e-09   Sorghum bicolor [broomcorn]
ref|NP_001147557.1|  LOC100281166                                     63.9    1e-08   Zea mays [maize]
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.8    3e-08   Oryza brachyantha
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...  62.0    7e-08   
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                  61.6    8e-08   
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like     57.8    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_001775242.1|  predicted protein                                57.4    2e-06   
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.8    7e-06   Setaria italica
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     55.1    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_002986021.1|  hypothetical protein SELMODRAFT_123441           55.1    1e-05   
ref|XP_002974778.1|  hypothetical protein SELMODRAFT_442539           54.7    1e-05   Selaginella moellendorffii
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861           53.5    4e-05   
emb|CDP13515.1|  unnamed protein product                              48.5    3e-04   Coffea canephora [robusta coffee]
ref|XP_006849175.1|  hypothetical protein AMTR_s00027p00189050        50.4    4e-04   
ref|XP_002963689.1|  hypothetical protein SELMODRAFT_62165            49.7    9e-04   



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 5/154 (3%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            MPTLVNYSGDD+F +G SLCSADLGLMLSLGHA VYCP RK+ARI+GPFVVE + K PSI
Sbjct  1    MPTLVNYSGDDEFYSGGSLCSADLGLMLSLGHAQVYCPLRKKARISGPFVVEERTKNPSI  60

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E LPDECLFEIFRRL GGRERS+AACVSKRWLML S+VRNSEI   +SH D+S+A+  NG
Sbjct  61   EILPDECLFEIFRRLQGGRERSAAACVSKRWLMLSSNVRNSEI---QSHTDISVAN--NG  115

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S+D +M  ADED+EVECDGYL+R +EGKKATD+
Sbjct  116  DSSDGKMVSADEDVEVECDGYLTRCLEGKKATDI  149



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   239 bits (609),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 6/154 (4%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            MPTLVNYSGDD+F +G SLCSADLGLMLSLGHA VYCP RKRARI+GPF++E + K PSI
Sbjct  1    MPTLVNYSGDDEFYSGGSLCSADLGLMLSLGHAQVYCPLRKRARISGPFIIEERTKNPSI  60

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E LPDECLFEIFRRL GGR+RS+AACVSKRWLML S+VR+SEI     H DLS+AD  NG
Sbjct  61   EILPDECLFEIFRRLQGGRQRSAAACVSKRWLMLSSNVRSSEI----CHTDLSVAD--NG  114

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S+D +M  ADED+EVECDGYL+R +EGKKATD+
Sbjct  115  TSSDAKMVSADEDVEVECDGYLTRCLEGKKATDI  148



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 124/154 (81%), Gaps = 10/154 (6%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            MPTLVNYSGDD+F +G S CSADLGLMLSLGHADVYCP RKRARI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGSFCSADLGLMLSLGHADVYCPPRKRARISGPFVVEDRSKDPSL  60

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E LPDECLFEI RRL GGRER +AACVSKRWL ++SSVRNSEI RSKS+ +L        
Sbjct  61   EILPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVRNSEICRSKSYNNL--------  112

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              ND  M   DEDLEVECDGYL+R VEGKKATDV
Sbjct  113  --NDAIMISKDEDLEVECDGYLTRCVEGKKATDV  144



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 124/154 (81%), Gaps = 10/154 (6%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            MPTLVNYSGDD+F +G S CSADLGLMLSLGHADVYCP RKRARI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGSFCSADLGLMLSLGHADVYCPPRKRARISGPFVVEDRSKDPSL  60

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E LPDECLFEI RRL GGRER +AACVSKRWL ++SSV+NSEI RSKS+ +L        
Sbjct  61   EVLPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVKNSEICRSKSYNNL--------  112

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              ND  M   DEDLEVECDGYL+R VEGKKATD+
Sbjct  113  --NDAIMISKDEDLEVECDGYLTRCVEGKKATDI  144



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 131/154 (85%), Gaps = 7/154 (5%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            M TLVNYSGD++F +G SLCSADLGLML+LGHAD+YCP  KRARI+GPFVVE + K PSI
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSADLGLMLALGHADIYCPVSKRARISGPFVVEERTKNPSI  60

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E LP+ECLFEIFRRL GGRERS+AACVSKRWLML+S++R+S+I     H +LS A   NG
Sbjct  61   EVLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI----RHTNLSAA---NG  113

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            AS+D +M+ ADEDLEVECDGYL+R +EGKKATD+
Sbjct  114  ASDDTKMASADEDLEVECDGYLTRCLEGKKATDI  147



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 123/154 (80%), Gaps = 10/154 (6%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            MP LVNYSGDD+  +G S CSADLGLMLSLGHA+VYCP RKR+RI+GPFVVE + K PS+
Sbjct  1    MPALVNYSGDDELYSGGSFCSADLGLMLSLGHAEVYCPPRKRSRISGPFVVEDRSKGPSL  60

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            + LPDECLFEI RRL GGRER +A+C+SKRWLML+SSVR+SEI RSKS+ +L        
Sbjct  61   DDLPDECLFEILRRLPGGRERGAASCLSKRWLMLLSSVRSSEICRSKSYTNL--------  112

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              ND  M   DEDLEVECDGYL+R VEGKKATDV
Sbjct  113  --NDSTMISKDEDLEVECDGYLTRCVEGKKATDV  144



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 130/154 (84%), Gaps = 8/154 (5%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            M TLVNYSGD++F +G SLCSADLGL+L+LGHAD+YCP  KRARI+GPF+VE + K PSI
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSADLGLILALGHADIYCPVSKRARISGPFIVEERTKNPSI  60

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E LP+ECLFEIFRRL GGRERS+AACVSKRWLML+S++R+S+I     H +LS A   NG
Sbjct  61   ELLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI----RHTNLSAA---NG  113

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            AS+D +M+ +DED +VECDGYL+R +EGKKATD+
Sbjct  114  ASDDTKMASSDED-QVECDGYLTRCLEGKKATDI  146



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 119/154 (77%), Gaps = 11/154 (7%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            MPTLVNYSGDD+F +G   CSA+           VYCP RKR RI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGPFCSAE-----------VYCPPRKRVRISGPFVVEDRSKDPSL  49

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E LPDECLFEI RRL GGRERS+AACVSKRWLML+SSVRNSEI RSKS  +LS  ++VNG
Sbjct  50   EILPDECLFEILRRLPGGRERSAAACVSKRWLMLLSSVRNSEICRSKSQNNLSSVEEVNG  109

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             SND  M   DEDLEVECDGYL+R VEGKKATDV
Sbjct  110  DSNDTTMIYKDEDLEVECDGYLTRCVEGKKATDV  143



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 117/154 (76%), Gaps = 11/154 (7%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  352
            MPTLVN+SGDD+F +G   CSA+           VYCP RKR RI+ PFVVE + K PS+
Sbjct  1    MPTLVNHSGDDEFYSGGPFCSAE-----------VYCPPRKRVRISSPFVVEDRSKDPSL  49

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E LPDECLFEI RRLSGGRERS+AACVSK WLML+SSVR SEI RSKSH +LS  ++V G
Sbjct  50   EILPDECLFEILRRLSGGRERSAAACVSKHWLMLLSSVRTSEICRSKSHNNLSSVEEVKG  109

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             SND  M   DEDLEVECDGYL+R VEGKKATDV
Sbjct  110  NSNDTTMISKDEDLEVECDGYLTRCVEGKKATDV  143



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 123/158 (78%), Gaps = 6/158 (4%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEV----QEK  340
            MP LVNY GDDDF  G S+CSAD GL+LS+  ADVYCP RKR+R++ P+ V+     +E+
Sbjct  1    MPALVNYGGDDDFYTGRSICSADSGLVLSI--ADVYCPPRKRSRVSAPYAVDSRLFNKER  58

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
             PSIE LPDECLFEIFRRL G +ERS++ACVSKRWLML+SSVRNSE  RS S Q+     
Sbjct  59   NPSIETLPDECLFEIFRRLPGAQERSASACVSKRWLMLLSSVRNSEFCRSNSPQEQLATK  118

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +V    +DVEM+ AD D+E++C+GYL+RS+EGKKATDV
Sbjct  119  EVKKTESDVEMNSADGDMEIQCNGYLTRSLEGKKATDV  156



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 114/159 (72%), Gaps = 13/159 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQE  337
            MP LVN  GDDDF + G SLCS D G++ S+  H ++YCP RKR+RI+GP++V     ++
Sbjct  1    MPALVNIRGDDDFYSEGGSLCSGDSGVVFSISSHVEIYCPPRKRSRISGPYIVSRNLFED  60

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            K+PSI+ LPDECLFEIFRRL GGRERS++ACVSKRWL ++SSVR+SE  RSK  Q     
Sbjct  61   KRPSIDVLPDECLFEIFRRLPGGRERSASACVSKRWLTVLSSVRSSEFNRSKIPQGQPKT  120

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              +  A N+ E        ++ECDGYL+R VEGKKATDV
Sbjct  121  ISIEKAVNNTE--------DIECDGYLTRCVEGKKATDV  151



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 115/161 (71%), Gaps = 13/161 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----QE  337
            MPTLVNYSGDD+F AG SLC+  +  + S+G   D+Y P  KRAR + PF+       Q 
Sbjct  1    MPTLVNYSGDDEFYAGGSLCTNSM--LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFEQN  58

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            K+PSI+ LPDECLFEIFRR+ GG+ERSS ACVSKRWL+L+SS++ +EI  SK+     +A
Sbjct  59   KQPSIDVLPDECLFEIFRRIPGGKERSSCACVSKRWLLLLSSIKRAEICESKTL----VA  114

Query  518  DK--VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            D       SNDVEM  +DE+ ++E DGYL+RS+EGKKATD 
Sbjct  115  DNEVTVSVSNDVEMISSDENGKIESDGYLTRSLEGKKATDT  155



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 117/175 (67%), Gaps = 21/175 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            M TLVNY+GD+DF +G SL +   D  L+LSLG H DVYCP RKR+RIT PFV       
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF-----RSKS  496
            Q+K+ SIE LPDECLFEIFRRL GG+ERS  ACVSKRWL L+SS+R +E++     +   
Sbjct  61   QKKQSSIEVLPDECLFEIFRRLPGGQERSICACVSKRWLFLLSSIRRTEVYGIETTQPAK  120

Query  497  HQDLSIADKVNGASNDVEMSPAD---------EDLEVECDGYLSRSVEGKKATDV  634
            H+   ++DK +  S  V+  PA          EDLEVE +GY +RS+ GKKATD+
Sbjct  121  HEGELVSDKTDEFSKLVKEEPASVSSDVASVGEDLEVESEGYFTRSLGGKKATDI  175



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 112/162 (69%), Gaps = 18/162 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            MP LVNYSGDD+F +G SLC+   DLG   S+G H D Y P  KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q K+PSI+ LPDECLFEIFRR+ GG+ERS+ ACVSKRWL L+SS+R +E+          
Sbjct  61   QNKQPSIDVLPDECLFEIFRRIPGGKERSACACVSKRWLTLLSSIRRAELCN--------  112

Query  512  IADKVNGASNDVEM-SPADEDLEVECDGYLSRSVEGKKATDV  634
              +++    NDVEM S  DE+ E+E DGYL+RS+EGKKATD+
Sbjct  113  --ERIVPGCNDVEMASSCDENGEIESDGYLTRSLEGKKATDM  152



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 120/177 (68%), Gaps = 23/177 (13%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            MPTLVNY+GD+DF +G SL +   D  L+LSLG H DVYCP RKR+RI+ PFV       
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ---  502
            Q+K+ SIE LPDECLFEIFRRL GG+ERS+ A VSKRWL+L+SS+R +EI  SK+ Q   
Sbjct  61   QQKQSSIEVLPDECLFEIFRRLPGGQERSACASVSKRWLVLLSSIRRTEICTSKTTQSAK  120

Query  503  -----------DLSIADKVNG--ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                       + S  DK +    SN+  ++  D DLE+E +G+L+R +EGKKATD+
Sbjct  121  PEAGLVPDMGDESSKLDKEDSLPVSNENGVASVDVDLELESEGHLTRCLEGKKATDI  177



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 110/161 (68%), Gaps = 17/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            MP LVNYSGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  F        
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q KKPSI+ LPDECLFEIFRRL+GG+ERSS A VSK+WLML+SSVR  ++ ++       
Sbjct  61   QVKKPSIDVLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSVRKVDLCKNP------  114

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +AD     S+  EM+  DED E E DG+L+R +EGKKATD+
Sbjct  115  VADN----SDXTEMTNGDEDXEQENDGFLTRCLEGKKATDI  151



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 115/166 (69%), Gaps = 13/166 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ---  334
            M TLVNYSGDDDF  G S  +   D GL++S+G   DVYCP RKR+RIT P++       
Sbjct  3    MSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLE  62

Query  335  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
             EK+PSI+ LPDECLFEI RRL GG+ERSS A VSKRWLML+SS+R +EI   KS Q L+
Sbjct  63   LEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLN  122

Query  512  IADKVNG-----ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             + K++        +D+EM  A ED E+  DGYL+R +EGKKATD+
Sbjct  123  ESSKLDKELTIPVPDDIEMISA-EDRELGSDGYLTRCLEGKKATDI  167



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 113/163 (69%), Gaps = 13/163 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            MP LVNYSGDD+  +G S    S+DLG + S+G   DVY P+ KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q  +PSIE LPDECLFEIFRR+  G+ERSS ACVSK+WLML+SS+R +E   S +  +  
Sbjct  61   QNTRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCNSSAAAE--  118

Query  512  IADKVNGAS--NDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              +K  GA   NDVEM   +E+ EVE DGYL+RS+EGKKATDV
Sbjct  119  --EKGTGAPVRNDVEMVSCEENREVESDGYLTRSLEGKKATDV  159



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 110/161 (68%), Gaps = 17/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            MP LVNY GDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  F        
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q KKPSI+ LPDECLFEIFRRL+GG+ERSS A VSK+WLML+SS+R  ++ ++       
Sbjct  61   QVKKPSIDDLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSIRKVDLCKNP------  114

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +AD     S+D EM+  DED E E DG+L+R +EGKKATD+
Sbjct  115  VADN----SDDTEMTNGDEDREQENDGFLTRCLEGKKATDI  151



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 105/160 (66%), Gaps = 26/160 (16%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQ----E  337
            MP LVNY GDDDF +  S CS D GL+ S+G HA+VYCP RKR+RI GP  +       +
Sbjct  1    MPALVNYRGDDDFNSIRSSCSGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADD  60

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            K PSI+ LPDECLFEIF  LS GRERS++ACVSKRWL ++SSVR SE  R K        
Sbjct  61   KTPSIDTLPDECLFEIFTHLSNGRERSTSACVSKRWLSVLSSVRCSEFHRIK--------  112

Query  518  DKVNGASNDVEMSPADEDLEVE-CDGYLSRSVEGKKATDV  634
                        +P + D+E+E CDGYL+R VEGKKATD+
Sbjct  113  ------------TPQESDIEMESCDGYLTRCVEGKKATDI  140



