BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS131A10

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP39346.1|  hypothetical protein JCGZ_01103                         217   2e-61   Jatropha curcas
ref|XP_007034285.1|  Sucrose phosphate synthase 3F isoform 5            214   6e-61   
ref|XP_007034284.1|  Sucrose phosphate synthase 3F isoform 4            214   8e-61   
ref|XP_007034282.1|  Sucrose phosphate synthase 3F isoform 2            214   1e-60   
ref|XP_007034283.1|  Sucrose phosphate synthase 3F isoform 3            214   1e-60   
ref|XP_007034281.1|  Sucrose phosphate synthase 3F isoform 1            214   1e-60   
emb|CDP11144.1|  unnamed protein product                                214   1e-60   Coffea canephora [robusta coffee]
ref|XP_002518055.1|  sucrose phosphate syntase, putative                212   1e-59   Ricinus communis
gb|EYU31461.1|  hypothetical protein MIMGU_mgv1a000579mg                211   2e-59   Erythranthe guttata [common monkey flower]
ref|XP_011101558.1|  PREDICTED: probable sucrose-phosphate syntha...    209   1e-58   Sesamum indicum [beniseed]
ref|XP_008380516.1|  PREDICTED: probable sucrose-phosphate syntha...    208   2e-58   Malus domestica [apple tree]
gb|KDO39033.1|  hypothetical protein CISIN_1g001492mg                   208   2e-58   Citrus sinensis [apfelsine]
ref|XP_006420963.1|  hypothetical protein CICLE_v10004221mg             208   2e-58   Citrus clementina [clementine]
ref|XP_009618538.1|  PREDICTED: probable sucrose-phosphate syntha...    207   5e-58   Nicotiana tomentosiformis
ref|XP_009777937.1|  PREDICTED: probable sucrose-phosphate syntha...    207   6e-58   Nicotiana sylvestris
ref|XP_004296966.1|  PREDICTED: probable sucrose-phosphate syntha...    207   6e-58   Fragaria vesca subsp. vesca
ref|XP_006494166.1|  PREDICTED: probable sucrose-phosphate syntha...    206   9e-58   Citrus sinensis [apfelsine]
emb|CBI17227.3|  unnamed protein product                                205   2e-57   Vitis vinifera
emb|CAN78805.1|  hypothetical protein VITISV_017581                     205   3e-57   Vitis vinifera
ref|XP_002271398.1|  PREDICTED: probable sucrose-phosphate syntha...    205   3e-57   Vitis vinifera
ref|XP_008222839.1|  PREDICTED: probable sucrose-phosphate syntha...    205   3e-57   Prunus mume [ume]
ref|XP_011045619.1|  PREDICTED: probable sucrose-phosphate syntha...    205   3e-57   Populus euphratica
ref|XP_007225402.1|  hypothetical protein PRUPE_ppa000622mg             205   3e-57   Prunus persica
sp|O04933.1|SPSA2_CRAPL  RecName: Full=Probable sucrose-phosphate...    204   5e-57   Craterostigma plantagineum
ref|XP_011041945.1|  PREDICTED: probable sucrose-phosphate syntha...    204   8e-57   Populus euphratica
ref|XP_002298684.1|  hypothetical protein POPTR_0001s32500g             204   8e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010927691.1|  PREDICTED: probable sucrose-phosphate syntha...    203   2e-56   Elaeis guineensis
ref|XP_010264121.1|  PREDICTED: probable sucrose-phosphate syntha...    202   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010264118.1|  PREDICTED: probable sucrose-phosphate syntha...    202   3e-56   Nelumbo nucifera [Indian lotus]
gb|KHG20806.1|  putative sucrose-phosphate synthase 3 -like protein     202   4e-56   Gossypium arboreum [tree cotton]
ref|XP_010247961.1|  PREDICTED: probable sucrose-phosphate syntha...    202   4e-56   Nelumbo nucifera [Indian lotus]
gb|KJB72051.1|  hypothetical protein B456_011G155900                    201   4e-56   Gossypium raimondii
gb|KJB72049.1|  hypothetical protein B456_011G155900                    201   6e-56   Gossypium raimondii
ref|XP_006373074.1|  sucrose-phosphate synthase family protein          200   2e-55   Populus trichocarpa [western balsam poplar]
gb|AJG44459.1|  sucrose phosphate synthase                              200   2e-55   Lilium davidii var. unicolor
ref|XP_008794597.1|  PREDICTED: probable sucrose-phosphate syntha...    199   4e-55   Phoenix dactylifera
ref|XP_007146334.1|  hypothetical protein PHAVU_006G031700g             198   8e-55   Phaseolus vulgaris [French bean]
gb|ADT64795.4|  sucrose phosphate synthase                              197   1e-54   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009396792.1|  PREDICTED: sucrose-phosphate synthase              197   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES70069.2|  sucrose-phosphate synthase family protein               197   2e-54   Medicago truncatula
ref|XP_008457154.1|  PREDICTED: probable sucrose-phosphate syntha...    197   3e-54   Cucumis melo [Oriental melon]
ref|XP_004138938.1|  PREDICTED: probable sucrose-phosphate syntha...    197   3e-54   
ref|NP_001266150.1|  sucrose-phosphate synthase B                       195   8e-54   Solanum lycopersicum
ref|XP_010069011.1|  PREDICTED: probable sucrose-phosphate syntha...    195   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010522391.1|  PREDICTED: probable sucrose-phosphate syntha...    195   1e-53   Tarenaya hassleriana [spider flower]
gb|AGE43981.1|  sucrose phosphate synthase 1                            195   1e-53   Cucumis sativus [cucumbers]
ref|XP_004499982.1|  PREDICTED: probable sucrose-phosphate syntha...    194   2e-53   Cicer arietinum [garbanzo]
ref|XP_010522392.1|  PREDICTED: probable sucrose-phosphate syntha...    194   2e-53   Tarenaya hassleriana [spider flower]
gb|ABA64521.1|  sucrose-phosphate synthase isoform B                    194   2e-53   Nicotiana tabacum [American tobacco]
ref|XP_006857652.1|  hypothetical protein AMTR_s00061p00145220          194   3e-53   Amborella trichopoda
ref|XP_006360944.1|  PREDICTED: probable sucrose-phosphate syntha...    194   3e-53   Solanum tuberosum [potatoes]
gb|ABW89596.1|  sucrose phosphate synthase B                            189   1e-52   Medicago sativa [alfalfa]
gb|KHN11970.1|  Putative sucrose-phosphate synthase 3                   192   1e-52   Glycine soja [wild soybean]
ref|XP_003545147.1|  PREDICTED: probable sucrose-phosphate syntha...    192   1e-52   Glycine max [soybeans]
gb|KHM99635.1|  Putative sucrose-phosphate synthase 3                   192   1e-52   Glycine soja [wild soybean]
ref|XP_003532093.1|  PREDICTED: probable sucrose-phosphate syntha...    192   1e-52   Glycine max [soybeans]
ref|XP_002892252.1|  ATSPS3F                                            191   2e-52   
ref|XP_006418081.1|  hypothetical protein EUTSA_v10006639mg             191   2e-52   Eutrema salsugineum [saltwater cress]
ref|NP_171984.2|  sucrose-phosphate synthase                            191   4e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAF40445.1|AC004809_3  Strong similarity to the sucrose-phosph...    190   5e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KHN18081.1|  Putative sucrose-phosphate synthase 3                   189   1e-51   Glycine soja [wild soybean]
ref|XP_003553129.1|  PREDICTED: probable sucrose-phosphate syntha...    189   1e-51   Glycine max [soybeans]
ref|XP_004166159.1|  PREDICTED: probable sucrose-phosphate syntha...    189   1e-51   
ref|XP_006306646.1|  hypothetical protein CARUB_v10008160mg             188   3e-51   Capsella rubella
ref|XP_003617418.1|  Sucrose-phosphate synthase                         188   3e-51   Medicago truncatula
ref|XP_010457558.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    187   1e-50   
ref|XP_010484393.1|  PREDICTED: probable sucrose-phosphate syntha...    186   1e-50   Camelina sativa [gold-of-pleasure]
emb|CDX89776.1|  BnaA10g03060D                                          186   1e-50   
ref|XP_003599818.1|  Sucrose-phosphate synthase                         185   3e-50   
ref|XP_010929745.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    185   4e-50   Elaeis guineensis
ref|XP_010475162.1|  PREDICTED: probable sucrose-phosphate syntha...    185   4e-50   
emb|CDY18270.1|  BnaC05g02930D                                          184   6e-50   Brassica napus [oilseed rape]
ref|XP_009119233.1|  PREDICTED: probable sucrose-phosphate syntha...    182   6e-49   Brassica rapa
gb|KFK42840.1|  hypothetical protein AALP_AA1G045800                    179   7e-48   Arabis alpina [alpine rockcress]
gb|AEO46461.1|  sucrose phosphate synthase B                            176   5e-47   Saccharum hybrid cultivar ROC22