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 111/162 (69%), Gaps = 15/162 (9%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHA--DVYCPSRKRARITGPFVVEV---  331
            MP LVNYSGDD+   G+S      DLG M +LG +    YC   KRARI  P + E    
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  332  -QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  508
             +++KP+IE LP+ECLFEIFRRLS G+ERSS +CVSKRWLMLMS +  +EI++S++  + 
Sbjct  61   RKDQKPAIEVLPNECLFEIFRRLSSGKERSSCSCVSKRWLMLMSRICKAEIYKSENLTEG  120

Query  509  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            S       AS DVEM+  DEDL +E DGYLSR +EGKKATDV
Sbjct  121  S-------ASCDVEMASVDEDLVIEDDGYLSRCLEGKKATDV  155



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 108/159 (68%), Gaps = 18/159 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEV----QEK  340
            MPTLVNYSGDD+F +G S     +       H D+YCP  KRARI+ PF +E     Q +
Sbjct  1    MPTLVNYSGDDEFYSGGSCSPYSIA-----SHVDLYCPPSKRARISAPFALEGSFFEQAE  55

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            KPSI+ LPDECLFEI R + GG+ER S+ACVSKRWLMLMSS+R +E+  SKS  +L    
Sbjct  56   KPSIDVLPDECLFEILRHVQGGKERISSACVSKRWLMLMSSIRRTEM-PSKSENELV---  111

Query  521  KVNGASNDVEMSPADEDLEVEC-DGYLSRSVEGKKATDV  634
                +S DVEM   D+D E+   DGYL+RS+EGKKATD+
Sbjct  112  ----SSGDVEMVAFDQDQELNGDDGYLTRSLEGKKATDI  146



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 105/161 (65%), Gaps = 17/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            MP LVN SGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  +        
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q K PSI  LPDECLFEIFRRL GG+ERSS A VSK+WLML+SS+R  ++ +S       
Sbjct  61   QVKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLLSSIRKVDLCKSP------  114

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + D     SND EM   DED E E DG+L+R +EGKKATD+
Sbjct  115  VVDN----SNDAEMITGDEDQEQENDGFLTRCLEGKKATDI  151



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 107/161 (66%), Gaps = 17/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFV---VEV-  331
            MP LVNYSGDDDF  G S    S DLG + S+    DVYCP RKR RI+ PF     EV 
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q K+PSI+ LPDECL EIF+R+SGG+ERSS ACVSK WLML++S+R  E   SK      
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSK-----V  115

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + + V   S DVEM  ++ED     DGYL+R +EGKKATD+
Sbjct  116  VKENVGSNSGDVEMILSEED-----DGYLTRCLEGKKATDM  151



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 12/163 (7%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVVEV----  331
            MPTLVNYSGDD+  +G S  +  +DLG + S+  + DVY P+ KRARI+ PF+ E     
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--SHQD  505
            Q K+PSIE LPDECLFEIFRR+  G+ERSS A VSK+WLML+SS+R SE   S   + ++
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCYSNPVAEEE  120

Query  506  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               A  V    NDVEM   +++ EVE DGYL+RS+EGKKATD+
Sbjct  121  KETAAPV---CNDVEMVSCEDNGEVESDGYLTRSLEGKKATDM  160



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 106/161 (66%), Gaps = 17/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFV---VEV-  331
            MP LVNYSGDDDF  G S    S DLG + S+    DVYCP RKR RI+ PF     EV 
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q K+PSI+ LPDECL EIF+R+SGG+ERSS ACVSK WLML++S+R  E   SK      
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSK-----V  115

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + +     S DVEM  ++ED     DGYL+R +EGKKATD+
Sbjct  116  VKENFGSNSGDVEMILSEED-----DGYLTRCLEGKKATDM  151



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 105/161 (65%), Gaps = 17/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  331
            MP LVNYSGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  +        
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q K PSI  LPDECLFEIFRRL GG+ERSS A VSK+WLML+SS+   ++ +      + 
Sbjct  61   QIKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLISSIWKVDLCK------IP  114

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + D     S+D EM   DED E E DG+L+R +EGKKATD+
Sbjct  115  VVDN----SDDAEMITGDEDQEQENDGFLTRCLEGKKATDI  151



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 113/163 (69%), Gaps = 12/163 (7%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVVEV----  331
            MPTLVNYSGDD+  +G S  +  +DLG + S+  + DVY P+ KRARI+ PF+ E     
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--SHQD  505
            Q  +PSIE LPDECLFEIFRR+  G+ERSS A VSK+WLML+SS+R SE   S   + ++
Sbjct  61   QNMRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCNSNPVAEEE  120

Query  506  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               A  V    NDVEM   +++ EVE DGYL+RS+EGKKATD+
Sbjct  121  KETAAPV---CNDVEMVSCEDNGEVESDGYLTRSLEGKKATDM  160



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 113/164 (69%), Gaps = 17/164 (10%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  334
            M  L ++SG DDF  G S+ +   +  L LSLG H DVY PSRKR+RI+ PFV      +
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  335  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            +KKPSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL ++S++R++EI  +K+ Q L +
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSNEISDNKTTQALDL  120

Query  515  ----ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                 DK  G  ++VE    DED+     GYLSRS+EGKKATDV
Sbjct  121  NYESTDKKGGDVSEVE----DEDVA---GGYLSRSLEGKKATDV  157



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 111/164 (68%), Gaps = 17/164 (10%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  334
            M  L ++SG DDF  G S+     +  L LSLG H DVY PSRKR+RI+ PFV      +
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  335  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            +KKPSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL ++S++R+ EI  +K+ Q L +
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSDEISDNKTTQALDL  120

Query  515  ----ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                 DK  G  +DVE    DED+     GYLSRS+EGKKATDV
Sbjct  121  NYESTDKKGGDVSDVE----DEDVA---GGYLSRSLEGKKATDV  157



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 109/161 (68%), Gaps = 16/161 (10%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            M  L  ++GDDDF  G  + +   +  L+LSLG H DVY PSRKR+RI+ PFV+      
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL L+S++   E+   K+ Q L+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLALLSNMSRDELCSKKTTQLLN  120

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             + + NG +         EDLE+E DGYLSRS+EGKKATD+
Sbjct  121  ESAEKNGEA---------EDLEIEDDGYLSRSLEGKKATDI  152



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 104/161 (65%), Gaps = 7/161 (4%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLGHA-DVYCPSRKRARITGPFVV---EVQ  334
            MPTLVNY G+D F  G SLC  S DL  + S+G + D+Y P  KRARI GP+ V   E +
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  60

Query  335  EKKPS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
             ++PS I  LPDECLFEIFRRL GGRERS+ ACVSK WL L+SS+R +EI          
Sbjct  61   GERPSSIGELPDECLFEIFRRLPGGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKE  120

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              +    +S DV+M   D    +E DGYL+R +EGKKATDV
Sbjct  121  DEEMKTSSSGDVQMVSCDVSGGLEEDGYLTRCLEGKKATDV  161



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 102/161 (63%), Gaps = 31/161 (19%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ---  334
            M TLVNYSGDDDF  G S  +   D GL++S+G   DVYCP RKR+RIT P++       
Sbjct  3    MSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLE  62

Query  335  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
             EK+PSI+ LPDECLFEI RRL GG+ERSS A VSKRWLML+SS+R +EI   KS Q L 
Sbjct  63   LEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSL-  121

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                     ND              DGYL+R +EGKKATD+
Sbjct  122  ---------ND--------------DGYLTRCLEGKKATDI  139



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 103/158 (65%), Gaps = 17/158 (11%)
 Frame = +2

Query  182  LVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QEK  340
             +  SGDDDF +G S    S DLG + S+    DVYCP RKRARI  PF+       Q K
Sbjct  51   FIGISGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFGETEFEQNK  110

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            +PSI+ LP+ECLFEIF+RL GGRERSS ACVSK WLML++S+R SE   SK      + +
Sbjct  111  QPSIDVLPEECLFEIFKRLPGGRERSSCACVSKHWLMLLTSIRKSEYESSK-----VVKE  165

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              +  S DVEM  +DED     DGYL+R +EGKKATD+
Sbjct  166  NTDLVSEDVEMISSDED-----DGYLTRCLEGKKATDM  198



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 103/161 (64%), Gaps = 32/161 (20%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            MP LVNYSGDD+  +G SL   S+DLG + S+G   DVY P+ KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q K+PSIE LPDECLFEIFRR+  G+ERSS ACVSK+WLML+SS+R +E   SK+     
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCSSKNR----  116

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                                 EVE DGYL+RS+EGKKATD+
Sbjct  117  ---------------------EVESDGYLTRSLEGKKATDM  136



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 99/158 (63%), Gaps = 4/158 (3%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEKK  343
            MPTLVNY G+D F  G SLC++ + L       D+Y P  KRARI GP+ V   E + + 
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEGEH  60

Query  344  PS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            PS I  LPDECLFEIFRRL  GRERS+ ACVSK WL L+SS+R +EI            +
Sbjct  61   PSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKEDEE  120

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                +S DVEM  +D    +E DGYL+R +EGKKATDV
Sbjct  121  MKTSSSVDVEMVSSDVSGGLEGDGYLTRCLEGKKATDV  158



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 99/158 (63%), Gaps = 4/158 (3%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEKK  343
            MPTLVNY G+D F  G SLC++ + L       D+Y P  KRARI GP+ V   E + + 
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEGEH  60

Query  344  PS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            PS I  LPDECLFEIFRRL  GRERS+ ACVSK WL L+SS+R +EI            +
Sbjct  61   PSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKEDEE  120

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                +S DVEM  +D    +E DGYL+R +EGKKATDV
Sbjct  121  MKTSSSVDVEMVSSDVSGGLEGDGYLTRCLEGKKATDV  158



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 103/161 (64%), Gaps = 25/161 (16%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            MP LVNY GDDDF +G S    S DLG + S+    DVY P RKRARIT PFVV      
Sbjct  1    MPALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q K+ SI+ LPDECLFEIF+RL GGRERSS ACVSK WLML+ S+R  E   SK+ ++  
Sbjct  61   QSKQASIDVLPDECLFEIFKRLPGGRERSSCACVSKHWLMLLISIRKGEYESSKAVKE--  118

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                    + D   S +DED     DGYL+R +EGKKATD+
Sbjct  119  --------NTD---SVSDED-----DGYLTRCLEGKKATDM  143



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 13/161 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ---  334
            M  L  ++GDDDF  G S+ +   +LGL LSLGH  DVY PSRKR+RI  PFV   +   
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  335  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
             +K+ SIE LPDECLFEIFRRL G  ERS+ A VSKRWL L+S++   E+   K+ Q L 
Sbjct  61   KKKQASIEVLPDECLFEIFRRLPG-EERSACAGVSKRWLGLLSNLSRDELCSKKTTQLLD  119

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             + K N     VE+    ED E+E DGYLSRS+EGKKATD+
Sbjct  120  ESAKKN-----VEVKSEAEDQEIEGDGYLSRSLEGKKATDI  155



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 109/171 (64%), Gaps = 17/171 (10%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            M  L +Y+G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+++ SI+ LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +K+   L 
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKTTGFLK  120

Query  512  IADKVNGASNDV----------EMSPADEDLEVECDGYLSRSVEGKKATDV  634
              + +   + D           E++P   DLE+E DGYLSR +EGKKATDV
Sbjct  121  PKETLISRNTDESSEAKKKGGDEVTPEAVDLEIESDGYLSRCLEGKKATDV  171



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 122/221 (55%), Gaps = 37/221 (17%)
 Frame = +2

Query  2    FSPFFPYSKWGFLL----EKSGLWIWNANLGRNPNLGCVDFAAKSNLF--CSLFGGFF*K  163
            F  FF  ++ G LL      S + +++  L R    GC  F+    LF  CS        
Sbjct  40   FFLFFCPTRLGLLLLHAFNLSSVLVFHLFLLRLVFFGCCFFSPARVLFSDCSPSA-----  94

Query  164  ETAMPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ  334
               MP LVNY GDD F  GS              H D YCP RKRAR++  F     E +
Sbjct  95   SATMPALVNYRGDDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFE  140

Query  335  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
             E +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +   
Sbjct  141  FENQPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK--  198

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              + V   S+ VEM   DED     DGYL+R ++GKKATD+
Sbjct  199  --EVVASVSDHVEMVSCDED----GDGYLTRCLDGKKATDL  233



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 114/193 (59%), Gaps = 24/193 (12%)
 Frame = +2

Query  110  FAAKSNLFCSLFGGFF*KETAMPTLVNY------------SGDDDFLAGSSLCS--ADLG  247
            F    +LF +LFGGF   E     L  +             G DDF  G S+     +  
Sbjct  15   FFLVGSLFFALFGGFLGGEQCRFDLPGFFELYLCQSSFLSVGSDDFCPGGSIYPNPKESS  74

Query  248  LMLSLGH-ADVYCPSRKRARITGPFVV---EVQEKKPSIEALPDECLFEIFRRLSGGRER  415
              LSLGH  DVY P RK++RI+ PFV      ++KKPSI+ LPDECLFEIFRRL GG+ER
Sbjct  75   HFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKKPSIDVLPDECLFEIFRRLPGGQER  134

Query  416  SSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGY  595
            S+ ACVSKRWL L+S++R  EI    + Q L++ D+       V     DED +VE DGY
Sbjct  135  SACACVSKRWLTLVSNIRKDEI----TTQALNLKDESTDKKGGV--VSEDEDQDVEGDGY  188

Query  596  LSRSVEGKKATDV  634
            LSRS+EGKKATDV
Sbjct  189  LSRSLEGKKATDV  201



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 102/160 (64%), Gaps = 22/160 (14%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLG--LMLSLGHADVYCPSRKRARITGPF----VVEVQ  334
            MP LVN SGDD+   G S+   DLG  L     + DVYC   KRARI+ PF    V   Q
Sbjct  1    MPALVNSSGDDEMYPGGSM---DLGGCLYTISSNVDVYCSPTKRARISAPFTFGAVEHKQ  57

Query  335  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            + KPS+E LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++  SEI R+ S  + S+
Sbjct  58   DHKPSVEILPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTISKSEIERTNSSVEESV  117

Query  515  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +   N           DED  VE DGYLSR +EG+KATDV
Sbjct  118  SSDEN-----------DED--VEGDGYLSRCLEGRKATDV  144



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 11/142 (8%)
 Frame = +2

Query  239  DLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ----EKKPSIEALPDECLFEIFRRLSG  403
            D GL++S+G   DVYCP RKR+RIT P++        EK+PSI+ LPDECLFEI RRL G
Sbjct  2    DSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLPG  61

Query  404  GRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG-----ASNDVEMSPADE  568
            G+ERSS A VSKRWLML+SS+R +EI   KS Q L+ + K++        +D+EM  A E
Sbjct  62   GQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLNESSKLDKELTIPVPDDIEMISA-E  120