ref|XP_008794976.1|  PREDICTED: probable sucrose-phosphate syntha...    174   4e-46   Phoenix dactylifera
ref|NP_001105694.1|  sucrose-phosphate synthase                         173   8e-46   Zea mays [maize]
gb|AAR84220.1|  sucrose-phosphate synthase                              159   3e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008674664.1|  PREDICTED: sucrose-phosphate synthase-like         171   5e-45   Zea mays [maize]
ref|XP_002458991.1|  hypothetical protein SORBIDRAFT_03g043900          170   6e-45   Sorghum bicolor [broomcorn]
ref|XP_004491325.1|  PREDICTED: probable sucrose-phosphate syntha...    169   2e-44   Cicer arietinum [garbanzo]
gb|AAC49379.1|  sucrose phosphate synthase                              168   5e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_006645236.1|  PREDICTED: probable sucrose-phosphate syntha...    167   8e-44   
emb|CDM85683.1|  unnamed protein product                                165   6e-43   Triticum aestivum [Canadian hard winter wheat]
gb|KDO42450.1|  hypothetical protein CISIN_1g001705mg                   164   7e-43   Citrus sinensis [apfelsine]
ref|XP_006478341.1|  PREDICTED: probable sucrose-phosphate syntha...    164   8e-43   Citrus sinensis [apfelsine]
ref|XP_003564935.1|  PREDICTED: sucrose-phosphate synthase              163   2e-42   Brachypodium distachyon [annual false brome]
sp|A2WYE9.2|SPSA1_ORYSI  RecName: Full=Probable sucrose-phosphate...    161   8e-42   Oryza sativa Indica Group [Indian rice]
gb|KDP31602.1|  hypothetical protein JCGZ_14827                         161   1e-41   Jatropha curcas
dbj|BAA08304.1|  sucrose phosphate synthase                             161   1e-41   Oryza sativa Japonica Group [Japonica rice]
emb|CAC81823.1|  sucrose-phosphate synthase                             151   1e-41   Beta vulgaris [beet]
ref|XP_007019751.1|  Sucrose-phosphate synthase family protein is...    160   1e-41   
ref|XP_007019750.1|  Sucrose-phosphate synthase family protein is...    160   1e-41   
ref|XP_002521744.1|  sucrose phosphate syntase, putative                160   2e-41   Ricinus communis
ref|XP_002319320.2|  sucrose-phosphate synthase family protein          159   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011011070.1|  PREDICTED: probable sucrose-phosphate syntha...    159   5e-41   Populus euphratica
ref|XP_006836877.1|  hypothetical protein AMTR_s00099p00104230          158   1e-40   Amborella trichopoda
gb|ADG01610.1|  sucrose phosphate synthase                              158   1e-40   Xerophyta humilis
ref|XP_008786458.1|  PREDICTED: probable sucrose-phosphate syntha...    157   2e-40   Phoenix dactylifera
ref|XP_002873988.1|  ATSPS1F                                            157   2e-40   
ref|NP_197528.1|  sucrose phosphate synthase 1F                         157   2e-40   Arabidopsis thaliana [mouse-ear cress]
sp|P31928.1|SPSA_SPIOL  RecName: Full=Sucrose-phosphate synthase;...    157   3e-40   Spinacia oleracea
gb|KJB65850.1|  hypothetical protein B456_010G116100                    156   4e-40   Gossypium raimondii
ref|XP_008443934.1|  PREDICTED: probable sucrose-phosphate syntha...    157   4e-40   Cucumis melo [Oriental melon]
ref|XP_007199693.1|  hypothetical protein PRUPE_ppa000716mg             156   4e-40   
ref|XP_010252403.1|  PREDICTED: probable sucrose-phosphate syntha...    156   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008237831.1|  PREDICTED: probable sucrose-phosphate syntha...    155   1e-39   Prunus mume [ume]
ref|XP_010048168.1|  PREDICTED: probable sucrose-phosphate syntha...    154   2e-39   Eucalyptus grandis [rose gum]
ref|XP_007011815.1|  Sucrose phosphate synthase 1F                      154   2e-39   Theobroma cacao [chocolate]
ref|XP_009348252.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    151   3e-39   
gb|AHE93347.1|  sucrose phosphate synthase 1                            153   5e-39   Camellia sinensis [black tea]
ref|XP_002324874.1|  sucrose-phosphate synthase family protein          153   6e-39   
ref|NP_001267857.1|  sucrose-phosphate synthase 1                       153   6e-39   Vitis vinifera
ref|XP_010062352.1|  PREDICTED: probable sucrose-phosphate syntha...    153   6e-39   Eucalyptus grandis [rose gum]
ref|XP_002972277.1|  sucrose phosphate synthase                         153   7e-39   
gb|ABG67969.1|  putative sucrose phosphate synthase                     150   9e-39   Gossypium hirsutum [American cotton]
ref|XP_006582436.1|  PREDICTED: probable sucrose-phosphate syntha...    150   9e-39   
ref|XP_008348712.1|  PREDICTED: probable sucrose-phosphate syntha...    152   1e-38   
ref|XP_008381670.1|  PREDICTED: probable sucrose-phosphate syntha...    152   1e-38   
ref|XP_010696531.1|  PREDICTED: sucrose-phosphate synthase              152   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006483396.1|  PREDICTED: probable sucrose-phosphate syntha...    152   2e-38   Citrus sinensis [apfelsine]
ref|XP_006450383.1|  hypothetical protein CICLE_v10007312mg             152   2e-38   Citrus clementina [clementine]
ref|XP_010520567.1|  PREDICTED: sucrose-phosphate synthase 1            151   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_011036585.1|  PREDICTED: probable sucrose-phosphate syntha...    151   3e-38   Populus euphratica
ref|XP_002515487.1|  sucrose phosphate syntase, putative                151   3e-38   
gb|EPS71734.1|  sucrose-phosphate synthase 1                            150   4e-38   Genlisea aurea
ref|XP_004292975.1|  PREDICTED: probable sucrose-phosphate syntha...    150   5e-38   Fragaria vesca subsp. vesca
gb|KJB27353.1|  hypothetical protein B456_004G292800                    150   5e-38   Gossypium raimondii
dbj|BAP47500.1|  sucrose phosphate synthase                             150   5e-38   Gentiana triflora
emb|CDY45096.1|  BnaA02g04800D                                          150   5e-38   Brassica napus [oilseed rape]
ref|XP_009404836.1|  PREDICTED: probable sucrose-phosphate syntha...    150   5e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFM46031.1|  sucrose phosphate synthase                              150   6e-38   Gossypium hirsutum [American cotton]
gb|KHG17450.1|  Solanesyl diphosphate synthase 1                        150   6e-38   Gossypium arboreum [tree cotton]
ref|XP_003526395.1|  PREDICTED: probable sucrose-phosphate syntha...    150   6e-38   Glycine max [soybeans]
gb|EEE55897.1|  hypothetical protein OsJ_04561                          150   6e-38   Oryza sativa Japonica Group [Japonica rice]
gb|AAC23914.1|  sucrose-phosphate synthase                              147   7e-38   Musa acuminata AAA Group [Cavendish banana]
gb|KJB27352.1|  hypothetical protein B456_004G292800                    150   7e-38   Gossypium raimondii
gb|KHG17451.1|  Solanesyl diphosphate synthase 1                        150   7e-38   Gossypium arboreum [tree cotton]
gb|EEC72045.1|  hypothetical protein OsI_04951                          150   7e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_008795846.1|  PREDICTED: probable sucrose-phosphate syntha...    150   7e-38   Phoenix dactylifera
gb|AAF06792.1|AF194022_1  sucrose-6-phosphate synthase A                150   9e-38   Nicotiana tabacum [American tobacco]
emb|CBI17025.3|  unnamed protein product                                149   1e-37   Vitis vinifera
gb|KHG18731.1|  putative sucrose-phosphate synthase 4                   149   1e-37   Gossypium arboreum [tree cotton]
gb|AGA82513.1|  sucrose phosphate synthase                              149   1e-37   Camellia sinensis [black tea]
gb|KHG18729.1|  putative sucrose-phosphate synthase 4                   150   1e-37   Gossypium arboreum [tree cotton]
emb|CBI21066.3|  unnamed protein product                                149   1e-37   Vitis vinifera
ref|XP_002282808.1|  PREDICTED: probable sucrose-phosphate syntha...    149   1e-37   Vitis vinifera
ref|XP_009774296.1|  PREDICTED: probable sucrose-phosphate synthase     149   2e-37   Nicotiana sylvestris
ref|XP_010910717.1|  PREDICTED: probable sucrose-phosphate syntha...    145   2e-37   Elaeis guineensis
gb|AAC60545.2|  sucrose-phosphate synthase                              148   4e-37   Spinacia oleracea
tpg|DAA56138.1|  TPA: putative sucrose-phosphate synthase family ...    148   5e-37   