Query  569  DLEVECDGYLSRSVEGKKATDV  634
            D E+  DGYL+R +EGKKATD+
Sbjct  121  DRELGSDGYLTRCLEGKKATDI  142



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 103/162 (64%), Gaps = 15/162 (9%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHA--DVYCPSRKRARITG----PFVVE  328
            MPTLVNYSGDD+   G S C    DLG + + G    + Y    KRARI       F+  
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPSKRARINALDAFEFLGR  60

Query  329  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  508
             Q++KP+I+ LPDECLFE+FR LS G+ERSS A VSKRWLMLMSS+  +EI +S    + 
Sbjct  61   EQDQKPTIDVLPDECLFEVFRWLSSGKERSSCAYVSKRWLMLMSSICKAEIHKSDKMIEG  120

Query  509  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            S       AS  VEM+  DED  +E +GYL+R +EGKKAT+V
Sbjct  121  S-------ASGYVEMASVDEDQGIEDNGYLTRCLEGKKATNV  155



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 101/161 (63%), Gaps = 24/161 (15%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQ  334
            M  L  +SG +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  335  EK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
             K   SIE LPDECLFEIFRRLSGG+ERS+ A VSKRWLML+S++ + E+          
Sbjct  61   SKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHEL----------  110

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                    S DV  S   ED+E+E DGYLSRS+EGKKATD+
Sbjct  111  -------KSEDVVASKEVEDIEIESDGYLSRSLEGKKATDL  144



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 100/161 (62%), Gaps = 29/161 (18%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            M  L +Y+G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+++ SI+ LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI          
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEIC---------  111

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                         M+P   DLE+E DGYLSR +EGKKATDV
Sbjct  112  -------------MTPEAVDLEIESDGYLSRCLEGKKATDV  139



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 99/158 (63%), Gaps = 26/158 (16%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EK  340
            MP LVNY GDD F  GS              H D YCP RKRAR++  F     E + E 
Sbjct  1    MPALVNYRGDDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFEFEN  46

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     +
Sbjct  47   QPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----E  102

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             V   S+ VEM   DED     DGYL+R ++GKKATD+
Sbjct  103  VVASVSDHVEMVSCDED----GDGYLTRCLDGKKATDL  136



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 109/161 (68%), Gaps = 24/161 (15%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSA---DLGLMLSLGHADVYCPSRKRARITGPFVVE----V  331
            MPTLVNYSGDD+F +G S  S+   DLG +LS+G ++ Y PS KRARI+  F +      
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPMDLGCLLSVG-SNAYPPS-KRARISSQFDIRGSSFE  58

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            QEKK SIE LP+ECLFEIFRRL GG+ER + A VSK+WLML+SS+R SE           
Sbjct  59   QEKKASIEVLPEECLFEIFRRLHGGKERITCASVSKKWLMLLSSIRPSE-----------  107

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               K    S+D EM+  DED + E DG+L+RS+EGKKATDV
Sbjct  108  ---KEIPKSDDTEMTTGDED-QKETDGFLTRSLEGKKATDV  144



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 12/158 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  340
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +V+G           ED EVE  GYLSRS+EGKKATDV
Sbjct  121  EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDV  150



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 17/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  334
            M  L+ ++G+DDF  G S+ +   +  L LS G HADV+   RKR+RI+GPFV      +
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  335  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            +KKP SI+ LPDECLFEIF+RL GG ERS+ ACVSKRWL L+S++   E   + ++  L+
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKRWLTLLSNIHRDEFCSNTTNLLLN  120

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              D+V G          ++D EVE  GYLSRS+EGKKATDV
Sbjct  121  PQDEVTG----------NKDQEVESCGYLSRSLEGKKATDV  151



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 12/158 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  340
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +V+G           ED EVE  GYLSRS+EGKKATDV
Sbjct  121  EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDV  150



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 101/158 (64%), Gaps = 12/158 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  340
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +V+G           ED EVE  GYLSRS+EGKKATDV
Sbjct  121  EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDV  150



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 103/166 (62%), Gaps = 12/166 (7%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGL---MLSLGHADVYCPSRKRARITGPFVVEV----  331
            MP LVNY GDD++  G S  S+ + L   + +  H D+Y    KRARI  P V       
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            QE  PSIEALPDECLFEIFR L   RERSS A VSKRWLML+S++R +EI +S+S     
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRSTCISQ  120

Query  512  IADKVN-----GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + +  N       S+++ +   DED E E +G+L+R +EGKKATDV
Sbjct  121  MVESSNVEQQKTESDEISVVNCDEDQEDESNGFLTRCLEGKKATDV  166



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 95/136 (70%), Gaps = 7/136 (5%)
 Frame = +2

Query  239  DLGLMLSLGHADVYCPSRKRARITGPFVVEV----QEKKPSIEALPDECLFEIFRRLSGG  406
            DLG +LS+G   VY P  KRAR    F  E     Q +KPSIE LPDECLFEIFRRL GG
Sbjct  2    DLGCLLSIGS--VYYPPSKRARKDSQFAFEGSDFEQVRKPSIEVLPDECLFEIFRRLDGG  59

Query  407  RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVEC  586
            +ERSS ACVSK+WLML+SS+R  ++ +S +   +    K++  S+D EM+  +ED E+E 
Sbjct  60   KERSSCACVSKKWLMLLSSIRKVDLCKSPAADKVIQPLKLDN-SDDTEMTTGEEDQELEN  118

Query  587  DGYLSRSVEGKKATDV  634
            DGYL+R +EGKKATD+
Sbjct  119  DGYLTRCLEGKKATDI  134



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE---VQE  337
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      ++
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            K+ SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     
Sbjct  61   KEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQSFKSQ  120

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            D+V+G           ED EVE  GYLSRS+EGKKATDV
Sbjct  121  DEVSGNK--------AEDQEVEGCGYLSRSLEGKKATDV  151



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 99/159 (62%), Gaps = 20/159 (13%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSL--GHADVYCPSRKRAR-ITGPFVVEVQE  337
            MP LVNYSGDD+   G S C +  +LG + S    + D+Y P  KR+R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSRSILEAIEGEQHY  60

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            ++P IE LPDECLFEIFRRL  G+ERS  ACVSKRWLMLMSS+   EI R+ S  +    
Sbjct  61   QEPGIEVLPDECLFEIFRRLPSGKERSLCACVSKRWLMLMSSICKDEIERTTSAAE----  116

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                       +SP DE+ ++ECDGYL+R ++GKKATDV
Sbjct  117  ----------TVSP-DENQDIECDGYLTRCLDGKKATDV  144



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 103/173 (60%), Gaps = 19/173 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEK  340
            M  + ++ GD DF  G  L     + GL L LG H DVY P RKR+RI+ PFVV  V ++
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVVSGVAKQ  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF------------  484
            +PSIE LPDECLFE+FRRL GG ERS+ ACVSKRWLML+SS+   EI             
Sbjct  61   QPSIEILPDECLFEVFRRLPGGHERSACACVSKRWLMLLSSIYRDEICTTVTTHFVEPEN  120

Query  485  RSKSHQDLSIADKVNGASNDVE--MSPADEDL-EVECDGYLSRSVEGKKATDV  634
            RS+S +    A        D    + P DE+  E +  GYLSR +EGKKA+DV
Sbjct  121  RSESQKADEFAQPKEKGEFDCPNGIKPEDEEFQEADSHGYLSRCLEGKKASDV  173



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 104/163 (64%), Gaps = 17/163 (10%)
 Frame = +2

Query  197  GDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QEKKPSIE  355
            G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      Q+++ SI+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  356  ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGA  535
             LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +K+   L   + +   
Sbjct  169  VLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKTTGFLKPKETLISR  228

Query  536  SNDV----------EMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + D           E++P   DLE+E DGYLSR +EGKKATDV
Sbjct  229  NTDESSEAKKKGGDEVTPEAVDLEIESDGYLSRCLEGKKATDV  271



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 104/162 (64%), Gaps = 14/162 (9%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  340
            M  L  +SG DDF  G S+  +     +    + DVY P  KR R++ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFFYPNQDVYFPPCKRCRVSSPFVFAGGKFEQK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ--DLSI  514
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +K+ Q  DL  
Sbjct  61   KPSIEILPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEIDDNKTTQASDLEY  120

Query  515  --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               DK  G S++      D D +VE DGYLSRS++GKKATDV
Sbjct  121  ESTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDV  156



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 102/165 (62%), Gaps = 14/165 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGL---MLSLGHADVYCPSRKRARITGPFVVEV----  331
            MP LVNY GDD++  G S  S+ + L   + +  H D+Y    KRARI  P V       
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            QE  PSIEALPDECLFEIFR L   RERSS A VSKRWLML+S++R +EI +S+S     
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRST---C  117

Query  512  IADKVNGAS----NDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            I+  V  ++      + +   DED E E +G+L+R +EGKKATDV
Sbjct  118  ISQTVECSNVEQQKTISVVNCDEDQEDESNGFLTRCLEGKKATDV  162



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 104/161 (65%), Gaps = 24/161 (15%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQ  334
            M  L  +SG +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  335  EK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
             K   SIE LPDECLFEIFRRLS G+ERS+ A VSKRWLML+S++ + E+   KS  ++ 
Sbjct  61   SKANVSIEILPDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHEL---KSEDEV-  116

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                   AS +V      ED+E+E DGYLSRS+EGKKATD+
Sbjct  117  -------ASKEV------EDIEIESDGYLSRSLEGKKATDL  144



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 103/168 (61%), Gaps = 16/168 (10%)
 Frame = +2

Query  152  FF*KETAMPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV  322
            FF +     +LV+   +DDF  G  + S   D  L LSLG H DVY PSRKR+RI+ PFV
Sbjct  43   FFKQYPCRRSLVSPVSNDDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFV  102

Query  323  VE----VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS  490
                   ++KK SI+ LPDECLFEIFRRL    ERS++ACVSKRWLML+S++R  E+   
Sbjct  103  FSEERLQKKKKASIDVLPDECLFEIFRRLPA-EERSASACVSKRWLMLLSNIRQEELCSE  161

Query  491  KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            K+   L   D +             ED E+E  GYLSRS+EGKKATDV
Sbjct  162  KTSASLKSEDDI--------AEEKGEDQEIETQGYLSRSLEGKKATDV  201



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 102/158 (65%), Gaps = 12/158 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ--EK  340
            M  L+ +SG DDF  G    +  + GL LSLGH ADV  P RKR+RI+ PFV      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFEK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            + SI+ LPDECLFEIF+R+ GG ERS+ ACVS+RWL ++S++   E   + ++      D
Sbjct  61   EVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSNPTNLSFKSQD  120

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +V+G ++        ED EVE  GYLSRS+EGKKATDV
Sbjct  121  EVSGNNS--------EDQEVENCGYLSRSLEGKKATDV  150



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 102/158 (65%), Gaps = 12/158 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ--EK  340
            M  L+ +SG DDF  G    +  + GL LSLGH ADV  P RKR+RI+ PFV      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFEK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            + SI+ LPDECLFEIF+R+ GG ERS+ ACVS+RWL ++S++   E   + ++      D
Sbjct  61   EVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSNPTNLSFKSQD  120

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +V+G ++        ED EVE  GYLSRS+EGKKATDV
Sbjct  121  EVSGNNS--------EDQEVENCGYLSRSLEGKKATDV  150



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 103/162 (64%), Gaps = 14/162 (9%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  340
            M  L  +SG DDF  G S+  +     +    + DVY P  KR RI+ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQDVYFPPCKRYRISAPFVFAGGKFEQK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI--  514
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +++ Q   +  
Sbjct  61   KPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQASDLEH  120

Query  515  --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               DK  G S++      D D +VE DGYLSRS++GKKATD+
Sbjct  121  ENTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDI  156



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 103/162 (64%), Gaps = 14/162 (9%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  340
            M  L  +SG DDF  G S+  +     +    + DVY P  KR RI+ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQDVYFPPCKRYRISAPFVFAGGKFEQK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI--  514
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +++ Q   +  
Sbjct  61   KPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQASDLEH  120

Query  515  --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               DK  G S++      D D +VE DGYLSRS++GKKATD+
Sbjct  121  ENTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDI  156



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 105/161 (65%), Gaps = 11/161 (7%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  331
            M  +  ++GD DF  G SL     +  L LSLG H D+Y P+ KR+RI+ PFV       
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+KK SI+ LPDECLFEIFRRL  G+ERS+ ACVSKRWLML+S++R  E+  +K+   L 
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKTTLPLK  120

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              D  N   N+ E+S  DE   ++ DGYL+R +EGKKATDV
Sbjct  121  RED--NPGENE-EIS-GDEPPAIKDDGYLTRVLEGKKATDV  157



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   127 bits (319),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSA-DLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  340
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKAT  628
            +V+G           ED EVE  GYLSRS+E K+  
Sbjct  121  EVSGNK--------AEDQEVEGCGYLSRSLERKEGN  148



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 105/161 (65%), Gaps = 11/161 (7%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  331
            M  +  ++GD DF  G SL     +  L LSLG H D+Y P+ KR+RI+ PFV       
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+KK SI+ LPDECLFEIFRRL  G+ERS+ ACVSKRWLML+S++R  E+  +K+   L 
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKTTLPLK  120

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              D  N   N+ E+S  DE   ++ DGYL+R +EGKKATDV
Sbjct  121  RED--NPGENE-EIS-GDEPPAIKDDGYLTRVLEGKKATDV  157



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 100/159 (63%), Gaps = 17/159 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  337
            MP LVNYSGDDDF    +  S +LG + S+   ADVY P  KR RI+ PF+       Q 
Sbjct  1    MPALVNYSGDDDFFIRKN--SIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQN  58

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            K+PSI  LP EC+FEIF+RL  GRERS  ACVSKRWL L+SS+R  E +RS +     + 
Sbjct  59   KQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGE-YRSSN----VVK  113

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + ++  S  +E   ++E+      GYL+R +EGKKATDV
Sbjct  114  ENIDSVSYAIETISSNEN-----GGYLTRCLEGKKATDV  147



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 97/160 (61%), Gaps = 22/160 (14%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVV---EVQ  334
            M  L ++SG D+F  G S+     +  L  SLGH  DVY P  KR+RI+ P V     V+
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERVE  60

Query  335  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            +K PSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL L+S++   EI     +    +
Sbjct  61   KKNPSIEILPDECLFEIFRRLPGGQERSSCACVSKRWLTLVSNIHRDEI---NDNNKGGV  117

Query  515  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              KV             ED +VE DGYLSR +EGKKATDV
Sbjct  118  VSKV-------------EDQDVEGDGYLSRVLEGKKATDV  144



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 98/158 (62%), Gaps = 27/158 (17%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EK  340
            MP LVNY  DD F  GS              H D YCP RKRAR++  F     E + E 
Sbjct  1    MPALVNYR-DDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFEFEN  45

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     +
Sbjct  46   QPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----E  101

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             V   S+ VEM   DED     DGYL+R ++GKKATD+
Sbjct  102  VVASVSDHVEMVSCDED----GDGYLTRCLDGKKATDL  135



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 98/159 (62%), Gaps = 17/159 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  337
            MP LVNYSGDD+F    +  S +LG + S+   ADVY P  KR RI+ PF+       Q 
Sbjct  1    MPALVNYSGDDEFFIRKN--SIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQN  58