emb|CDP11522.1|  unnamed protein product                                147   6e-37   Coffea canephora [robusta coffee]
ref|XP_002969539.1|  sucrose phosphate synthase                         147   6e-37   
gb|KJB59576.1|  hypothetical protein B456_009G262100                    147   7e-37   Gossypium raimondii
ref|NP_001289997.1|  probable sucrose-phosphate synthase                147   8e-37   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX94270.1|  BnaC02g29300D                                          144   9e-37   
gb|KJB59577.1|  hypothetical protein B456_009G262100                    147   9e-37   Gossypium raimondii
ref|XP_006397097.1|  hypothetical protein EUTSA_v10028384mg             147   1e-36   Eutrema salsugineum [saltwater cress]
gb|KDP33569.1|  hypothetical protein JCGZ_07140                         147   1e-36   Jatropha curcas
ref|XP_006352069.1|  PREDICTED: probable sucrose-phosphate syntha...    146   2e-36   Solanum tuberosum [potatoes]
ref|XP_004250761.1|  PREDICTED: probable sucrose-phosphate syntha...    146   2e-36   Solanum lycopersicum
ref|XP_002449293.1|  hypothetical protein SORBIDRAFT_05g007310          146   2e-36   
gb|ADG01611.1|  sucrose phosphate synthase                              145   3e-36   Xerophyta humilis
ref|XP_009128722.1|  PREDICTED: probable sucrose-phosphate syntha...    145   4e-36   Brassica rapa
gb|KFK25382.1|  hypothetical protein AALP_AA8G106300                    145   4e-36   Arabis alpina [alpine rockcress]
emb|CDY41124.1|  BnaA02g23460D                                          145   5e-36   Brassica napus [oilseed rape]
ref|XP_010456485.1|  PREDICTED: probable sucrose-phosphate syntha...    144   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_007148633.1|  hypothetical protein PHAVU_005G002600g             144   8e-36   Phaseolus vulgaris [French bean]
ref|XP_010419666.1|  PREDICTED: probable sucrose-phosphate syntha...    144   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010491806.1|  PREDICTED: probable sucrose-phosphate syntha...    144   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004971065.1|  PREDICTED: probable sucrose-phosphate syntha...    134   1e-35   
gb|AJG44460.1|  sucrose phosphate synthase                              134   2e-35   Lilium davidii var. unicolor
ref|XP_002871456.1|  ATSPS2F                                            143   3e-35   
dbj|BAA19241.1|  Sucrose-Phosphate Synthase                             142   4e-35   Saccharum officinarum [noble cane]
gb|AFW61932.1|  putative sucrose-phosphate synthase family protein      134   5e-35   
gb|AAP94624.1|  sucrose phosphate synthase                              141   7e-35   Viscum album subsp. album
ref|XP_008678023.1|  PREDICTED: probable sucrose-phosphate syntha...    141   1e-34   Zea mays [maize]
ref|XP_006286964.1|  hypothetical protein CARUB_v10000113mg             141   1e-34   Capsella rubella
ref|XP_008441196.1|  PREDICTED: probable sucrose-phosphate syntha...    140   2e-34   Cucumis melo [Oriental melon]
ref|XP_006399612.1|  hypothetical protein EUTSA_v10012643mg             140   2e-34   
ref|XP_010110858.1|  hypothetical protein L484_005397                   130   3e-34   
ref|XP_010455412.1|  PREDICTED: probable sucrose-phosphate syntha...    139   3e-34   Camelina sativa [gold-of-pleasure]
dbj|BAD43701.1|  sucrose-phosphate synthase - like protein              139   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192750.2|  probable sucrose-phosphate synthase 4                 139   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010555013.1|  PREDICTED: probable sucrose-phosphate syntha...    139   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_010437512.1|  PREDICTED: probable sucrose-phosphate syntha...    139   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006286963.1|  hypothetical protein CARUB_v10000112mg             139   4e-34   
emb|CAB39764.1|  sucrose-phosphate synthase-like protein                139   4e-34   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94390.1|  sucrose-phosphate synthase - like protein              139   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009607707.1|  PREDICTED: probable sucrose-phosphate syntha...    139   4e-34   Nicotiana tomentosiformis
ref|XP_002872492.1|  ATSPS4F                                            139   5e-34   
gb|EYU22701.1|  hypothetical protein MIMGU_mgv1a000604mg                139   5e-34   Erythranthe guttata [common monkey flower]
ref|XP_010241591.1|  PREDICTED: probable sucrose-phosphate syntha...    139   6e-34   Nelumbo nucifera [Indian lotus]
gb|EMS59564.1|  hypothetical protein TRIUR3_20316                       131   6e-34   Triticum urartu
ref|XP_009358563.1|  PREDICTED: probable sucrose-phosphate syntha...    139   7e-34   Pyrus x bretschneideri [bai li]
ref|XP_008336979.1|  PREDICTED: probable sucrose-phosphate syntha...    139   7e-34   
dbj|BAJ90127.1|  predicted protein                                      139   7e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAN11294.1|  sucrose phosphate synthase                              138   9e-34   Oncidium hybrid cultivar
gb|AEG78833.1|  sucrose phosphate synthase                              138   9e-34   Dendrobium officinale
ref|XP_011093228.1|  PREDICTED: probable sucrose-phosphate syntha...    138   1e-33   Sesamum indicum [beniseed]
gb|ABA64520.1|  sucrose-phosphate synthase isoform C                    138   1e-33   Nicotiana tabacum [American tobacco]
gb|EYU32355.1|  hypothetical protein MIMGU_mgv1a000596mg                138   1e-33   Erythranthe guttata [common monkey flower]
ref|XP_009340653.1|  PREDICTED: probable sucrose-phosphate syntha...    137   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_004138659.1|  PREDICTED: probable sucrose-phosphate syntha...    137   2e-33   
gb|AEN84000.1|  sucrose-phosphate synthase                              137   2e-33   Cucumis sativus [cucumbers]
ref|XP_004290259.1|  PREDICTED: probable sucrose-phosphate syntha...    137   2e-33   Fragaria vesca subsp. vesca
emb|CDX78411.1|  BnaA03g03230D                                          137   2e-33   
ref|XP_009131196.1|  PREDICTED: probable sucrose-phosphate syntha...    137   2e-33   Brassica rapa
ref|XP_010099850.1|  putative sucrose-phosphate synthase 1              137   2e-33   
dbj|BAJ88991.1|  predicted protein                                      135   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO73470.1|  hypothetical protein CISIN_1g001541mg                   137   3e-33   Citrus sinensis [apfelsine]
sp|O22060.1|SPSA1_CITUN  RecName: Full=Probable sucrose-phosphate...    137   3e-33   Citrus unshiu [satsuma mandarin]
ref|XP_006453095.1|  hypothetical protein CICLE_v10007311mg             137   3e-33   Citrus clementina [clementine]
ref|XP_010421935.1|  PREDICTED: probable sucrose-phosphate syntha...    137   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010250237.1|  PREDICTED: probable sucrose-phosphate syntha...    137   3e-33   
ref|XP_010250236.1|  PREDICTED: probable sucrose-phosphate syntha...    137   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_008385228.1|  PREDICTED: probable sucrose-phosphate syntha...    137   3e-33   
ref|XP_008242829.1|  PREDICTED: probable sucrose-phosphate syntha...    136   4e-33   Prunus mume [ume]
gb|ABV32551.1|  sucrose phosphate synthase protein 1                    136   4e-33   Prunus persica
gb|EPS69735.1|  hypothetical protein M569_05029                         136   5e-33   Genlisea aurea
ref|XP_007204296.1|  hypothetical protein PRUPE_ppa000639mg             136   5e-33   Prunus persica
ref|XP_010111723.1|  hypothetical protein L484_006594                   125   5e-33   
gb|AAQ14552.1|AF310160_1  sucrose-phosphate synthase                    136   5e-33   Triticum aestivum [Canadian hard winter wheat]
gb|EMT02687.1|  Sucrose-phosphate synthase 1                            136   6e-33   
gb|AAG01888.1|  sucrose phosphate synthase                              129   6e-33   Ipomoea batatas [batate]
ref|XP_006659287.1|  PREDICTED: probable sucrose-phosphate syntha...    135   7e-33   Oryza brachyantha
ref|XP_009363963.1|  PREDICTED: probable sucrose-phosphate syntha...    135   8e-33   Pyrus x bretschneideri [bai li]
ref|NP_001170108.1|  putative sucrose-phosphate synthase family p...    134   8e-33   
gb|AFW61934.1|  putative sucrose-phosphate synthase family protein      133   8e-33   
gb|ACI23258.1|  sucrose phosphate synthase                              125   9e-33   Gossypium hirsutum [American cotton]
ref|XP_009786823.1|  PREDICTED: probable sucrose-phosphate syntha...    135   1e-32   Nicotiana sylvestris
ref|XP_009418508.1|  PREDICTED: probable sucrose-phosphate syntha...    135   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418507.1|  PREDICTED: probable sucrose-phosphate syntha...    135   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006852870.1|  hypothetical protein AMTR_s00033p00204130          135   2e-32   
gb|ABX59534.1|  sucrose phosphate synthase II                           135   2e-32   Saccharum officinarum [noble cane]
emb|CDX70382.1|  BnaC03g04660D                                          134   2e-32   
ref|XP_009126436.1|  PREDICTED: sucrose-phosphate synthase 1-like       134   2e-32   Brassica rapa
gb|AFP23360.1|  sucrose phosphate synthase                              134   3e-32   Litchi chinensis [litchi]
sp|O04932.1|SPSA1_CRAPL  RecName: Full=Probable sucrose-phosphate...    134   3e-32   Craterostigma plantagineum
ref|XP_004167243.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    134   3e-32   
ref|XP_004150653.1|  PREDICTED: probable sucrose-phosphate syntha...    134   3e-32   
dbj|BAM68535.1|  sucrose phosphate synthase                             134   3e-32   Mangifera indica
dbj|BAM37540.1|  sucrose phosphate synthase                             134   3e-32   Mangifera indica
ref|XP_003573681.1|  PREDICTED: probable sucrose-phosphate syntha...    134   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_009395490.1|  PREDICTED: probable sucrose-phosphate syntha...    134   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL34531.1|AF439861_1  sucrose-phosphate synthase                    133   5e-32   Ipomoea batatas [batate]
ref|XP_011084090.1|  PREDICTED: probable sucrose-phosphate syntha...    133   5e-32   Sesamum indicum [beniseed]
gb|ACN89831.2|  sucrose phosphate synthase B3                           130   5e-32   Medicago sativa [alfalfa]
emb|CDM80277.1|  unnamed protein product                                133   5e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009802041.1|  PREDICTED: probable sucrose-phosphate syntha...    133   5e-32   Nicotiana sylvestris
gb|EEC67927.1|  hypothetical protein OsI_35637                          133   5e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_008677664.1|  PREDICTED: uncharacterized protein LOC100384...    133   5e-32   
ref|XP_009613348.1|  PREDICTED: probable sucrose-phosphate syntha...    133   5e-32   Nicotiana tomentosiformis
dbj|BAM68537.1|  sucrose phosphate synthase                             133   6e-32   Mangifera indica
dbj|BAM68530.1|  sucrose phosphate synthase                             133   6e-32   Mangifera indica
ref|XP_011095228.1|  PREDICTED: probable sucrose-phosphate syntha...    133   6e-32   Sesamum indicum [beniseed]
ref|XP_006345631.1|  PREDICTED: probable sucrose-phosphate syntha...    133   6e-32   Solanum tuberosum [potatoes]
ref|XP_011095234.1|  PREDICTED: probable sucrose-phosphate syntha...    133   7e-32   Sesamum indicum [beniseed]
gb|ADL70859.1|  sucrose phosphate synthase A                            133   7e-32   Saccharum hybrid cultivar ROC22
ref|XP_011078416.1|  PREDICTED: probable sucrose-phosphate syntha...    133   7e-32   Sesamum indicum [beniseed]
ref|XP_011078414.1|  PREDICTED: probable sucrose-phosphate syntha...    133   7e-32   
gb|KDP30238.1|  hypothetical protein JCGZ_17020                         133   8e-32   Jatropha curcas
gb|KFK26237.1|  hypothetical protein AALP_AA8G221000                    132   1e-31   Arabis alpina [alpine rockcress]
ref|NP_001266250.1|  sucrose-phosphate synthase A2                      132   1e-31   Solanum lycopersicum
ref|XP_006400595.1|  hypothetical protein EUTSA_v10012540mg             132   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_002441522.1|  hypothetical protein SORBIDRAFT_09g028570          132   1e-31   Sorghum bicolor [broomcorn]
ref|XP_009120820.1|  PREDICTED: sucrose-phosphate synthase 1            132   1e-31   Brassica rapa
gb|EYU18237.1|  hypothetical protein MIMGU_mgv1a000621mg                132   1e-31   Erythranthe guttata [common monkey flower]
emb|CDY35815.1|  BnaC09g37470D                                          132   1e-31   Brassica napus [oilseed rape]
ref|XP_011020206.1|  PREDICTED: probable sucrose-phosphate syntha...    132   1e-31   Populus euphratica
emb|CDX92473.1|  BnaA10g15120D                                          132   1e-31   
gb|KJB83218.1|  hypothetical protein B456_013G235900                    132   1e-31   Gossypium raimondii
ref|XP_002265473.1|  PREDICTED: probable sucrose-phosphate syntha...    132   2e-31   Vitis vinifera
emb|CBI25540.3|  unnamed protein product                                132   2e-31   Vitis vinifera
ref|XP_004287272.1|  PREDICTED: probable sucrose-phosphate syntha...    131   2e-31   Fragaria vesca subsp. vesca
ref|XP_008788819.1|  PREDICTED: probable sucrose-phosphate syntha...    131   3e-31   
ref|XP_010928318.1|  PREDICTED: probable sucrose-phosphate syntha...    131   3e-31   Elaeis guineensis
ref|XP_010420869.1|  PREDICTED: sucrose-phosphate synthase 1-like       131   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010913331.1|  PREDICTED: probable sucrose-phosphate syntha...    131   3e-31   Elaeis guineensis
ref|XP_010493137.1|  PREDICTED: sucrose-phosphate synthase 1-like       131   3e-31   
ref|XP_010454335.1|  PREDICTED: sucrose-phosphate synthase 1            131   4e-31   
ref|XP_010057603.1|  PREDICTED: probable sucrose-phosphate syntha...    130   4e-31   
ref|XP_003577676.1|  PREDICTED: probable sucrose-phosphate syntha...    130   5e-31   
emb|CDX88168.1|  BnaA06g27590D                                          130   5e-31   
gb|AAC39434.1|  sucrose-phosphate synthase                              128   5e-31   
emb|CDX80498.1|  BnaC07g29460D                                          130   5e-31   
ref|XP_009151050.1|  PREDICTED: probable sucrose-phosphate syntha...    130   6e-31   
ref|XP_006381105.1|  sucrose-phosphate synthase family protein          130   7e-31   
gb|ABK29437.1|  sucrose phosphate synthase                              130   9e-31   
gb|ABI17900.1|  sucrose phosphate synthase                              130   9e-31   
emb|CDP10465.1|  unnamed protein product                                129   1e-30   
gb|AGE43982.1|  sucrose phosphate synthase 2                            130   1e-30   
ref|XP_007013574.1|  Sucrose phosphate synthase 1F                      129   1e-30   
ref|XP_011017846.1|  PREDICTED: probable sucrose-phosphate syntha...    129   1e-30   
gb|AHH86105.1|  sucrose-phosphate synthase                              129   1e-30   
ref|NP_001275243.1|  probable sucrose-phosphate synthase                129   1e-30   
gb|AAZ85400.1|  sucrose-phosphate synthase 2                            129   2e-30   
ref|XP_001764226.1|  predicted protein                                  129   2e-30   
ref|XP_006389442.1|  hypothetical protein POPTR_0025s00740g             129   2e-30   
ref|XP_010112056.1|  putative sucrose-phosphate synthase 4              129   3e-30   
gb|AAL86360.1|  sucrose phosphate synthase                              128   4e-30   
ref|NP_001234839.1|  sucrose phosphate synthase                         127   5e-30   
gb|ABF47344.1|  sucrose phosphate synthase                              127   5e-30   
dbj|BAI39704.1|  putative sucrose-phosphate synthase                    127   5e-30   
gb|AFW61931.1|  putative sucrose-phosphate synthase family protein      118   5e-30   
gb|ABC96184.1|  sucrose phosphate synthase                              127   5e-30   
ref|NP_001061495.1|  Os08g0301500                                       127   6e-30   
gb|AAQ56529.1|  putative sucrosephosphate synthase                      127   6e-30   
sp|Q43845.1|SPSA_SOLTU  RecName: Full=Probable sucrose-phosphate ...    127   7e-30   
ref|XP_010324849.1|  PREDICTED: sucrose-phosphate synthase A2 iso...    127   7e-30   
ref|XP_006646988.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    127   9e-30   