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            K+PSI  LP EC+FEIF+RL  GRERS  ACVSKRWL L+SS+R  E   SK      + 
Sbjct  59   KQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGEYGSSK-----VVK  113

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + ++  S  +E   ++E+      GYL+R +EGKKATDV
Sbjct  114  ENIDSVSYAIETISSNEN-----GGYLTRCLEGKKATDV  147



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 102/161 (63%), Gaps = 17/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  334
            M  L+   G+DDF  G S+ +   +  L LSLG HADV+   RKR+RI+G FV      +
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  335  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            +KKP SI+ LPDECLFEIF+RL GG ERS+ ACVSK WL L+S++   E   + +   L+
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKHWLTLLSNIHRDEFCSNTNDLSLN  120

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              D+V G          ++D EVE  GYLSRS+EGKKATDV
Sbjct  121  PQDEVTG----------NKDQEVESCGYLSRSLEGKKATDV  151



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 96/151 (64%), Gaps = 24/151 (16%)
 Frame = +2

Query  203  DDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQEK-KPSIEAL  361
            +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+ K   SIE L
Sbjct  61   EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEIL  120

Query  362  PDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASN  541
            PDECLFEIFRRLSGG+ERS+ A VSKRWLML+S++ + E+                  S 
Sbjct  121  PDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHEL-----------------KSE  163

Query  542  DVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            DV  S   ED+E+E DGYLSRS+EGKKATD+
Sbjct  164  DVVASKEVEDIEIESDGYLSRSLEGKKATDL  194



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 100/161 (62%), Gaps = 18/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  331
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E           
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDE-----------  109

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +  +   A  + E+    ED E+E DG LSRS+EGKKATD+
Sbjct  110  LCSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDI  150



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 100/161 (62%), Gaps = 18/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  331
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E           
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDE-----------  109

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +  +   A  + E+    ED E+E DG LSRS+EGKKATD+
Sbjct  110  LCSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDI  150



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 98/160 (61%), Gaps = 17/160 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  334
            M  L   SG DDF  G  +     + GL+L LG + D+Y  +RKR+RI+ PFV      +
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERFE  60

Query  335  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            +K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL L+S++   EI   K       
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACACVSKRWLSLLSNIHRDEIRSLKPE-----  115

Query  515  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                  A   VE+    ED +VE DGYLSRS+EGKKATD+
Sbjct  116  ------AEKKVELVSDAEDPDVERDGYLSRSLEGKKATDI  149



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 97/159 (61%), Gaps = 20/159 (13%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLG-LMLSLG-HADVYCPSRKRAR-ITGPFVVEVQE  337
            MP LVNYSGDD+   G S C    +LG L  ++G + DVY P  KR R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPRSIFEAIEREQYY  60

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            ++P IE LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++   EI R+ S       
Sbjct  61   QEPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEIERATSVD-----  115

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                      E   +DE+ ++E DGYL+R ++GKKATDV
Sbjct  116  ----------ETVSSDENQDIEDDGYLTRCLDGKKATDV  144



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 100/161 (62%), Gaps = 18/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E           
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDE-----------  109

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +  +   A  + E+    ED E+E DG LSRS+EGKKATD+
Sbjct  110  LCSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDI  150



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 98/153 (64%), Gaps = 13/153 (8%)
 Frame = +2

Query  191  YSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE---VQEKKPSIE  355
             +G DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      ++K+ SI 
Sbjct  11   LAGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKKEVSIN  70

Query  356  ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGA  535
             LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D+V+G 
Sbjct  71   VLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQSFKSQDEVSGN  130

Query  536  SNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                      ED EVE  GYLSRS+EGKKATDV
Sbjct  131  K--------AEDQEVEGCGYLSRSLEGKKATDV  155



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 99/161 (61%), Gaps = 18/161 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  331
            M  +  ++G++DF  G  + +   +  L LS+G   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+K+ SIE LPDECLFEIFRRL GG ER + ACVSKRWL L+S++   E           
Sbjct  61   QKKQASIEFLPDECLFEIFRRLPGGDERGACACVSKRWLSLLSNICKDE-----------  109

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +  +   A  + ++    ED E+E DGYLSRS+EGKKATD+
Sbjct  110  LCSQNESAKKNTQVKSEVEDEEIEGDGYLSRSLEGKKATDI  150



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 105/167 (63%), Gaps = 14/167 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV-------  322
            MP LVNY G DD  +   L S   D   +LSL  + DV+CP RKR+R+T PF+       
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  323  -VEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  496
              E Q+++P SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+SS+R SE+   K+
Sbjct  61   GAEKQKQQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEMAAYKN  120

Query  497  HQDLSIADKVNGASNDVEMS-PADEDLEVECDGYLSRSVEGKKATDV  634
            +   S  + +     D+  +   DE+ E E  GYL+R ++ K ATDV
Sbjct  121  NGT-SGCETLKKPLPDLNSAMSTDEEEEFESTGYLTRKLKAKDATDV  166



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 99/161 (61%), Gaps = 20/161 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            M  ++ +SG DDF  G SL +   +    L LG   DVY P RKR+R+  PFV +     
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q++K SIE+LPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+   EI   K+    S
Sbjct  61   QKQKTSIESLPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKDEICVIKN----S  116

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             A+ +    +DVE            +GYLSRS+EGKKATDV
Sbjct  117  SAENIKKDGDDVEFGG---------EGYLSRSLEGKKATDV  148



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 104/175 (59%), Gaps = 31/175 (18%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARITGPFVVEVQEK-  340
            MP LV Y G DD      L S  +   L L  A   DV+CP RKR+R+T PFV +  EK 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  341  --KP-----SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  499
              KP     SI+ LPDECLFEI RRL G RERS++ACVSKRWLML+SS+R SEI      
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRRLPGSRERSNSACVSKRWLMLLSSIRASEI------  114

Query  500  QDLSIADKVNGASN-DVEMSP---------ADEDLEVECDGYLSRSVEGKKATDV  634
                 A+K NG+SN D+  +P          DE+ E E  GYL+R ++ K+ATDV
Sbjct  115  ----AANKKNGSSNGDLLKNPLPDLNDAVSTDEEEEPEKAGYLTRYLKAKEATDV  165



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 95/148 (64%), Gaps = 12/148 (8%)
 Frame = +2

Query  203  DDFLAGSSLCSA-DLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEKKPSIEALPDE  370
            DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK+ SI  LPDE
Sbjct  59   DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKEVSINVLPDE  118

Query  371  CLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVE  550
            CLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D+V+G      
Sbjct  119  CLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQDEVSGNK----  174

Query  551  MSPADEDLEVECDGYLSRSVEGKKATDV  634
                 ED EVE  GYLSRS+EGKKATDV
Sbjct  175  ----AEDQEVEGCGYLSRSLEGKKATDV  198



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 102/164 (62%), Gaps = 10/164 (6%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-  340
            M  +V++SGD+ F   + L     +    LSLG H +VY   RKR+RIT PF+V  + K 
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSGEPKQ  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL-SIA  517
            KPSIE LPDECLFE+FRRL GG+ERS+ A VSKRWLML+SS+   EI  +K    + S  
Sbjct  61   KPSIEILPDECLFEVFRRLEGGQERSACASVSKRWLMLLSSICKDEICTTKEEPKIGSDL  120

Query  518  DKVNGASNDVEMSPADEDLEVECD-----GYLSRSVEGKKATDV  634
             K + ++   E      DL  EC      GYLSRS+EGKKA+DV
Sbjct  121  PKADDSTKKAEEKGEFIDLTEECQETDSHGYLSRSLEGKKASDV  164



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 97/159 (61%), Gaps = 20/159 (13%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLG-LMLSLG-HADVYCPSRKRAR-ITGPFVVEVQE  337
            MP LVNYSGDD+   G S C    +LG L  ++G + D+Y P  KR R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPRSIFEAIEREQYY  60

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            + P IE LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++                 
Sbjct  61   QDPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTI---------------CK  105

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            D++ G ++  E   +DE+ +++ DGYL+R ++GKKATDV
Sbjct  106  DEIEGTTSVAETVSSDENQDIDDDGYLTRCLDGKKATDV  144



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 103/161 (64%), Gaps = 20/161 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            M  ++ ++G +DF +G S+  +  +  L LSLG H DVY P  KR+RI+ PFV       
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+++ +IE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++  +E    KS     
Sbjct  61   QKRQDTIEVLPDECLFEIFRRLPGGQERSACACVSKRWLNLLSNICPNERSSGKSQ----  116

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                     N+++ +   E++  E DG+LSRS+EGKKATD+
Sbjct  117  ---------NNLDPTCGGEEVSSEDDGFLSRSLEGKKATDI  148



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 108/174 (62%), Gaps = 21/174 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLGH-ADVYCPSRKRARITGPFV-VEVQEK  340
            M  + N+SGD+ F  G +L  +  +  L LSLGH  DVY P  KR+RIT P +  E Q+K
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFTEKQKK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK-----SHQD  505
             PSI+ LPDECLFE+FRR+S G+ERS+ ACVSKRWLML+SS+R  E   SK       ++
Sbjct  61   LPSIDVLPDECLFEVFRRVSDGKERSACACVSKRWLMLLSSIRGDETVVSKPSPSSETEE  120

Query  506  LSI-------ADKVNGAS----NDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             SI        D +        N VE++   E  ++E +G+LSR ++GKKATDV
Sbjct  121  RSIRSAPIKPVDCIKKGEVVEPNGVEVADV-ETQDIEGEGHLSRCLDGKKATDV  173



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 98/163 (60%), Gaps = 24/163 (15%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  331
            M  ++ +SG DDF    S+ +   +    LSLG   DVY P RKR+R+  PFV +     
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q++K SIEALPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+  SEI  +K      
Sbjct  61   QKQKTSIEALPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKSEISVNK------  114

Query  512  IADKVNGASNDVEMSPADE--DLEVECDGYLSRSVEGKKATDV  634
                     N    +P  E  D+E    GYLSRS+EGKKATDV
Sbjct  115  ---------NTTVENPEKEGDDVEFGGKGYLSRSLEGKKATDV  148



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 106/174 (61%), Gaps = 21/174 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLGH-ADVYCPSRKRARITGPFV-VEVQEK  340
            M  + N+SGDD F  G +L  +  +  L LSLGH  DVY P  KR+R+T P +  E Q+K
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFTEKQKK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK---------  493
             PSI+ LPDECLFE+ RR+S G+ERS+ ACVSKRWLML+SS+R  E   SK         
Sbjct  61   LPSIDVLPDECLFEVLRRVSDGKERSACACVSKRWLMLLSSIRGYETVVSKPSPSSETEE  120

Query  494  -SHQDLSI--ADKVNGAS----NDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S Q   +   D +        N VE++   E  ++E +G+LSR ++GKKATDV
Sbjct  121  RSIQSAPVKPVDSIKKGEVVDPNGVEVADI-ETQDIEGEGHLSRCLDGKKATDV  173



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 99/151 (66%), Gaps = 24/151 (16%)
 Frame = +2

Query  203  DDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQEK-KPSIEAL  361
            +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+ K   SIE L
Sbjct  2    EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEIL  61

Query  362  PDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASN  541
            PDECLFEIFRRLS G+ERS+ A VSKRWLML+S++ + E+   KS  ++        AS 
Sbjct  62   PDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHEL---KSEDEV--------ASK  110

Query  542  DVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +V      ED+E+E DGYLSRS+EGKKATD+
Sbjct  111  EV------EDIEIESDGYLSRSLEGKKATDL  135



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 95/148 (64%), Gaps = 12/148 (8%)
 Frame = +2

Query  203  DDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ--EKKPSIEALPDE  370
            DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK+ SI  LPDE
Sbjct  59   DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKEVSINVLPDE  118

Query  371  CLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVE  550
            CLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D+V+G      
Sbjct  119  CLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQDEVSGNK----  174

Query  551  MSPADEDLEVECDGYLSRSVEGKKATDV  634
                 ED EVE  GYLSRS+EGKKATDV
Sbjct  175  ----AEDQEVEGCGYLSRSLEGKKATDV  198



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 103/167 (62%), Gaps = 14/167 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  343
            MP LVNY G DD  +   L S   D   +LSL  + DV+CP RKR+R+T PF+ +  EK+
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  344  P---------SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  496
                      SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+S++R SE+   K+
Sbjct  61   GAEKQKQQSCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSTIRASEMAAHKN  120

Query  497  HQDLSIADKVNGASNDVEMS-PADEDLEVECDGYLSRSVEGKKATDV  634
            +   S  + +     D+  +   DE+ E E  GYL+R ++ K ATDV
Sbjct  121  NCT-SGCETLKKPLPDLNSAMSTDEEEEFESTGYLTRKLKAKDATDV  166



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 97/160 (61%), Gaps = 17/160 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  334
            M  L   SG DDF  G  +     + GL+L LG + DVY  +RKR+RI+ PFV      +
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERFE  60

Query  335  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            +K+ SIE LPDECLFEIFRRL GG ERS+ A VSKRWL L+S++   EI   K   +   
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACASVSKRWLSLLSNIHRDEIRSLKPESE---  117

Query  515  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                      VE+    ED +VE DGYLSRS+EGKKATD+
Sbjct  118  --------KKVELVSDAEDPDVERDGYLSRSLEGKKATDI  149



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 95/144 (66%), Gaps = 15/144 (10%)
 Frame = +2

Query  248  LMLSLG-HADVYCPSRKRARITGPFVVEVQ-EKKPSIEALPDECLFEIFRRLSGGRERSS  421
            L L LG H DVY   RKR+RI+ PFVV  + E++PSI+ LPDECLFE+FRRL GG+ERS+
Sbjct  27   LFLPLGNHVDVYFLPRKRSRISAPFVVSGEPEQQPSIDVLPDECLFEVFRRLPGGQERSA  86

Query  422  AACVSKRWLMLMSSVRNSEIFRSKSHQDL--------SIAD---KVNGASNDVE--MSPA  562
             ACVSKRWLMLMSS+   EI  SK+ Q +        ++A    K    SND+    S  
Sbjct  87   CACVSKRWLMLMSSIARDEICNSKTTQFVEPEIRSSPAVAHDSAKPKEKSNDMNGIKSED  146

Query  563  DEDLEVECDGYLSRSVEGKKATDV  634
            +E  E +  GYLSR +EGKKATDV
Sbjct  147  EECQENDSHGYLSRCLEGKKATDV  170



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 104/175 (59%), Gaps = 31/175 (18%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARITGPFVVEVQE--  337
            MP LV Y G DD      L S  +   L L  A   DV+CP RKR+R+T PF+ +  E  
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  338  -KKP-----SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  499
             +KP     SI+ LPDECLFEI R L G RERS++ACVSKRWLML+SS+R SEI      
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRWLPGSRERSNSACVSKRWLMLLSSIRASEI------  114