ref|XP_008219524.1|  PREDICTED: probable sucrose-phosphate syntha...    127   9e-30   
gb|EPS59759.1|  sucrose-phosphate synthase 1                            124   1e-29   
ref|XP_007225404.1|  hypothetical protein PRUPE_ppa000636mg             125   2e-29   
gb|ABV32550.1|  sucrose phosphate synthase protein 2                    125   2e-29   
ref|NP_001233920.1|  sucrose-phosphate synthase                         125   3e-29   
ref|XP_004973187.1|  PREDICTED: probable sucrose-phosphate syntha...    125   4e-29   
ref|XP_001770952.1|  predicted protein                                  125   4e-29   
ref|XP_007155064.1|  hypothetical protein PHAVU_003G170100g             124   8e-29   
gb|ABX80100.1|  sucrose phosphate synthase III                          124   9e-29   
gb|AFW70480.1|  putative sucrose-phosphate synthase family protein      124   9e-29   
gb|ACX94229.1|  sucrose phosphate synthase                              124   9e-29   
ref|XP_004508449.1|  PREDICTED: probable sucrose-phosphate syntha...    124   9e-29   
ref|XP_003609431.1|  Sucrose-phosphate synthase                         124   9e-29   
gb|ADM63847.1|  sucrose phosphate synthase                              124   1e-28   
ref|XP_002451675.1|  hypothetical protein SORBIDRAFT_04g005720          124   1e-28   
gb|AAK09427.2|AF322116_1  sucrose-phosphate synthase                    124   1e-28   
sp|Q43876.1|SPSA_VICFA  RecName: Full=Probable sucrose-phosphate ...    123   1e-28   
ref|NP_001281029.1|  probable sucrose-phosphate synthase 1              123   2e-28   
gb|AAR16190.1|  sucrose-phosphate synthase                              123   2e-28   
ref|XP_008645337.1|  PREDICTED: probable sucrose-phosphate syntha...    123   2e-28   
gb|KHG14876.1|  Sucrose-phosphate synthase                              119   2e-28   
gb|KHN15044.1|  Putative sucrose-phosphate synthase                     123   2e-28   
ref|XP_003549735.1|  PREDICTED: probable sucrose-phosphate syntha...    123   2e-28   
dbj|BAE80113.1|  sucrose phosphate synthase                             123   2e-28   
ref|XP_009355773.1|  PREDICTED: probable sucrose-phosphate syntha...    123   2e-28   
ref|XP_004173723.1|  PREDICTED: probable sucrose-phosphate syntha...    113   2e-28   
ref|XP_009346170.1|  PREDICTED: probable sucrose-phosphate syntha...    123   2e-28   
dbj|BAG30918.1|  sucrose phosphate synthase                             122   3e-28   
ref|XP_004951663.1|  PREDICTED: probable sucrose-phosphate syntha...    122   3e-28   
gb|AAC24872.3|  sucrose-phosphate synthase                              122   4e-28   
gb|ABX80099.1|  sucrose phosphate synthase III                          122   4e-28   
ref|XP_006389443.1|  sucrose-phosphate synthase family protein          122   5e-28   
ref|NP_196672.3|  sucrose phosphate synthase 2F                         121   8e-28   
ref|XP_003570834.1|  PREDICTED: probable sucrose-phosphate syntha...    121   9e-28   
dbj|BAJ97760.1|  predicted protein                                      120   2e-27   
ref|NP_001046108.2|  Os02g0184400                                       120   2e-27   
sp|B7F7B9.2|SPSA2_ORYSJ  RecName: Full=Probable sucrose-phosphate...    120   2e-27   
ref|XP_002531942.1|  sucrose phosphate syntase, putative                120   3e-27   
gb|AAQ10452.1|  sucrose-phosphate synthase 9                            119   3e-27   
gb|EMT16959.1|  Sucrose-phosphate synthase                              119   3e-27   
ref|XP_003542649.1|  PREDICTED: probable sucrose-phosphate synthase     119   4e-27   
gb|ABV90637.1|  sucrose-phosphate synthase                              119   5e-27   
gb|EEC72629.1|  hypothetical protein OsI_06131                          118   7e-27   
ref|XP_003563303.1|  PREDICTED: probable sucrose-phosphate syntha...    117   3e-26   
gb|AAX95197.1|  Similar to sucrose phosphate synthase                   110   4e-26   
gb|AGK07273.1|  sucrose phosphate synthase III                          105   1e-25   
gb|EMS63629.1|  Sucrose-phosphate synthase 1                            114   2e-25   
gb|EAZ06480.1|  hypothetical protein OsI_28718                          114   2e-25   
ref|XP_008648202.1|  PREDICTED: uncharacterized protein LOC100384...    113   4e-25   
ref|XP_008648203.1|  PREDICTED: uncharacterized protein LOC100384...    113   4e-25   
dbj|BAK00548.1|  predicted protein                                      112   4e-25   
gb|KHN47105.1|  Putative sucrose-phosphate synthase                     112   9e-25   
gb|EMT03664.1|  Sucrose-phosphate synthase 1                            111   2e-24   
dbj|BAA19242.1|  sucrose-phosphate synthase                             111   2e-24   
gb|EAZ42258.1|  hypothetical protein OsJ_26822                          108   2e-23   
ref|XP_004965756.1|  PREDICTED: probable sucrose-phosphate syntha...    108   3e-23   
ref|XP_006663318.1|  PREDICTED: probable sucrose-phosphate syntha...    107   7e-23   
gb|AGT16394.1|  sucrose-phosphate synthase                              106   9e-23   
sp|Q67WN8.1|SPSA3_ORYSJ  RecName: Full=Probable sucrose-phosphate...    106   1e-22   
gb|EEE51891.1|  hypothetical protein OsJ_33470                          100   2e-22   
gb|AGT17176.1|  sucrose phosphate synthase III                          104   5e-22   
gb|KCW74793.1|  hypothetical protein EUGRSUZ_E03528                     103   7e-22   
ref|XP_002438738.1|  hypothetical protein SORBIDRAFT_10g025240          103   8e-22   
gb|AGT17001.1|  sucrose-phosphate synthase                              103   8e-22   
gb|AGT15920.1|  sucrose-phosphate synthase                            99.8    2e-20   
gb|EEE66101.1|  hypothetical protein OsJ_22133                        99.4    3e-20   
gb|AFW87299.1|  putative sucrose-phosphate synthase family protein    98.2    7e-20   
ref|XP_004965757.1|  PREDICTED: probable sucrose-phosphate syntha...  97.4    1e-19   
gb|AGT16224.1|  sucrose phosphate synthase                            96.7    2e-19   
ref|XP_006441780.1|  hypothetical protein CICLE_v100186551mg          91.7    1e-17   
gb|EMT08378.1|  hypothetical protein F775_11023                       90.9    1e-17   
gb|KHN20554.1|  Putative sucrose-phosphate synthase 4                 88.2    2e-16   
ref|XP_002964041.1|  sucrose phosphate synthase                       87.0    4e-16   
emb|CAN84060.1|  hypothetical protein VITISV_036457                   80.5    6e-16   
gb|EMT21205.1|  hypothetical protein F775_44071                       79.7    1e-15   
ref|XP_006441779.1|  hypothetical protein CICLE_v100186552mg          78.2    2e-15   
gb|KHG18730.1|  putative sucrose-phosphate synthase 4                 83.2    1e-14   
gb|AEA03003.1|  sucrose phosphate synthase B3                         79.3    1e-14   
ref|NP_001045210.1|  Os01g0919400                                     70.9    2e-12   
gb|AAQ15106.1|AF347064_1  sucrose-phosphate synthase 2                75.9    2e-12   
tpg|DAA55891.1|  TPA: putative calmodulin-binding family protein      70.5    3e-11   
ref|XP_008466432.1|  PREDICTED: probable sucrose-phosphate syntha...  66.2    6e-11   
gb|EMS46175.1|  hypothetical protein TRIUR3_32151                     67.0    7e-11   
ref|XP_008466433.1|  PREDICTED: probable sucrose-phosphate syntha...  65.9    8e-11   
ref|NP_001142854.1|  uncharacterized protein LOC100275248             64.7    4e-10   
gb|AFW87300.1|  putative sucrose-phosphate synthase family protein    63.9    8e-10   
emb|CAD44259.1|  putative sucrose-phosphate synthase                  66.6    1e-09   
ref|XP_008380517.1|  PREDICTED: probable sucrose-phosphate syntha...  48.1    3e-09   
ref|XP_010324850.1|  PREDICTED: sucrose-phosphate synthase A2 iso...  61.2    1e-07   
gb|ADD92152.1|  sucrose phosphate synthase                            58.2    2e-07   
ref|XP_009366869.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...  59.7    3e-07   
gb|EMS67679.1|  Sucrose-phosphate synthase                            53.5    4e-05   
emb|CAD44260.1|  putative sucrose-phosphate synthase                  52.8    5e-05   
gb|AFW62326.1|  hypothetical protein ZEAMMB73_604560                  52.4    6e-05   
ref|XP_006656289.1|  PREDICTED: probable sucrose-phosphate syntha...  51.2    2e-04   
emb|CAD44257.1|  putative sucrose-phosphate synthase                  50.4    3e-04   