Query  500  QDLSIADKVNGASN-DVEMSP---------ADEDLEVECDGYLSRSVEGKKATDV  634
                 A+K NG+SN D+  +P         ADE+ E E  GYL+R ++ K+ATDV
Sbjct  115  ----AANKKNGSSNGDLLKNPLPDLNDAVSADEEEEPEKAGYLTRYLKAKEATDV  165



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 98/159 (62%), Gaps = 17/159 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  337
            M  +  +SGD+    G      +    LSLG   DVY P +KR+R++ PFV +     Q+
Sbjct  1    MSQVFGFSGDNFCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFEQK  60

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            +K SIE+LPDECLFEIFRRL  G ERS++ACVSKRWLML+S++  SEI  +KS       
Sbjct  61   QKTSIESLPDECLFEIFRRLPVGEERSASACVSKRWLMLLSNICKSEICSNKST------  114

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                 +SND      D + E   +GYLSRS+EGKKATDV
Sbjct  115  -----SSNDENKMECDSE-EFGGEGYLSRSLEGKKATDV  147



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 98/161 (61%), Gaps = 20/161 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQE  337
            M  ++ +SG DDF    S+ +   +    L LG   DVY P RKR+R+  PFV   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  338  KKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            +KP  S+EALPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+  +EI  +K      
Sbjct  61   QKPKTSVEALPDECLFEIFRRLPSGEDRSACACVSKRWLMLLSSICKNEICVNK------  114

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                 N     +E     +D+E   +GYLSRS+EGKKATDV
Sbjct  115  -----NATVETIE--KEGDDVEFGGEGYLSRSLEGKKATDV  148



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   123 bits (309),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 106/174 (61%), Gaps = 21/174 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLG-HADVYCPSRKRARITGPFV-VEVQEK  340
            M  + N+SGDD F  G ++  +  +  L LSLG H DVY P  KR+R+  PFV  E ++K
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTEKKQK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
              SI+ LPDECLFE+ RRLS G+ERS++ACVSKRWLML+SS+   E   S  +  L   +
Sbjct  61   LSSIDVLPDECLFEVLRRLSDGKERSASACVSKRWLMLLSSIHGDETVISDLNPSLETEE  120

Query  521  K-VNGA---------------SNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + +  A               SN  E++ A E  ++E +G+LSR ++GKKATDV
Sbjct  121  RSIQTALVKPVDCVKKGEVLDSNGAEVADA-ESQDIEGEGHLSRCLDGKKATDV  173



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 99/160 (62%), Gaps = 21/160 (13%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE----VQ  334
            M  +  +SGD+   +GS   +  +     SLGH  D Y P +KR+R++ PFV +     Q
Sbjct  1    MSQVFGFSGDNFCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFTQ  60

Query  335  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            ++K SIE+LPDECLFEIFRRL  G ERSS ACVSKRWLML+S++  SEI  +KS  +   
Sbjct  61   KQKTSIESLPDECLFEIFRRLPVGEERSSCACVSKRWLMLLSNICKSEICSNKSDDE---  117

Query  515  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             +K+ G S            E   +GYLSRS+EGKKATDV
Sbjct  118  -NKMEGVSE-----------EFGGEGYLSRSLEGKKATDV  145



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 104/163 (64%), Gaps = 18/163 (11%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADL---GLMLSLG-HADVYCPSRKRARITGPFVVEVQ--  334
            M TLV YSGDD    G  L S+ L    L LSL  + DVYCP RKR+R+T PFV+     
Sbjct  1    MSTLVKYSGDDRH--GGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNT  58

Query  335  --EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR-SKSHQD  505
              ++KPS++ LPDECLFEI RR++  R+RS+ ACVSK WLML S+++  E+   SK    
Sbjct  59   NFQRKPSLDNLPDECLFEILRRVNTSRDRSACACVSKHWLMLQSTIKRVEVVADSKLTCS  118

Query  506  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             ++A++ + AS ++E +        + +GYLSRS+ G KATDV
Sbjct  119  DALANQEDVASFEIEENG-------DSNGYLSRSLRGNKATDV  154



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 93/161 (58%), Gaps = 19/161 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  331
            M  L  ++G DDF  G S+     + G  LSLG   D+Y P  KR+R + PFV       
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q K+ SI+ LP+ECLFEIF+RL GG ERS+ ACVSK+WL L+S++   E     ++  + 
Sbjct  61   QNKQVSIDVLPEECLFEIFKRLPGGEERSACACVSKKWLSLLSNIHRDEFCNKNTNLSVK  120

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              D+              ED E+E  GYLSRS+EGKKATDV
Sbjct  121  SQDETT------------EDQEIESCGYLSRSLEGKKATDV  149



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 91/163 (56%), Gaps = 34/163 (21%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV--------E  328
            MP  VN SG+D+   G        G  +S  + DV+C   KR RI+ PF           
Sbjct  1    MPGRVNQSGNDELHPGCR------GYTIS-SNVDVHCSPTKRTRISAPFTFGPLPRALEH  53

Query  329  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  508
             Q+ KPSIE+LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+R  EI         
Sbjct  54   GQDLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI---------  104

Query  509  SIADKVNGASNDVEMSPADEDLE-VECDGYLSRSVEGKKATDV  634
                      + VE   +DE  E  +  G+L+R +EG+KATDV
Sbjct  105  ---------DSGVETISSDESEEDAKGGGWLTRRLEGRKATDV  138



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 97/167 (58%), Gaps = 24/167 (14%)
 Frame = +2

Query  173  MPTLVNYSGDDDF---LAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPF-------  319
            M  LVNY G DD      GSS         LS G + DVYCP RKRAR+  P        
Sbjct  1    MAALVNYGGGDDLCPLFPGSSR-------FLSPGRNVDVYCPPRKRARVIAPLGFSFRGR  53

Query  320  -VVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  493
              V  ++++P SI+ LPDECLFEI RRL G +ERSS ACVSKRWLML+ S+R+SE+    
Sbjct  54   EEVAAEKQQPRSIDTLPDECLFEILRRLPGEKERSSCACVSKRWLMLLISIRSSELAARM  113

Query  494  SHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               D S+  ++   S  V      E+ E E +GYL+R ++ ++ATD+
Sbjct  114  KTTDESVKTRMPDLSKGV----CAEEKECENNGYLTRRLDAEEATDI  156



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 97/163 (60%), Gaps = 14/163 (9%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARITGPFVVEVQEK-  340
            M  LVN  G+DD   G  L S  +   L L    + DVYCP RKR R+T P +    EK 
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  341  -----KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  505
                 + SI+ LP+ECLFEI RRL G +ERS++ACVSKRWLML+SS+R+SE+ + K    
Sbjct  61   ADEKLQRSIDTLPEECLFEILRRLPGDKERSNSACVSKRWLMLLSSIRSSELAQKKPS--  118

Query  506  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                + V     D+    A ++ E E +GYL+R ++ ++ATD+
Sbjct  119  ---VESVKKPVPDLNKDCALDEHESENNGYLTRRLDAEEATDI  158



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 91/163 (56%), Gaps = 34/163 (21%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV--------E  328
            MP  VN SG+D+   G        G  +S  + DV+C   KR RI+ PF           
Sbjct  1    MPGRVNQSGNDELHPGCR------GYTIS-SNVDVHCSPTKRTRISAPFTFGPLPRALEH  53

Query  329  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  508
             Q+ KPSIE+LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+R  EI         
Sbjct  54   GQDLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI---------  104

Query  509  SIADKVNGASNDVEMSPADEDLE-VECDGYLSRSVEGKKATDV  634
                      + VE   +DE  E  +  G+L+R +EG+KATDV
Sbjct  105  ---------DSGVETISSDESEEDAKGGGWLTRRLEGRKATDV  138



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 100/167 (60%), Gaps = 31/167 (19%)
 Frame = +2

Query  197  GDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV-------VEVQEKKP  346
            G DD  +   L S   D   +LS+  + DV+ P RKR+RIT PF+        E Q+++P
Sbjct  21   GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  347  -SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  523
             SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+SS+R SE+           A K
Sbjct  81   CSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEM----------AAHK  130

Query  524  VNGASN---------DVEMSPA-DEDLEVECDGYLSRSVEGKKATDV  634
             NGAS+         D+  S + DE+ E E  GYL+R ++ K ATDV
Sbjct  131  KNGASSGETLKKPLPDLNTSASTDEEKEFESTGYLARKLKAKDATDV  177



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 103/164 (63%), Gaps = 31/164 (19%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG---HADVYCPSRKRARITGPFV-----  322
            M  + ++SG+++F  G S+ S   + G  LSLG   H DVY P+ KRARI+ P V     
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  323  VEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  502
            +E Q+K+ S++ LPDECL+EI RRL G +ERSS A VSKRWLML+SS+ ++++       
Sbjct  60   LE-QKKQVSLDVLPDECLYEILRRLPGDQERSSCASVSKRWLMLLSSIPSADL-------  111

Query  503  DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                        N  E+  A+E  E+E DG+L+RS+EGKKATDV
Sbjct  112  -----------CNKFEVV-AEEGDEIESDGFLTRSLEGKKATDV  143



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 96/158 (61%), Gaps = 26/158 (16%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  343
            M  + +++G++DF    ++     D  L+LSLG  ADVY P  KR+R+  P +    EKK
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKK  60

Query  344  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            P SI+ LPDECLFEIFRRLSG +ERS+ A VSK+WL L+SS+R  EI             
Sbjct  61   PVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQKEI-------------  107

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                   DV  S   ED + +C+G LSRS++GKKATDV
Sbjct  108  -------DVP-SKITEDGD-DCEGCLSRSLDGKKATDV  136



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 94/158 (59%), Gaps = 24/158 (15%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  343
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P V    E+K
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEEK  60

Query  344  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            P SI+ LPDECLFEIFRRL G +ERSS A VSK WL L+SS+R  E+             
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSSCAFVSKHWLTLVSSIRQKEL-------------  107

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                   DV  S   ED + +C+G LSRS++GKKATDV
Sbjct  108  -------DVVPSNKSEDGDDDCEGCLSRSLDGKKATDV  138



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 98/161 (61%), Gaps = 27/161 (17%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQE  337
            M  + +++G+DDF  G  +     +  L LSLG   DVY P +KR+R + PF +  E  E
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  338  KKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            +KP  SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +E +         
Sbjct  61   QKPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNETY---------  111

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                    SN+   S  +E+ E+  +GYLSRS+EGKKATDV
Sbjct  112  --------SNE---STGNENQEISDEGYLSRSLEGKKATDV  141



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 93/160 (58%), Gaps = 29/160 (18%)
 Frame = +2

Query  182  LVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV------EVQ  334
            ++ +SG+DDF  G  +     +  L LSLG   DVY P +KR+R + PF +      + Q
Sbjct  1    MLGFSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQ  60

Query  335  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            + K SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI           
Sbjct  61   KPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYG-------  113

Query  515  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                         S  +E+ E+  +GYLSRS+EGKKATDV
Sbjct  114  -------------STGNENQEISDEGYLSRSLEGKKATDV  140



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 84/137 (61%), Gaps = 14/137 (10%)
 Frame = +2

Query  266  HADVYCPSRKRARITGPFVVEVQEKK-PSIEALPDECLFEIFRRLSGGRERSSAACVSKR  442
            H + Y   RKR RI+ PFV   + K  PSIE LPDECLFEIFRRL G +E+S  ACVSKR
Sbjct  47   HFESYSLQRKRCRISAPFVAGREVKLLPSIEILPDECLFEIFRRLHGNKEKSVCACVSKR  106

Query  443  WLMLMSSVRNSEIFRSKS--HQDLSIADKVN--------GASNDVEMSPADEDLEV---E  583
            WLML+SS+R  E + ++S  H +  I    N        G    V+ S + E+ EV   +
Sbjct  107  WLMLLSSIRKDESYTTESVGHLEPEIGFNSNVADYSPTVGEKYGVDCSSSVEEPEVGEND  166

Query  584  CDGYLSRSVEGKKATDV  634
            C G+LSR + GKKATDV
Sbjct  167  CHGFLSRYLGGKKATDV  183



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 100/172 (58%), Gaps = 21/172 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSL-GHADVYCPSRKRARITGPFVV-EVQEKKP  346
            M  + N+SGD       S    +  L LSL  H DVY P  KR+R+  PFV  E + K  
Sbjct  1    MSKVFNFSGDHGGTVYPS--PKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSEKKHKLS  58

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK-  523
            SI+ LPDECLFE+ RRLS G++RS++ACVSKRWLML+SS+R  E   S  +  L   ++ 
Sbjct  59   SIDVLPDECLFEVLRRLSDGKDRSASACVSKRWLMLLSSIRGDETVISNPNPSLETEERS  118

Query  524  VNGA---------------SNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +  A               SN  E++ A E  ++E +G+LSR ++GKKATDV
Sbjct  119  IQTALVKSVDCVKKGEVVDSNAAEVAEA-ESQDIEGEGHLSRCLDGKKATDV  169



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 102/162 (63%), Gaps = 20/162 (12%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  331
            M  +  ++G++DF  G  + +   +  L LS+G   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-FRSKSHQDL  508
            Q+K+ SIE LPDECLFEIFRRL GG ER + ACVSK WL L+S++   E+  +++S + +
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGNERGACACVSKHWLSLLSNICKDELCCQNESAKKI  120

Query  509  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +            ++    ED EVE DGYLSRS+EGKKATD+
Sbjct  121  T------------QVKSEVEDEEVEGDGYLSRSLEGKKATDI  150



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 103/165 (62%), Gaps = 17/165 (10%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAG---SSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV---  331
            M  LV Y G+DD   G   S+L   D  L+LSLG  ADVY P  KR R+T P +      
Sbjct  1    MAALVKYGGNDDICPGPFYSNL--TDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEK  58

Query  332  ---QEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  499
               +EK+P SI+ LPDECLFEI RRL G +ERS++ACVSK WLML+SS+R+SE+      
Sbjct  59   VIDEEKQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKHWLMLVSSIRSSELAACNKA  118

Query  500  QDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             D S+ +     +NDV +   DE  E E +GYL+R ++ ++ATD+
Sbjct  119  CDESVKNPSLFLNNDVIV---DEQ-ESENNGYLTRCLDAEEATDI  159



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 86/158 (54%), Gaps = 43/158 (27%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV----EVQEK  340
            MPTL+NYSG D+     S                 + PS KRARI  PFV+      QEK
Sbjct  1    MPTLINYSGKDELYNERS-----------------FYPSCKRARINAPFVLWGQESEQEK  43

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            + SI  LPDECLFEIFR L  G+ERS+ ACVSK WL L+SS+R +E+             
Sbjct  44   RSSINVLPDECLFEIFRHLP-GQERSNCACVSKHWLTLLSSIRRAEMC------------  90

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                   D++     +D EV  DG L+RSVEGKKATDV
Sbjct  91   -------DIDTVMVSDDKEV--DGCLTRSVEGKKATDV  119



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 90/156 (58%), Gaps = 35/156 (22%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFV-VEVQEKKP  346
            M  +  +SGD+DF  G S+        LS G    VY P+RKR RI  P V +  ++K+ 
Sbjct  1    MSGIFRFSGDEDFFPGGSM-------HLSPGSCPGVYFPARKRLRIAAPSVQIGFEQKQT  53

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL L+SS+  SE+  ++S QD       
Sbjct  54   SIEVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEV--NESVQD-------  104

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                             VE +G+LSRS+EGKKATD+
Sbjct  105  -----------------VEGEGFLSRSLEGKKATDL  123



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 90/156 (58%), Gaps = 32/156 (21%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-KP  346
            M  L  +SGD+ +  G S+C       LS G +  VY P+RKR+RI+ P +    E+ + 
Sbjct  1    MSGLFRFSGDEGYFPGGSMC-------LSPGSNIGVYYPARKRSRISAPSLFSGFERNQA  53

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SIE LPDECLFEIFRRL  G+ERS  ACVSK+WL L+S++R  E   SK           
Sbjct  54   SIEVLPDECLFEIFRRLPSGQERSVCACVSKQWLGLLSNIRREEASGSK-----------  102

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                        DE  EVE +G+LSRS+EGKK TD+
Sbjct  103  ------------DEFQEVEDEGHLSRSLEGKKVTDL  126



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   112 bits (280),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 24/153 (16%)
 Frame = +2

Query  203  DDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQEKKPSIEALPD  367
            +DF  G+ +     D  L LSLG   DVY P RKR+R++ PFV   E+ +K+ SIE LPD
Sbjct  13   EDFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVPSGEILKKEASIEVLPD  72

Query  368  ECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDV  547
            ECLFEIF+RL     RS  ACVSKRWLML+SS+  +E +               GAS ++
Sbjct  73   ECLFEIFKRLPERETRSLCACVSKRWLMLLSSISGNEFY---------------GASENL  117

Query  548  E----MSPADEDLEVECDGYLSRSVEGKKATDV  634
            +    ++   ED +   +G LSR++EGKKATDV
Sbjct  118  KPKNVVTENLEDNQTTNEGCLSRNLEGKKATDV  150



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 100/163 (61%), Gaps = 13/163 (8%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARIT------GPFVV  325
            M  LVN +G+DD   G  L S  +   L L    + D YCP  KR RIT      G    
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  326  EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  505
            + +++  SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+ S+R+SE+   K H++
Sbjct  61   DEKQQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKRWLMLLCSIRSSELADRKKHRN  120

Query  506  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S+   +   + DV    ++++ E E +G+L+R ++ ++ATD+
Sbjct  121  ESVKKPLPDLNKDV----SEDEQESENNGFLTRRLDAEEATDI  159



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 84/134 (63%), Gaps = 24/134 (18%)
 Frame = +2

Query  239  DLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRE  412
            D  L+LSLG  ADVY P  KR+R+  P +    EKKP SI+ LPDECLFEIFRRLSG +E
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKKPVSIDVLPDECLFEIFRRLSGPQE  60

Query  413  RSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDG  592
            RS+ A VSK+WL L+SS+R  EI                    DV  S   ED + +C+G
Sbjct  61   RSACAFVSKQWLTLVSSIRQKEI--------------------DVP-SKITEDGD-DCEG  98

Query  593  YLSRSVEGKKATDV  634
             LSRS++GKKATDV
Sbjct  99   CLSRSLDGKKATDV  112



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 15/136 (11%)
 Frame = +2

Query  239  DLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQEKKPSIEALPDECLFEIFRRLSGG  406
            D  L LSLG H DVY P RKR+R++ P+V     +++K+ SIE LPDECLFEIF+RL   
Sbjct  26   DTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGEILKKKEASIEVLPDECLFEIFKRLPDR  85

Query  407  RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVEC  586
              RS  ACVSKRWLML+SS+  +E + +  +    I            ++   ED ++  
Sbjct  86   ETRSLCACVSKRWLMLLSSISGNEFYSASENLKPKIV-----------VTENLEDNQITN  134

Query  587  DGYLSRSVEGKKATDV  634
            +G LSR++EGKKATDV
Sbjct  135  EGCLSRNLEGKKATDV  150



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 96/158 (61%), Gaps = 22/158 (14%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV-QEK  340
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P V    +EK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEEK  60

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            + SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+            D
Sbjct  61   QVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL------------D  108

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             V+  SN        ED + +C+G LSRS++GKKATDV
Sbjct  109  VVSSNSNK------SEDGDDDCEGCLSRSLDGKKATDV  140



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 90/156 (58%), Gaps = 32/156 (21%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEKKP  346
            M  L  +SGD+DF  G SL        LS G   DVY P+ KR+RI  P +    ++ + 
Sbjct  1    MSGLFRFSGDEDFFPGGSL-------YLSPGSQIDVYYPAHKRSRIAAPAIFSGFEQNQV  53

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SI+ LPDECLFEIFR L  G+ERS+ ACVSKRWL L+S++R  E+  S+           
Sbjct  54   SIDVLPDECLFEIFRCLPSGQERSACACVSKRWLGLLSNIRGEEVSGSE-----------  102

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                        D+  +V+ +G+LSRS+EGKKATD+
Sbjct  103  ------------DKSQKVDDEGHLSRSLEGKKATDL  126



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 13/125 (10%)
 Frame = +2

Query  272  DVYCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLM  451
            DVY P  KR+R T     + ++KKPSIE LPDECLFEIFR L GGRERSS ACVSKRWL+
Sbjct  2    DVYFPLSKRSR-TSASGEKFEQKKPSIEVLPDECLFEIFRWLRGGRERSSCACVSKRWLI  60

Query  452  LMSS-----VRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEG  616
            L+S+     +R++ I  + + +D S   KV G  ++VE +      +V+ DGY +R++EG
Sbjct  61   LVSNICKYEIRDNNIIHALNPKDESTNKKV-GIVSEVEHN------DVDSDGYFTRNLEG  113

Query  617  KKATD  631
            KKATD
Sbjct  114  KKATD  118



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 100/165 (61%), Gaps = 16/165 (10%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARITGPFV------V  325
            M  LVN  G DD   G SL S  +   L L    + DVYC SRKR R+T P        V
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  326  EVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-FRSKSH  499
              ++++P SI++LPDECLFEI RRL G +ERS++A VSKRWLML+SS+R+SE+  R KSH
Sbjct  61   AYKKQQPRSIDSLPDECLFEILRRLPGDKERSNSARVSKRWLMLLSSIRSSELGARKKSH  120

Query  500  QDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                  +       D+  +   ++ E E +GYL+R ++ ++ATD+
Sbjct  121  -----VESGKKFLPDLNKNVLLDEQESENNGYLTRRLDAEEATDI  160



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 90/154 (58%), Gaps = 25/154 (16%)
 Frame = +2

Query  185  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  352
            VN S D +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  5    VNQSSDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  60

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  61   EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  109

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S+D      D D + E DGYL+R +EG+KATDV
Sbjct  110  VSSD------DSDEDAEGDGYLTRRLEGRKATDV  137



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 90/154 (58%), Gaps = 25/154 (16%)
 Frame = +2

Query  185  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  352
            VN S D +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  56   VNQSSDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  111

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  112  EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  160

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S+D      D D + E DGYL+R +EG+KATDV
Sbjct  161  VSSD------DSDEDAEGDGYLTRRLEGRKATDV  188



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 96/161 (60%), Gaps = 21/161 (13%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHADVYCPSRKRARITGPFVVEVQ----  334
            M  + ++SG+DDF  G  +     +  L LSLG +  Y P +KR+R++  F +  +    
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVDYFPLQKRSRVSVSFDINREWFDE  60

Query  335  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
             ++K SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +E+          
Sbjct  61   PKQKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEVCS--------  112

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                 NG++ D  +   D+D     +GYLSRS+EGKKATDV
Sbjct  113  -----NGSTGDSNVG-GDDDQGFSNEGYLSRSLEGKKATDV  147



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 91/154 (59%), Gaps = 25/154 (16%)
 Frame = +2

Query  185  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  352
            +++ GD +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  1    MDFPGDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  56

Query  353  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  532
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  57   EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  105

Query  533  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S+D      D D + E DGYL+R +EG+KATDV
Sbjct  106  VSSD------DSDEDAEGDGYLTRRLEGRKATDV  133



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 18/125 (14%)
 Frame = +2

Query  269  ADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRW  445
             DVY P RK++R++ P V    E++P SI+ LPDECLFEIFRR+ G +ER + A VSKRW
Sbjct  36   VDVYFPPRKKSRVSAPLVARAFEQEPVSIDVLPDECLFEIFRRMPGAQERCACASVSKRW  95

Query  446  LMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVE--MSPADEDLEVECDGYLSRSVEGK  619
            L L+SS+          HQ     D++   SN V+   S  D + +VE +GYLSRS+EGK
Sbjct  96   LNLLSSI----------HQ-----DELEVISNKVKDGASKGDGEDDVESNGYLSRSLEGK  140

Query  620  KATDV  634
            KATDV
Sbjct  141  KATDV  145



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 93/158 (59%), Gaps = 26/158 (16%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  343
            M  + +++G++DF    ++     D  L+LSLG   DVY P  KR+R+  P V    EKK
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSGFEKK  60

Query  344  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            P SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+             
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLKLVSSIRQKEL-------------  107

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
              +  SN  E    D D   +C+G LSRS++GKKATDV
Sbjct  108  --DVPSNKTE----DGD---DCEGCLSRSLDGKKATDV  136



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 87/156 (56%), Gaps = 34/156 (22%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  346
            M  +  +SGD+DF  G S       + LS G    VY P+RKR RI  P V    +EK+ 
Sbjct  1    MSGIFRFSGDEDFFLGGS------SMYLSPGSCPGVYFPARKRLRIAAPSVFSGFEEKQT  54

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SI+ LPDECLFEI RRL  G ERS+ ACVSK WL L+SS+  SE+  ++S QD       
Sbjct  55   SIDVLPDECLFEILRRLPSGEERSACACVSKHWLNLLSSISRSEV--NESVQD-------  105

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                             VE +G+LSR +EGKKATD+
Sbjct  106  -----------------VEGEGFLSRRLEGKKATDL  124



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 92/159 (58%), Gaps = 25/159 (16%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV-EVQEK  340
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P  V    EK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAFEK  60

Query  341  KP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            KP S + LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+            
Sbjct  61   KPVSFDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL------------  108

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                    DV  S   ED   +C+G LSRS++GKKATDV
Sbjct  109  --------DVVPSNTSEDGGDDCEGCLSRSLDGKKATDV  139



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 93/158 (59%), Gaps = 26/158 (16%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  343
            M  + +++G+++F    ++     D  L+LSLG   DVY P  KR+R+  P V    EKK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSFEKK  60

Query  344  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            P SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+             
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL-------------  107

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                   DV  S   ED + +C+G LSRS++GKKATDV
Sbjct  108  -------DVT-SNKTEDCD-DCEGCLSRSLDGKKATDV  136



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 87/156 (56%), Gaps = 35/156 (22%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  346
            M  +  +SGD+DF  G S+        LS G    VY P+ KR RI  P V    ++K+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSM-------YLSPGSCPGVYFPAHKRLRIAAPSVFSGFEQKQT  53

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L+SS+  +E+       D S+ D  
Sbjct  54   SIDVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRNEV-------DESVQD--  104

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                             VE +G+LSRS+EGKKATD+
Sbjct  105  -----------------VEGEGFLSRSLEGKKATDL  123



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 93/158 (59%), Gaps = 25/158 (16%)
 Frame = +2

Query  173  MPTLVNYSGDDDFL--AGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQEKK  343
            M  + ++SG++DF     +     D+ L+LSLG   D Y P  KR+R+  P      E+K
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAFEEK  60

Query  344  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  520
            P SI+ LP+ECLFEIFRRLSG +ER++ A VS+ WL L++S+R SE+             
Sbjct  61   PVSIDVLPEECLFEIFRRLSGSQERTACASVSRHWLTLVTSIRQSEL-------------  107

Query  521  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                   DV  S   ED E +C+G LSRS++GKKATDV
Sbjct  108  -------DVVPSSKTEDGE-DCEGCLSRSLDGKKATDV  137



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 88/138 (64%), Gaps = 14/138 (10%)
 Frame = +2

Query  233  SADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-KPSIEALPDECLFEIFRRLSGG  406
            S D  L  +LG   D+Y   RKR+RI+ PF+   + K + SIEALPDECLFEI RRL  G
Sbjct  17   SKDSNLSFTLGSRVDMYFLQRKRSRISAPFIAGKKSKMQSSIEALPDECLFEILRRLPRG  76

Query  407  RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSP--ADEDLEV  580
            RE ++ ACVSKRWLML+SS++  E+  S++ + +           +++ +P    ED +V
Sbjct  77   RETNACACVSKRWLMLLSSMKKDEMCTSETTRFV---------GPEIQSNPPKPKEDDDV  127

Query  581  ECDGYLSRSVEGKKATDV  634
               GYLSR +EGKKATDV
Sbjct  128  S-RGYLSRCLEGKKATDV  144



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRAR--ITGPF--VVEVQE  337
            MPTLV++ GD+DF         D  L LSL    +V CP RKR R  +T PF      QE
Sbjct  1    MPTLVSFRGDEDFGGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLRGNVTIPFRETKPKQE  60

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  493
            +K  I  LPDECLFEIFR L   R+RS +ACVSKRWLML SS+R SEI RSK
Sbjct  61   QKDLISMLPDECLFEIFRCLPAARDRSVSACVSKRWLMLQSSMRRSEIKRSK  112



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 87/156 (56%), Gaps = 34/156 (22%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  346
            M  +  +SGD+DF  G S+ +      LS G    VY P+RKR RI    V    ++K+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHN------LSPGSCPGVYFPARKRLRIAATSVFSGFEQKQT  54

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+  S            
Sbjct  55   SIDVLPDECLFEILRRLPSGKERSACACVSKHWLHLLTSITRNEVVESV-----------  103

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                         +DLE E  G+LSRS++GKKATD+
Sbjct  104  -------------QDLEGE--GFLSRSLDGKKATDL  124



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 86/156 (55%), Gaps = 33/156 (21%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP-FVVEVQEKKP  346
            M  +  +SGD+D L G S+        LS G    VY P+RKR R+    F    +EK+ 
Sbjct  1    MSGIFRFSGDEDCLLGGSM-------YLSPGSCPGVYYPARKRLRVAATSFYSGFEEKQT  53

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SI+ LP+ECLFEI RRL  G+ERS+ ACVSK WL L+SS+  SE+  S            
Sbjct  54   SIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEVNESSVQ---------  104

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                 DVE          E +G+LSRS+EGKKATD+
Sbjct  105  -----DVE----------EGEGFLSRSLEGKKATDL  125



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 83/156 (53%), Gaps = 38/156 (24%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP-FVVEVQEKKP  346
            M  + ++SGD++F  G S+        LS G  + VY P RKR R+  P       +K+ 
Sbjct  1    MSGIFSFSGDEEFFNGGSM-------YLSTGSCSGVYLPPRKRLRVAAPSLYSSFNQKQT  53