>gb|KDP39346.1| hypothetical protein JCGZ_01103 [Jatropha curcas]
Length=1065

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA AIE E KP    + GEQGHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAGAIE-EQKPTPAVNPGEQGHFNPTKYFVEEVVTGVDETDLH  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE EG QRLA RR EREQGR+DVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEGQQRLASRRLEREQGRRDVTE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>ref|XP_007034285.1| Sucrose phosphate synthase 3F isoform 5 [Theobroma cacao]
 gb|EOY05211.1| Sucrose phosphate synthase 3F isoform 5 [Theobroma cacao]
Length=823

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  589  DMS  597
            D+S
Sbjct  119  DLS  121



>ref|XP_007034284.1| Sucrose phosphate synthase 3F isoform 4 [Theobroma cacao]
 gb|EOY05210.1| Sucrose phosphate synthase 3F isoform 4 [Theobroma cacao]
Length=991

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  589  DMS  597
            D+S
Sbjct  119  DLS  121



>ref|XP_007034282.1| Sucrose phosphate synthase 3F isoform 2 [Theobroma cacao]
 gb|EOY05208.1| Sucrose phosphate synthase 3F isoform 2 [Theobroma cacao]
Length=1049

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  589  DMS  597
            D+S
Sbjct  119  DLS  121



>ref|XP_007034283.1| Sucrose phosphate synthase 3F isoform 3 [Theobroma cacao]
 gb|EOY05209.1| Sucrose phosphate synthase 3F isoform 3 [Theobroma cacao]
Length=991

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  589  DMS  597
            D+S
Sbjct  119  DLS  121



>ref|XP_007034281.1| Sucrose phosphate synthase 3F isoform 1 [Theobroma cacao]
 gb|EOY05207.1| Sucrose phosphate synthase 3F isoform 1 [Theobroma cacao]
Length=1063

 Score =   214 bits (546),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 112/123 (91%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AIE E KPA ++ R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPATVSLR-ETGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWEREQGRRDATE  118

Query  589  DMS  597
            D+S
Sbjct  119  DLS  121



>emb|CDP11144.1| unnamed protein product [Coffea canephora]
Length=1065

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AI+ E+K     + GE+ HFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAID-ENKAISSVNLGERSHFNPTKYFVEEVVTGVDETDLH  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLELE +QRLA RRWEREQGRKDVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLELEDIQRLAKRRWEREQGRKDVTE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>ref|XP_002518055.1| sucrose phosphate syntase, putative [Ricinus communis]
 gb|EEF44188.1| sucrose phosphate syntase, putative [Ricinus communis]
Length=1064

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 109/123 (89%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA AIE E KP       ++GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAGAIE-EQKPVQPVDLKDRGHFNPTKYFVEEVVTGVDETDLH  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLEL  LQRLA+RRWEREQGR+D TE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLELGELQRLANRRWEREQGRRDATE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>gb|EYU31461.1| hypothetical protein MIMGU_mgv1a000579mg [Erythranthe guttata]
Length=1061

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGASAI+ E+K AV     ++GHFNPTKYFVEEVV+GVDE+DLH
Sbjct  1    MAGNEWINGYLEAILDSGASAID-ENKAAVAVRVKDRGHFNPTKYFVEEVVTGVDESDLH  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQRL  RRWEREQGRKDVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRLTDRRWEREQGRKDVTE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>ref|XP_011101558.1| PREDICTED: probable sucrose-phosphate synthase 2 [Sesamum indicum]
Length=1057

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 109/123 (89%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MA NEWINGYLEAILDSGASAIE       +N R ++GHFNPTKYFVEEVV+GVDE+DLH
Sbjct  1    MAANEWINGYLEAILDSGASAIEENKAGPGVNVR-DRGHFNPTKYFVEEVVTGVDESDLH  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN+ ERSSRLENMCWRIWHL RKKKQLE E LQRLA+RRWEREQGRKDVTE
Sbjct  60   RTWIKVVATRNSRERSSRLENMCWRIWHLARKKKQLEWEDLQRLANRRWEREQGRKDVTE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>ref|XP_008380516.1| PREDICTED: probable sucrose-phosphate synthase 2 isoform X1 [Malus 
domestica]
Length=1065

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGASAIE E KP   N R ++GHFNPTKYFVEEVV+GVDE+DL+
Sbjct  1    MAGNEWINGYLEAILDSGASAIE-EQKPVPENLR-DRGHFNPTKYFVEEVVTGVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ER SRLENMCWRIWHLTRKKKQLE+E  QRLA+RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERGSRLENMCWRIWHLTRKKKQLEVEEHQRLANRRWEREQGRRDATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>gb|KDO39033.1| hypothetical protein CISIN_1g001492mg [Citrus sinensis]
Length=1067

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGASAIE + K A +N   ++GHFNPTKYFVEEVV+ VDETDL+
Sbjct  1    MAGNEWINGYLEAILDSGASAIEEQQKQAPVN-LADRGHFNPTKYFVEEVVTSVDETDLY  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RR EREQGR+DVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRLEREQGRRDVTE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>ref|XP_006420963.1| hypothetical protein CICLE_v10004221mg [Citrus clementina]
 gb|ESR34203.1| hypothetical protein CICLE_v10004221mg [Citrus clementina]
Length=1067

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGASAIE + K A +N   ++GHFNPTKYFVEEVV+ VDETDL+
Sbjct  1    MAGNEWINGYLEAILDSGASAIEEQQKQAPVN-LADRGHFNPTKYFVEEVVTSVDETDLY  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RR EREQGR+DVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRLEREQGRRDVTE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>ref|XP_009618538.1| PREDICTED: probable sucrose-phosphate synthase 2 [Nicotiana tomentosiformis]
Length=1064

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGE-QGHFNPTKYFVEEVVSGVDETDL  405
            MAGNEWINGYLEAIL SGASAIE    P+  +H     GHFNPTKYFVEEVV+GVDETDL
Sbjct  1    MAGNEWINGYLEAILSSGASAIEDNKTPSSTSHVNNLTGHFNPTKYFVEEVVTGVDETDL  60

Query  406  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            HRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR+A+RR EREQGRKDVT
Sbjct  61   HRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRIANRRLEREQGRKDVT  120

Query  586  EDMS  597
            EDMS
Sbjct  121  EDMS  124



>ref|XP_009777937.1| PREDICTED: probable sucrose-phosphate synthase 2 [Nicotiana sylvestris]
Length=1064

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGE-QGHFNPTKYFVEEVVSGVDETDL  405
            MAGNEWINGYLEAIL SGASAIE    P+  +H     GHFNPTKYFVEEVV+GVDETDL
Sbjct  1    MAGNEWINGYLEAILSSGASAIEDNKTPSSTSHVNNLTGHFNPTKYFVEEVVTGVDETDL  60

Query  406  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            HRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR+A+RR EREQGRKDVT
Sbjct  61   HRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRIANRRLEREQGRKDVT  120

Query  586  EDMS  597
            EDMS
Sbjct  121  EDMS  124



>ref|XP_004296966.1| PREDICTED: probable sucrose-phosphate synthase 3 [Fragaria vesca 
subsp. vesca]
Length=1066

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 110/123 (89%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILD+GA+AIE E KP  +N   E GHFNPTKYFVEEVV+GVDE+DL+
Sbjct  1    MAGNEWINGYLEAILDTGATAIE-EQKPTPVN-LSEGGHFNPTKYFVEEVVTGVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQR A+RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRSANRRWEREQGRRDATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_006494166.1| PREDICTED: probable sucrose-phosphate synthase 3-like [Citrus 
sinensis]
Length=1067

 Score =   206 bits (525),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGASAIE + K   +N   ++GHFNPTKYFVEEVV+ VDETDL+
Sbjct  1    MAGNEWINGYLEAILDSGASAIEEQQKQTPVN-LADRGHFNPTKYFVEEVVTSVDETDLY  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RR EREQGR+DVTE
Sbjct  60   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRLEREQGRRDVTE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>emb|CBI17227.3| unnamed protein product [Vitis vinifera]
Length=1046

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 108/123 (88%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL SGASAIE +SK   I  R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILVSGASAIE-DSKATPIALR-EGGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE+E  QRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEVEDQQRLAVRRWEREQGRRDATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>emb|CAN78805.1| hypothetical protein VITISV_017581 [Vitis vinifera]
Length=1057

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 108/123 (88%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL SGASAIE +SK   I  R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILVSGASAIE-DSKATPIALR-EGGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE+E  QRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEVEDQQRLAVRRWEREQGRRDATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_002271398.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Vitis 
vinifera]
 ref|XP_010650290.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Vitis 
vinifera]
 ref|XP_010650292.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Vitis 
vinifera]
Length=1067

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 108/123 (88%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL SGASAIE +SK   I  R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILVSGASAIE-DSKATPIALR-EGGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE+E  QRLA RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEVEDQQRLAVRRWEREQGRRDATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_008222839.1| PREDICTED: probable sucrose-phosphate synthase 3 [Prunus mume]
Length=1066

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSG+SAIE E KP   N R ++G+FNPTKYFVEEVV+GVDE+DL+
Sbjct  1    MAGNEWINGYLEAILDSGSSAIE-EQKPVPENLR-DRGNFNPTKYFVEEVVTGVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ER SRLENMCWRIWHLTRKKKQLE+E  QRLA+RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERGSRLENMCWRIWHLTRKKKQLEIEEHQRLANRRWEREQGRRDATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_011045619.1| PREDICTED: probable sucrose-phosphate synthase 3 [Populus euphratica]
Length=1069

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSG--ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  402
            M GNEWINGYLEAIL+SG  A AIE E KPA   +  E GHFNPTKYFVEEVV+GVDETD
Sbjct  1    MPGNEWINGYLEAILNSGGGAGAIE-EHKPAPTVNLRETGHFNPTKYFVEEVVTGVDETD  59

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RRWEREQGR+D 
Sbjct  60   LHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRWEREQGRRDA  119