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESLQ-------------  100

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                            EVE +G+LSRS+EG KATD+
Sbjct  101  ----------------EVESEGFLSRSLEGNKATDL  120



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 79/134 (59%), Gaps = 24/134 (18%)
 Frame = +2

Query  239  DLGLMLSL-GHADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRE  412
            D  L+LSL    DVY P  KR R+  P +    EKKP SI+ LPDECLFEIFRRLSG +E
Sbjct  25   DASLLLSLISFGDVYFPPSKRQRVVLPTLFSAFEKKPVSIDVLPDECLFEIFRRLSGPQE  84

Query  413  RSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDG  592
            RS+ A VSK+WL  +SS+R  EI         ++  K+          P D D    C+G
Sbjct  85   RSACAFVSKQWLTTVSSIRQKEI---------TVPSKI----------PEDGD---NCEG  122

Query  593  YLSRSVEGKKATDV  634
             LSRS++GKK TDV
Sbjct  123  TLSRSLDGKKRTDV  136



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 95/162 (59%), Gaps = 22/162 (14%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHADVYCPSRKRARITGPFVV-----EV  331
            M  + ++SG+DDF  G  +     +  L LSLG +  Y   +KR+R++  F +     + 
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVDYFSLQKRSRVSVSFDINREWFDE  60

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q+++ SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI  + S  D +
Sbjct  61   QKQEISIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEICSNGSTGDYN  120

Query  512  IADKVNGASNDVEMSPADEDLEVECDGY-LSRSVEGKKATDV  634
            +                D+D     +GY LSRS+EGKKATDV
Sbjct  121  VG--------------GDDDQGFSNEGYLLSRSLEGKKATDV  148



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 87/156 (56%), Gaps = 34/156 (22%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  346
            M  +  +SGD+DF  G S+ +      LS G    VY P+RKR RI    V    +EK+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHN------LSPGSCPGVYFPARKRLRIAATSVFSGFEEKQT  54

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+   +S QD       
Sbjct  55   SIDVLPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEVV--ESVQD-------  105

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                             VE +G+LSRS++G KATD+
Sbjct  106  -----------------VEGEGFLSRSLDGVKATDL  124



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 84/156 (54%), Gaps = 38/156 (24%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP-FVVEVQEKKP  346
            M  + +++GD++F  G S+        LS G  + VY P RKR R++ P       +K+ 
Sbjct  1    MSGIFSFNGDEEFFNGGSM-------YLSPGSCSGVYLPPRKRLRVSTPSLYSSFNQKQT  53

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESLQ-------------  100

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                            EVE +G+LSRS+EG KATD+
Sbjct  101  ----------------EVESEGFLSRSLEGNKATDL  120



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 82/156 (53%), Gaps = 38/156 (24%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPF-VVEVQEKKP  346
            M  + ++SGD+DF  G ++        LS G    VY P RKR R+  P       +K+ 
Sbjct  1    MSGIFSFSGDEDFFNGGTM-------HLSPGSCPGVYLPPRKRLRVAAPSPYSAFNQKQT  53

Query  347  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  526
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESVQ-------------  100

Query  527  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                            EVE +G+LSRS+EG KATD+
Sbjct  101  ----------------EVESEGFLSRSLEGNKATDL  120



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 84/157 (54%), Gaps = 41/157 (26%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYC--PSRK-RARITGPFVVEVQEKK  343
            MPTL+NY+GDD+F   S     D    L +      C  P+++ RA +  PF     +  
Sbjct  1    MPTLLNYTGDDEFHPTSM---EDFPCFLPVSSRINVCFQPNKRVRANLKIPF--RRDDTN  55

Query  344  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  523
            PSI+ LPDECLFEIF+RL  G+ +SS ACVSKRWLML+SS+R                  
Sbjct  56   PSIDDLPDECLFEIFKRLYNGKSKSSCACVSKRWLMLLSSIR------------------  97

Query  524  VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                   VE        E E +GYL+R +EGKKATD+
Sbjct  98   -------VE--------ETENNGYLTRHLEGKKATDI  119



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 84/157 (54%), Gaps = 41/157 (26%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYC--PSRK-RARITGPFVVEVQEKK  343
            MPTL+NY+GDD+F   S     D    L +      C  P+++ R  +  PF+ +  + K
Sbjct  1    MPTLLNYTGDDEFHPTSM---EDFPCFLPISSRINVCFQPNKRFRTNLKIPFLGD--DTK  55

Query  344  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  523
            PSI+ LPDECLFEIF+RL  G+ +SS ACVSKRWLML+SS+R                  
Sbjct  56   PSIDDLPDECLFEIFKRLDNGKSKSSCACVSKRWLMLLSSIRME----------------  99

Query  524  VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                             + E +GYL+R +EGKKATD+
Sbjct  100  -----------------KTENNGYLTRHLEGKKATDI  119



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 90/162 (56%), Gaps = 25/162 (15%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHAD-VYCPSRKRARITGPFVVEVQ---  334
            M  +++++G DDF  G S  L   +  L LSLG  +  Y P +KR+R   PF    +   
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  335  EKKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  508
            + KP  SIE LPDECLFEI RRL  G++RS  A VSKRWL L+SS+  +EI         
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEI---------  111

Query  509  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                     SN    +   ++ E   +GYLSRS+EGKKATDV
Sbjct  112  --------CSNASSGNKDSDNQEFGDEGYLSRSLEGKKATDV  145



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 90/162 (56%), Gaps = 25/162 (15%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHAD-VYCPSRKRARITGPFVVEVQ---  334
            M  +++++G DDF  G S  L   +  L LSLG  +  Y P +KR+R   PF    +   
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  335  EKKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  508
            + KP  SIE LPDECLFEI RRL  G++RS  A VSKRWL L+SS+  +EI         
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEI---------  111

Query  509  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                     SN    +   ++ E   +GYLSRS+EGKKATDV
Sbjct  112  --------CSNASSGNKDSDNQEFGDEGYLSRSLEGKKATDV  145



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 72/121 (60%), Gaps = 22/121 (18%)
 Frame = +2

Query  275  VYCPSRKRARITGPFVVEVQEK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLM  451
            VY   RKR R+  PFV   + K  PSI+ALPDECLFEI RRL G  E+S+ ACVSKRWLM
Sbjct  1    VYSLQRKRCRVNAPFVASREFKLPPSIDALPDECLFEILRRLPGINEKSACACVSKRWLM  60

Query  452  LMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATD  631
            L+SS+   E + +++ ++              E SP          G+LSRSVEGK A+D
Sbjct  61   LLSSISRDESYTTEALREFE------------ESSP---------RGFLSRSVEGKNASD  99

Query  632  V  634
            V
Sbjct  100  V  100



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 84/152 (55%), Gaps = 34/152 (22%)
 Frame = +2

Query  191  YSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV----EVQEKKPSIEA  358
            +SG+D+   G S   +      ++ H DVY P  KR R+  PFV+      Q  + SI  
Sbjct  8    FSGEDELYGGRSSNPS------AMSHVDVYGPPNKRQRVNAPFVLWGSNPEQNTRSSINV  61

Query  359  LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  538
            LPDEC+FE+FRRL   +ERS+ ACVSK+WL +++ +R SE+  + S Q          +S
Sbjct  62   LPDECMFEVFRRLPP-QERSNCACVSKQWLTILTGIRRSEMSSTLSVQ----------SS  110

Query  539  NDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +DV             D  L+RSVEGKKATDV
Sbjct  111  DDV-------------DSCLTRSVEGKKATDV  129



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 82/147 (56%), Gaps = 32/147 (22%)
 Frame = +2

Query  197  GDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVE-VQEKKPSIEALPDEC  373
            GD+DF  G S+ +   G         VY P+RKR RI    V    ++K+ SI+ LPDEC
Sbjct  5    GDEDFFLGGSMHNLSPG-----SCPGVYFPARKRLRIAATSVFSGFEQKQTSIDVLPDEC  59

Query  374  LFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEM  553
            LFEI RRL  G+ERS+ ACVSK WL L++S+  +E+   +S QDL               
Sbjct  60   LFEILRRLPSGKERSACACVSKHWLNLLTSITRNEV--CESVQDL---------------  102

Query  554  SPADEDLEVECDGYLSRSVEGKKATDV  634
                     E +G+LSRS++GKKATD+
Sbjct  103  ---------EGEGFLSRSLDGKKATDL  120



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 75/123 (61%), Gaps = 15/123 (12%)
 Frame = +2

Query  269  ADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRW  445
             D Y P  KR R++ P    V E+ P SI+ LPDECLFE+FRRL G +ERS  A VSKRW
Sbjct  36   VDAYFPPCKRTRVSAPTAFSVFEQDPVSIDVLPDECLFEVFRRLPGAQERSVCASVSKRW  95

Query  446  LMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKA  625
            L L+S +R  E+            D ++  + D  M   ++D++ +  GYLSRS+EGKKA
Sbjct  96   LNLLSGIRPDEL------------DDISKKAKDASMEDCEDDVDCD--GYLSRSLEGKKA  141

Query  626  TDV  634
            +DV
Sbjct  142  SDV  144



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 86/164 (52%), Gaps = 38/164 (23%)
 Frame = +2

Query  173  MPTLVNYSGDDDFL-AGSSLCSADLGLMLSL---GHADVYCPSRKRARITGPFVVEVQEK  340
            MP L N  G  +F  A  S+C   L L  S     + DVY P  KRAR++        E 
Sbjct  1    MPALANCCGAGEFHNATGSICKTQLNLGKSRFVGNNVDVYYPPGKRARLS--------ES  52

Query  341  KP------SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  502
            +P      SIE LPDECLFEI RRL G +ER  ++CVS+RWL +++ +R SE        
Sbjct  53   EPEATDRSSIEILPDECLFEILRRLPGVKERCVSSCVSRRWLSVLTMIRLSEF-------  105

Query  503  DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                      A NDV+M P+D+D     DG   R +EGKKATD+
Sbjct  106  ---------SACNDVDMVPSDDDE----DGCRVRCLEGKKATDM  136



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 93/161 (58%), Gaps = 28/161 (17%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLC----SADLGLMLSLGHADVYCPSRKRARI--TGPFVVEVQ  334
            M  + +++G++DF    ++      A+L L L+      Y P  KR+R+  T P +    
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  335  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            E KP SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L++S++ +EI          
Sbjct  61   EAKPVSIDVLPDECLFEIFRRLPGPQERSACASVSKHWLTLVTSIKQNEI----------  110

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                  GA    ++S   ED + +C+G LSRS++GKKATDV
Sbjct  111  ------GA----DLSNKTEDGD-DCEGCLSRSLDGKKATDV  140



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 91/164 (55%), Gaps = 31/164 (19%)
 Frame = +2

Query  173  MPTLVNYSGDDDFL-AGSSLCSA--DLGLMLSLG-HADVYC-PSRKRARITGPFV-----  322
            MP L NY G  +   AG S+C    +LG +L  G +A VY  P  KRARI+   +     
Sbjct  1    MPALANYCGTGELHNAGGSICKTQLNLGKLLYTGDNAGVYYYPPNKRARISSSVLSVESE  60

Query  323  VEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  502
             EV E++ SIE LPDECLFEI RRL   +ER  + CVSKRWL +++S+R SE        
Sbjct  61   TEVSEQQ-SIEILPDECLFEILRRLPRVKERCLSLCVSKRWLNVLTSMRLSEF-------  112

Query  503  DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                      A NDV+M  +++D     DG   R +EGKKATD+
Sbjct  113  ---------SACNDVDMVLSEDDD----DGSRVRCLEGKKATDM  143



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 90/160 (56%), Gaps = 33/160 (21%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGHADVYCPSRKRARITGP----FVVEVQE  337
            M  + +++G+ +F   GS+   A++ L L     D Y P  KR+R+       F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL----VDCYYPPCKRSRVVAAAPSLFSAFEEE  56

Query  338  KKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            +KP SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+           
Sbjct  57   EKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL-----------  105

Query  515  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                     DV +    ED   +C+G LSRS++GKKATDV
Sbjct  106  ---------DVVVDNKTED---DCEGCLSRSLDGKKATDV  133



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 79/159 (50%), Gaps = 38/159 (24%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP---FVVEVQEK  340
            M  +   SGDD+F  G    S    + LS G    VY P+RKR R+T     F    +EK
Sbjct  1    MSGIFRVSGDDEFFTGGGGSS----MHLSPGSCPGVYLPARKRLRVTAAATSFYSSFEEK  56

Query  341  KPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            + SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+   E       +     
Sbjct  57   QASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRDESVEEVESE-----  111

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                                    G+LSRS+EG KATD+
Sbjct  112  ------------------------GFLSRSLEGNKATDL  126



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 79/159 (50%), Gaps = 38/159 (24%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP---FVVEVQEK  340
            M  +   SGDD+F  G    S    + LS G    VY P+RKR R+T     F    +EK
Sbjct  1    MSGIFRVSGDDEFFTGGGGSS----MHLSPGSCPGVYLPARKRLRVTAAATSFYSSFEEK  56

Query  341  KPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            + SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+   E       +     
Sbjct  57   QASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRDESVEEVESE-----  111

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                                    G+LSRS+EG KATD+
Sbjct  112  ------------------------GFLSRSLEGNKATDL  126



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 88/159 (55%), Gaps = 31/159 (19%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP---FVVEVQE  337
            M  + +++G+ +F   GS+   A++   LSLG   D Y P  KR+R+      F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANI--FLSLGSLVDCYYPPCKRSRVVAAPSLFSAFEEE  58

Query  338  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  517
            K  SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+            
Sbjct  59   KPVSIDVLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL------------  106

Query  518  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                    DV     D   E + +G LSRS++GKKATDV
Sbjct  107  --------DV----VDHKTEDDSEGCLSRSLDGKKATDV  133



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 81/161 (50%), Gaps = 42/161 (26%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP----FVVEVQE  337
            M  +   SGDD+F  G         + LS G    VY P+RKR R+       F    +E
Sbjct  1    MSGIFRISGDDEFFTG-----GGSSMHLSPGSCPGVYLPARKRLRVASAAATSFYSSFEE  55

Query  338  KKPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSV-RNSEIFRSKSHQDLS  511
            K+ SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+ RN  +   +S     
Sbjct  56   KQTSIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSIARNESVEEVES-----  110

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                                     +G+LSRS+EG KATD+
Sbjct  111  -------------------------EGFLSRSLEGNKATDL  126



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 20/101 (20%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            + ++ SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI          
Sbjct  104  RSQRTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYG------  157

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                          S  +E+ E+  +GYLSRS+EGKKATDV
Sbjct  158  --------------STGNENQEISDEGYLSRSLEGKKATDV  184



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 12/104 (12%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q  +PS++ALPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+ ++ +    S
Sbjct  66   QPPQPSLDALPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRASELGQATAAAPPS  125

Query  512  IADKVNG---ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            + D +N       D + SP D  +E        R +EGK+ATDV
Sbjct  126  LPD-LNEEFVMEEDTDDSPVDPCVE--------RVLEGKEATDV  160