Query  583  TEDMS  597
            TEDMS
Sbjct  120  TEDMS  124



>ref|XP_007225402.1| hypothetical protein PRUPE_ppa000622mg [Prunus persica]
 gb|EMJ26601.1| hypothetical protein PRUPE_ppa000622mg [Prunus persica]
Length=1066

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 111/123 (90%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSG+SAIE E KP   N R ++G+FNPTKYFVEEVV+GVDE+DL+
Sbjct  1    MAGNEWINGYLEAILDSGSSAIE-EQKPVPENLR-DRGNFNPTKYFVEEVVTGVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ER SRLENMCWRIWHLTRKKKQLE+E  QRLA+RRWEREQGR+D TE
Sbjct  59   RTWIKVVATRNTRERGSRLENMCWRIWHLTRKKKQLEIEEHQRLANRRWEREQGRRDATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>sp|O04933.1|SPSA2_CRAPL RecName: Full=Probable sucrose-phosphate synthase 2; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase 2 [Craterostigma 
plantagineum]
 emb|CAA72491.1| sucrose-phosphate synthase [Craterostigma plantagineum]
Length=1081

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 107/127 (84%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES----KPAVINHRGEQGHFNPTKYFVEEVVSGVDE  396
            MAGNEWINGYLEAILD+GASAI+  S      A    R    HFNPTKYFVEEVVSGVDE
Sbjct  1    MAGNEWINGYLEAILDTGASAIDENSGGGKTAAAQKGRHHDHHFNPTKYFVEEVVSGVDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            +DLHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA R+WEREQGRK
Sbjct  61   SDLHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEDLQRLAARKWEREQGRK  120

Query  577  DVTEDMS  597
            DVTEDMS
Sbjct  121  DVTEDMS  127



>ref|XP_011041945.1| PREDICTED: probable sucrose-phosphate synthase 3 [Populus euphratica]
 ref|XP_011041946.1| PREDICTED: probable sucrose-phosphate synthase 3 [Populus euphratica]
Length=1069

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSG--ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  402
            MAGNEWINGYLEAIL+SG  A AIE E KPA   +  E GHFNPTKYFVEEVV+GVDETD
Sbjct  1    MAGNEWINGYLEAILNSGGGAGAIE-EHKPAPTVNLRETGHFNPTKYFVEEVVTGVDETD  59

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RRWERE GR+D 
Sbjct  60   LHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRWERELGRRDA  119

Query  583  TEDMS  597
            TEDMS
Sbjct  120  TEDMS  124



>ref|XP_002298684.1| hypothetical protein POPTR_0001s32500g [Populus trichocarpa]
 gb|EEE83489.1| hypothetical protein POPTR_0001s32500g [Populus trichocarpa]
Length=1069

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 108/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSG--ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  402
            M GNEWINGYLEAIL+SG  A AIE E KPA   +  E GHFNPTKYFVEEVV GVDETD
Sbjct  1    MPGNEWINGYLEAILNSGGGAGAIE-EHKPAPTVNLRETGHFNPTKYFVEEVVRGVDETD  59

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA+RRWEREQGR+D 
Sbjct  60   LHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLANRRWEREQGRRDA  119

Query  583  TEDMS  597
            TEDMS
Sbjct  120  TEDMS  124



>ref|XP_010927691.1| PREDICTED: probable sucrose-phosphate synthase 2 [Elaeis guineensis]
Length=1086

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGASAI  E + +      + GHFNPT+YFVEEVV GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGASAITDEQRGSSPVSVRDTGHFNPTRYFVEEVVMGVDETDLH  60

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN+ ERSSRLENMCWRIWHL RKKKQLE E LQR+A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNSRERSSRLENMCWRIWHLARKKKQLEWEDLQRMANRRWEREQGRRDATE  120

Query  589  DMS  597
            DMS
Sbjct  121  DMS  123



>ref|XP_010264121.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X2 [Nelumbo 
nucifera]
Length=978

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 108/123 (88%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA +IE + KP  ++ R E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAGSIE-DQKPISVDLR-ERGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWI+V ATRNT ERSSRLENMCWRIWHL RKKKQLE E  QRLA+RRWE EQGR DVTE
Sbjct  59   RTWIQVAATRNTRERSSRLENMCWRIWHLARKKKQLEWEDFQRLANRRWEWEQGRMDVTE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_010264118.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264120.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Nelumbo 
nucifera]
Length=1071

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 108/123 (88%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA +IE + KP  ++ R E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAGSIE-DQKPISVDLR-ERGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWI+V ATRNT ERSSRLENMCWRIWHL RKKKQLE E  QRLA+RRWE EQGR DVTE
Sbjct  59   RTWIQVAATRNTRERSSRLENMCWRIWHLARKKKQLEWEDFQRLANRRWEWEQGRMDVTE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>gb|KHG20806.1| putative sucrose-phosphate synthase 3 -like protein [Gossypium 
arboreum]
Length=1045

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 107/123 (87%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AIE E KP V     E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPTV--DLRERGHFNPTKYFVEEVVTGVDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN  ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWERE  RKD TE
Sbjct  58   RTWIKVVATRNARERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWERELVRKDATE  117

Query  589  DMS  597
            D++
Sbjct  118  DLA  120



>ref|XP_010247961.1| PREDICTED: probable sucrose-phosphate synthase 2 [Nelumbo nucifera]
Length=1073

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 107/123 (87%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MA NEWINGYLEAILDSGA++IE E KP+ +N R E GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAVNEWINGYLEAILDSGAASIE-EQKPSSVNLR-EGGHFNPTKYFVEEVVTGVDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN  ERSSRLENMCWRIWHL RKKKQLE E  QRL +RRWEREQGR D TE
Sbjct  59   RTWIKVVATRNARERSSRLENMCWRIWHLARKKKQLEWEEFQRLTNRRWEREQGRMDATE  118

Query  589  DMS  597
            D+S
Sbjct  119  DLS  121



>gb|KJB72051.1| hypothetical protein B456_011G155900 [Gossypium raimondii]
Length=951

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 107/123 (87%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AIE E KP V     E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKPMV--DLRERGHFNPTKYFVEEVVTGVDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN  ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWERE  RKD TE
Sbjct  58   RTWIKVVATRNARERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWERELVRKDATE  117

Query  589  DMS  597
            D++
Sbjct  118  DLA  120



>gb|KJB72049.1| hypothetical protein B456_011G155900 [Gossypium raimondii]
 gb|KJB72050.1| hypothetical protein B456_011G155900 [Gossypium raimondii]
Length=1057

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 110/123 (89%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGA+AIE E KP +++ R E+GHFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGAAAIE-EQKP-MVDLR-ERGHFNPTKYFVEEVVTGVDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN  ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWERE  RKD TE
Sbjct  58   RTWIKVVATRNARERSSRLENMCWRIWHLTRKKKQLEWEELQRLAKRRWERELVRKDATE  117

Query  589  DMS  597
            D++
Sbjct  118  DLA  120



>ref|XP_006373074.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
 gb|ERP50871.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
Length=1069

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSG--ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  402
            MAGNEWINGYLEAILDSG  A AIE E KPA   +  + G FNPTKYFVEEVV+GVDETD
Sbjct  1    MAGNEWINGYLEAILDSGGGAGAIE-EHKPAPSMNLRDTGDFNPTKYFVEEVVTGVDETD  59

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQRLA RRWERE GR+D 
Sbjct  60   LHRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRLATRRWERELGRRDA  119

Query  583  TEDMS  597
            TEDMS
Sbjct  120  TEDMS  124



>gb|AJG44459.1| sucrose phosphate synthase [Lilium davidii var. unicolor]
Length=1080

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 105/124 (85%), Gaps = 3/124 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEV-ESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  405
            MAGNEWINGYLEAILDSG SA+   + +P      G  GHFNPT+YFVEEVV+GVDETDL
Sbjct  1    MAGNEWINGYLEAILDSGPSAMAAGDEQPPAGGVLG--GHFNPTRYFVEEVVTGVDETDL  58

Query  406  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            HRTWIKVVATRNT ERSSRLENMCWRIWHLTRKKK+LE E  QRL HRRWEREQGR+D T
Sbjct  59   HRTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKKLEWEDFQRLTHRRWEREQGRRDAT  118

Query  586  EDMS  597
            EDMS
Sbjct  119  EDMS  122



>ref|XP_008794597.1| PREDICTED: probable sucrose-phosphate synthase 2 [Phoenix dactylifera]
Length=1084

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSGASAI  E + +      + GHFNPT YFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGASAITDEQRGSSPVSVRDTGHFNPTTYFVEEVVTGVDETDLH  60

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN+ ERSSRLENMCWRIWHL RKKKQLE E +QR+A+RRWERE GR+D TE
Sbjct  61   RTWIKVVATRNSRERSSRLENMCWRIWHLARKKKQLEWEDVQRMANRRWERELGRRDATE  120

Query  589  DMS  597
            DMS
Sbjct  121  DMS  123



>ref|XP_007146334.1| hypothetical protein PHAVU_006G031700g [Phaseolus vulgaris]
 gb|ESW18328.1| hypothetical protein PHAVU_006G031700g [Phaseolus vulgaris]
Length=1050