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 89/161 (55%), Gaps = 36/161 (22%)
 Frame = +2

Query  173  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGHADVYCPSRKRARITGP----FVVEVQE  337
            M  + +++G+ +F   GS+   A++ L L     D Y P  KR+R+       F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL----VDCYYPPCKRSRVVAAAPSLFSAFEEE  56

Query  338  KKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  514
            +KP SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+           
Sbjct  57   EKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL-----------  105

Query  515  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEG-KKATDV  634
                     DV     D   E +C+G LSRS++G KKATDV
Sbjct  106  ---------DV-----DNKTEDDCEGCLSRSLDGKKKATDV  132



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 66/105 (63%), Gaps = 15/105 (14%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI----FRSKSH  499
            Q  +PS++ LPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+      + S 
Sbjct  61   QPPQPSLDGLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRVSELGHAALAAPSL  120

Query  500  QDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             DL+    +   ++D   SPAD  +E        R +EG +ATDV
Sbjct  121  PDLNEEFVMEEGTDD---SPADPCVE--------RVLEGNEATDV  154



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 9/102 (9%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-FRSKSHQDL  508
            Q  +PS++ LPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+   + +   L
Sbjct  351  QPPQPSLDVLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRISELGHAAAAAPSL  410

Query  509  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               ++      D + SPAD  +E        R +EG +ATDV
Sbjct  411  PDLNEEFVMEEDTDDSPADPCVE--------RVLEGNEATDV  444



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 16/110 (15%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK------  493
            Q + PS++ALPDECLFE+ RRL GGRER ++ACVS+RWL L+ S+R SE+ ++       
Sbjct  62   QRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASELNQATAAAAAA  121

Query  494  ---SHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               S  DL+    +     + E SP         D  + R +EGK+ATDV
Sbjct  122  APPSLPDLNEEFVMEEDDEEEESSPV-------VDPCVERVLEGKEATDV  164



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 15/110 (14%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK------  493
            Q + PS++ALPDECLFE+ RRL GGRER ++ACVS+RWL L+ S+R SE+ ++       
Sbjct  54   QRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASELNQATAAAAAA  113

Query  494  ---SHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               S  DL+    +     + + S    D  VE      R +EGK+ATDV
Sbjct  114  APPSLPDLNEEFVMEEDDEEEKESSPVVDPCVE------RVLEGKEATDV  157



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 69/130 (53%), Gaps = 23/130 (18%)
 Frame = +2

Query  290  RKRARITG--PFVV------------EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAA  427
            RKRAR+T   P V             +   + PS++ALPDECLFEI RR+ G R R ++A
Sbjct  29   RKRARVTAVPPCVYAAVAAAAAAAKKQKLRETPSLDALPDECLFEILRRVQGARARGASA  88

Query  428  CVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASND-VEMSPADEDLEVECDGYLSR  604
            CVS+RWL L+  +R SEI R+++     +     G   D   +SP          G   R
Sbjct  89   CVSRRWLALLGGIRASEIKRAEAPAVPDLNQVFVGEDEDEAALSPR--------PGCSER  140

Query  605  SVEGKKATDV  634
            S+EG+ ATDV
Sbjct  141  SLEGEGATDV  150



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 66/130 (51%), Gaps = 28/130 (22%)
 Frame = +2

Query  248  LMLSLGHA-DVYCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSA  424
            L LS G   +V  P RKR  +T       Q   PSIE L DECLF++F+ L  G+ERS  
Sbjct  14   LFLSRGQNRNVNFPPRKRICVTTASKNFEQRNHPSIEILLDECLFKVFKHLPSGKERSVC  73

Query  425  ACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSR  604
            ACVSKRWL L+SS+R  +I  S            NG               +E  G L R
Sbjct  74   ACVSKRWLTLLSSIRKDKIPES------------NG---------------IEGKGSLVR  106

Query  605  SVEGKKATDV  634
            S+ G++ATDV
Sbjct  107  SLVGREATDV  116



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 61/101 (60%), Gaps = 7/101 (7%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  511
            Q + PS++ALPDECLFEI RR+ G   R +AACVS+RWL L+ S+R SE  ++ +  D  
Sbjct  56   QRQLPSLDALPDECLFEILRRVPG--RRGAAACVSRRWLALLGSIRVSEFGQAAAAADTP  113

Query  512  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                +N      E    ++  EV  D  + R +EGK+ATDV
Sbjct  114  SLPDLNE-----EFVMEEDKEEVPADRCVDRVLEGKEATDV  149



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 61/101 (60%), Gaps = 6/101 (6%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE-IFRSKSHQDL  508
            + ++PS++ALPDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE +    +    
Sbjct  41   RREEPSLDALPDECLFEVLRRVRGARARCASACVSRRWLALLAGIRASEAVLAPPAPAVP  100

Query  509  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATD  631
             +  +  G  +D E    D D +        R++EGK+ATD
Sbjct  101  DLNQEYLGGEDDDEADLMDHDGDAR-----ERTLEGKEATD  136



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  344  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  523
            PS++ALPDECLFEI RR+ G R R ++A VS+RWL L+  +R+SEI R  +   +   ++
Sbjct  75   PSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEIKREPAAAAVPDLNQ  134

Query  524  VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            V    ++ E    +  L   C     R +EG++ATDV
Sbjct  135  VFVDEDEEEEDEFEVPLGGGCSS--ERCLEGREATDV  169



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  344  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  523
            PS++ALPDECLFEI RR+ G R R ++A VS+RWL L+  +R+SEI R  +   +   ++
Sbjct  75   PSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEIKREPAAAAVPDLNQ  134

Query  524  VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            V    ++ E    +  L   C     R +EG++ATDV
Sbjct  135  VFVDEDEEEEDEFEVPLGGGCSS--ERCLEGREATDV  169



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  341  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE  478
            +PS++A+PDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE
Sbjct  43   EPSLDAVPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASE  88



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 11/101 (11%)
 Frame = +2

Query  344  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  523
            PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ ++ +  D      
Sbjct  66   PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAADTPSLPD  125

Query  524  VN----GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +N        D E SPAD      C   + R +EGK+ATDV
Sbjct  126  LNEEFVMEEEDKEESPAD-----RC--AVDRVLEGKEATDV  159



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 21/126 (17%)
 Frame = +2

Query  287  SRKRARITG---PFVVEVQEKKPS----IEALPDECLFEIFRRLSGGRERSSAACVSKRW  445
            SRKR   T    P     + +K      ++ALPDECLFE+ RR+ G R R ++ACVS+RW
Sbjct  18   SRKRVFATAAAEPVTAAPKRQKRGDEMPLDALPDECLFEVLRRVQGTRARCASACVSRRW  77

Query  446  LMLMSSVRNSE---IFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDG-YLSRSVE  613
            L L++ +R SE      + +  DL          N   +S  DE   ++ DG    R++E
Sbjct  78   LALLAGIRASEAVLAPAAPAVPDL----------NQEYLSEDDEADLMDLDGDARERTLE  127

Query  614  GKKATD  631
            G +ATD
Sbjct  128  GMEATD  133



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 16/79 (20%)
 Frame = +2

Query  287  SRKRARITG----PFVVEVQEK------------KPSIEALPDECLFEIFRRLSGGRERS  418
            SRKRAR+T      F   V+E+             PS++ALPDECLFEI RR+ G R R 
Sbjct  27   SRKRARVTAVPPCAFAEAVEEEVTAASKRQKRREAPSLDALPDECLFEILRRVKGARARC  86

Query  419  SAACVSKRWLMLMSSVRNS  475
            ++  VS+RWL L+ +  +S
Sbjct  87   ASGAVSRRWLALLGAFGDS  105



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 18/108 (17%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR-------S  490
            Q   PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ +       +
Sbjct  59   QLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAAADT  118

Query  491  KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S  DL   ++      D E SPAD  ++        R +EGK+ATDV
Sbjct  119  PSLPDL---NEEFVMEEDNEESPADRCVD--------RVLEGKEATDV  155



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 18/108 (17%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR-------S  490
            Q   PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ +       +
Sbjct  162  QLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAAADT  221

Query  491  KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             S  DL   ++      D E SPAD  ++        R +EGK+ATDV
Sbjct  222  PSLPDL---NEEFVMEEDNEESPADRCVD--------RVLEGKEATDV  258



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 59/117 (50%), Gaps = 14/117 (12%)
 Frame = +2

Query  284  PSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSS  463
            P++KR+R     + +    +  I  LPDEC++EIFR L   R+R   A VSK+WL + + 
Sbjct  55   PNKKRSRHQETSISDKISTQDLISYLPDECIWEIFRYLPSTRDRCCCAAVSKKWLAIQAK  114

Query  464  VRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
            +R SE F+SK              S+++  S    D       + SR +EGKKA D 
Sbjct  115  MRISE-FKSKPK------------SSNIITSALGLDHHKGSQKF-SRCLEGKKANDT  157



>ref|XP_001775242.1| predicted protein [Physcomitrella patens]
 gb|EDQ59978.1| predicted protein [Physcomitrella patens]
Length=619

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +2

Query  350  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  529
            I  LPDECL EIF  L   ++R +AA V  RWLML S ++  + F+ +S   L  A++V+
Sbjct  23   INDLPDECLQEIFGFLPKVQDRCAAAAVCMRWLMLQSRMQRGD-FKIESASMLGNANEVH  81

Query  530  GASNDVEMSPADEDLEVECD-----GYLSRSVEGKKATDV  634
               N++++   D +  V+       G LSR ++GK+ATDV
Sbjct  82   PCGNEIDIV-IDGEPRVQMQPQWVCGELSRILQGKEATDV  120



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 60/103 (58%), Gaps = 7/103 (7%)
 Frame = +2

Query  332  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVR--NSEIFRSKSHQD  505
            Q   PS++ALPD CLFEI RR+ GGR R ++ACVS+RWL L+ S+R        + +   
Sbjct  61   QLPLPSLDALPDGCLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELAQAAAAAADT  120

Query  506  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
             ++ D      N+  +   D+D E   D  + R +EGK+ATDV
Sbjct  121  PALPDL-----NEEFVMEEDKDDETPADSCVERVLEGKEATDV  158



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = +2

Query  314  PFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  493
            P        K  I  LPDEC+ EIFR L   R+R S   VSKRWL L +++R SE+    
Sbjct  63   PVRKSTSSNKDLINTLPDECILEIFRFLPSSRDRCSCVTVSKRWLALQATMRISELKSDP  122

Query  494  SHQDLSIADKVNGA-SNDVEMS  556
              ++  I++ + G  +ND  ++
Sbjct  123  KSRNNKISECLQGKNANDTRLA  144



>ref|XP_002986021.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
 gb|EFJ12840.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
Length=647

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 51/103 (50%), Gaps = 17/103 (17%)
 Frame = +2

Query  326  EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  505
            EV     S++ +PDE L  IF  +   R+RSS A V +RWLML++ +   E+ R    +D
Sbjct  64   EVGSSCSSMDGIPDEILVVIFGSILSARDRSSCASVCRRWLMLLTHMPRQELPREVCSED  123

Query  506  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
               A + + A  D                 LSR +EGKKATDV
Sbjct  124  SDDAKQPHWALGD-----------------LSRCLEGKKATDV  149



>ref|XP_002974778.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
 gb|EFJ24298.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
Length=630

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 61/128 (48%), Gaps = 27/128 (21%)
 Frame = +2

Query  260  LGHADVY-CPSRKRARITGPFVVEVQEKKPS--IEALPDECLFEIFRRLSGGRERSSAAC  430
            +G+ ++Y  P R         V   ++ +P   I ALPDE L E+FR ++   +R + A 
Sbjct  54   IGNTEIYNAPKRFLPTPPPTAVPAAKKYQPKDLINALPDELLVEVFRYVAAPADRYACAS  113

Query  431  VSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSV  610
            V  RWLML S + +SEI      Q+LS+                DE         L RS+
Sbjct  114  VCTRWLMLQSHLHSSEI--KDDEQELSLGS-------------GDE---------LKRSL  149

Query  611  EGKKATDV  634
            EGK+ATDV
Sbjct  150  EGKRATDV  157



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 8/100 (8%)
 Frame = +2

Query  350  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  529
            ++ +PDE L  IF  +   R+RSS A V +RWLML++ +   E+ R    +D    D VN
Sbjct  1    MDGIPDEILVVIFGSILSARDRSSCASVCRRWLMLLTHMPRQELPREVCSEDSD--DAVN  58

Query  530  GASNDVEMSPADEDLEVE-----CDGYLSRSVEGKKATDV  634
                    +P +E   +E       G LSR +EGKKATDV
Sbjct  59   QPCR-AGSAPQEEVWTLEKQPHWALGDLSRCLEGKKATDV  97



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 15/131 (11%)
 Frame = +3

Query  99   VVLILLQNLIFFALSLGVSSEKKQ---------PCLLLLITVVMMT-SLLGAHCALQIWA  248
            +++  L +L  FAL  G+S  ++Q          CL  LI+VV  T SL G +  +    
Sbjct  10   LIVFFLVDLAVFALGRGLSGLRRQLGFDQLCSATCLKCLISVVTRTFSLGGRYTQIPRSQ  69

Query  249  SCYLLVMRMFTAPLESGRGLPA--HLLL---KFRKRNHPSKLFLMNASLRSLDVCLGAVK  413
             C+  +  M+       RGL +  H+ L        + P K F MNASLRS  VC+G  +
Sbjct  70   ICFYPLDLMWMCFFHLARGLVSMPHMFLVEKSLSGSSPPLKFFQMNASLRSSGVCMGVQR  129

Query  414  GVPPLVFPSAG  446
             VP LV+ +AG
Sbjct  130  KVPVLVYLNAG  140



>ref|XP_006849175.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
 gb|ERN10756.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
Length=620

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 50/104 (48%), Gaps = 7/104 (7%)
 Frame = +2

Query  326  EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  505
            E  +    I  LPD+CL EIFR L    + S  A VSK+WL+L + +     F    H+ 
Sbjct  60   ETSDSTDLIGRLPDDCLTEIFRFLPVPLDHSLCAMVSKKWLLLQAQMHAFR-FTPTMHE-  117

Query  506  LSIADKVNGASNDVEMSPADEDLEV-ECDGYLSRSVEGKKATDV  634
                  VN      ++       E+ E  GYL+R +EGKKATD 
Sbjct  118  ----PTVNAMVTTYDVLEPWLSYELGERPGYLTRRLEGKKATDT  157



>ref|XP_002963689.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
 gb|EFJ35560.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
Length=542

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 47/95 (49%), Gaps = 24/95 (25%)
 Frame = +2

Query  350  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  529
            I ALP+E L E+FR ++   +R + A V  RWLML S + +SEI      Q+LS+     
Sbjct  1    INALPEELLVEVFRYVAAPADRYACASVCTRWLMLQSHLHSSEI--KDDEQELSLGS---  55

Query  530  GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDV  634
                       DE         L R +EGK+ATDV
Sbjct  56   ----------GDE---------LKRILEGKRATDV  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500