 Score =   198 bits (504),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 108/123 (88%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL +GAS IE E KPA +  R + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIE-EQKPAPVTLR-DGGHFNPTKYFVEEVVTSVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E  QR+A+RRWEREQGR++ TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEETQRVANRRWEREQGRREATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>gb|ADT64795.4| sucrose phosphate synthase [Musa acuminata AAA Group]
Length=1082

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSG +  + +   + ++ R    HFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGGAVADDQKVSSPVSVRDGGDHFNPTKYFVEEVVTGVDETDLH  60

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN+ ERS+RLENMCWRIWHLTRKKKQLE E +QR A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNSRERSTRLENMCWRIWHLTRKKKQLEWENVQRTANRRWEREQGRRDATE  120

Query  589  DMS  597
            DMS
Sbjct  121  DMS  123



>ref|XP_009396792.1| PREDICTED: sucrose-phosphate synthase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009396793.1| PREDICTED: sucrose-phosphate synthase [Musa acuminata subsp. 
malaccensis]
Length=1082

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSG +  + +   + ++ R    HFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGGAVADDQKVSSPVSVRDGGDHFNPTKYFVEEVVTGVDETDLH  60

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRN+ ERS+RLENMCWRIWHLTRKKKQLE E +QR A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNSRERSTRLENMCWRIWHLTRKKKQLEWENVQRTANRRWEREQGRRDATE  120

Query  589  DMS  597
            DMS
Sbjct  121  DMS  123



>gb|AES70069.2| sucrose-phosphate synthase family protein [Medicago truncatula]
Length=1046

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 104/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL +GAS IE +  P      G  GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIEEQKPPQAALRDG--GHFNPTKYFVEEVVASVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTW+KVVATRNT ERSSRLENMCWRIWHL RKKKQLE E +QRLA+RRWEREQGR+D TE
Sbjct  59   RTWVKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEEVQRLANRRWEREQGRRDATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_008457154.1| PREDICTED: probable sucrose-phosphate synthase 2 [Cucumis melo]
Length=1062

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVIN---HRGEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILD+GA+AIE E KPA      +  ++GHFNPTKYFVEEVVSGVDE+
Sbjct  1    MAGNEWINGYLEAILDTGATAIE-EQKPASAAAAANLTDRGHFNPTKYFVEEVVSGVDES  59

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQR  +RR ERE+GR D
Sbjct  60   DLHRTWLKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRSTNRRLERERGRMD  119

Query  580  VTEDMS  597
            VTEDMS
Sbjct  120  VTEDMS  125



>ref|XP_004138938.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cucumis 
sativus]
Length=1067

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVIN---HRGEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILD+GA+AIE E KPA      +  ++GHFNPTKYFVEEVVSGVDE+
Sbjct  1    MAGNEWINGYLEAILDTGATAIE-EQKPASAAAAANLTDRGHFNPTKYFVEEVVSGVDES  59

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQR  +RR ERE+GR D
Sbjct  60   DLHRTWLKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRSTNRRLERERGRMD  119

Query  580  VTEDMS  597
            VTEDMS
Sbjct  120  VTEDMS  125



>ref|NP_001266150.1| sucrose-phosphate synthase B [Solanum lycopersicum]
 gb|AFD64638.1| sucrose-phosphate synthase B [Solanum lycopersicum]
Length=1064

 Score =   195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 107/128 (84%), Gaps = 6/128 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVIN-----HRGEQGHFNPTKYFVEEVVSGVD  393
            MAGNEWINGYLEAIL SGASAIE + KP+        +  E+ +FNPTKYFVEEVV+GVD
Sbjct  1    MAGNEWINGYLEAILSSGASAIE-DKKPSSTTTSSHLNLAERANFNPTKYFVEEVVTGVD  59

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR A+RR ERE GR
Sbjct  60   ETDLHRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRSANRRLERELGR  119

Query  574  KDVTEDMS  597
            KDVTEDMS
Sbjct  120  KDVTEDMS  127



>ref|XP_010069011.1| PREDICTED: probable sucrose-phosphate synthase 3 [Eucalyptus 
grandis]
 ref|XP_010069012.1| PREDICTED: probable sucrose-phosphate synthase 3 [Eucalyptus 
grandis]
 gb|KCW57233.1| hypothetical protein EUGRSUZ_H00041 [Eucalyptus grandis]
Length=1071

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILDSG      ++    +  + E+G FNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDSGGGGSSEQNVQKEVKMK-ERGDFNPTKYFVEEVVTGVDETDLH  59

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT +RSSRLENMCWRIWHLTRKKKQLE E +QRLA RRWEREQGR+D TE
Sbjct  60   RTWIKVVATRNTRDRSSRLENMCWRIWHLTRKKKQLEWEEMQRLAKRRWEREQGRRDATE  119

Query  589  DMS  597
            DMS
Sbjct  120  DMS  122



>ref|XP_010522391.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X1 [Tarenaya 
hassleriana]
Length=1059

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAV--INHRGEQGHFNPTKYFVEEVVSGVDETD  402
            MAGNEWINGYLEAILDS A AIE E +P    +N R     FNPTKYFVEEVV+GVDETD
Sbjct  1    MAGNEWINGYLEAILDSRAQAIE-EQRPQAPPVNSRDGGQFFNPTKYFVEEVVTGVDETD  59

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHRTWIKVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR AHRRWEREQGR+D 
Sbjct  60   LHRTWIKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEVSQRQAHRRWEREQGRRDA  119

Query  583  TEDMS  597
            TED+S
Sbjct  120  TEDLS  124



>gb|AGE43981.1| sucrose phosphate synthase 1 [Cucumis sativus]
Length=1067

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVIN---HRGEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWI+GYLEAILD+GA+AIE E KPA      +  ++GHFNPTKYFVEEVVSGVDE+
Sbjct  1    MAGNEWISGYLEAILDTGATAIE-EQKPASAAAAANLTDRGHFNPTKYFVEEVVSGVDES  59

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E LQR  +RR ERE+GR D
Sbjct  60   DLHRTWLKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEELQRSTNRRLERERGRMD  119

Query  580  VTEDMS  597
            VTEDMS
Sbjct  120  VTEDMS  125



>ref|XP_004499982.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cicer 
arietinum]
Length=1042

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 107/123 (87%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL +GAS IE E KPA +  R + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIE-EQKPAQVTLR-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E +QR+ +RRWEREQGR++ TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEEVQRVTNRRWEREQGRREATE  118

Query  589  DMS  597
            D+S
Sbjct  119  DLS  121



>ref|XP_010522392.1| PREDICTED: probable sucrose-phosphate synthase 3 isoform X2 [Tarenaya 
hassleriana]
Length=1044

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAV--INHRGEQGHFNPTKYFVEEVVSGVDETD  402
            MAGNEWINGYLEAILDS A AIE E +P    +N R     FNPTKYFVEEVV+GVDETD
Sbjct  1    MAGNEWINGYLEAILDSRAQAIE-EQRPQAPPVNSRDGGQFFNPTKYFVEEVVTGVDETD  59

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHRTWIKVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR AHRRWEREQGR+D 
Sbjct  60   LHRTWIKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEVSQRQAHRRWEREQGRRDA  119

Query  583  TEDMS  597
            TED+S
Sbjct  120  TEDLS  124



>gb|ABA64521.1| sucrose-phosphate synthase isoform B [Nicotiana tabacum]
Length=1064

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 107/127 (84%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVIN----HRGEQGHFNPTKYFVEEVVSGVDE  396
            MAGNEWINGYLEAIL SGASAIE ++  +       +  E+ +FNPTKYFVEEVV+GVDE
Sbjct  1    MAGNEWINGYLEAILSSGASAIEDKTPSSSTTSSHLNLAERANFNPTKYFVEEVVTGVDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            TDLHRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E +QR A+RR EREQGRK
Sbjct  61   TDLHRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDVQRSANRRLEREQGRK  120

Query  577  DVTEDMS  597
            DVTEDMS
Sbjct  121  DVTEDMS  127



>ref|XP_006857652.1| hypothetical protein AMTR_s00061p00145220 [Amborella trichopoda]
 gb|ERN19119.1| hypothetical protein AMTR_s00061p00145220 [Amborella trichopoda]
Length=1072

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAILD+GA  +E ++K   +N  G   HFNPTKYFVEEVV+GVDETDLH
Sbjct  1    MAGNEWINGYLEAILDTGAGGVE-DNKAVNLNDHGS--HFNPTKYFVEEVVTGVDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTW+KVVATRNT ERS+RLENMCWRIWHL RKKKQLE E  QRLA+RR EREQGR+D TE
Sbjct  58   RTWLKVVATRNTRERSTRLENMCWRIWHLARKKKQLEGEDSQRLANRRSEREQGRRDATE  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>ref|XP_006360944.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Solanum 
tuberosum]
Length=1064

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 107/127 (84%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVIN----HRGEQGHFNPTKYFVEEVVSGVDE  396
            MAGNEWINGYLEAIL +GASAIE ++  +       +  E+ +FNPTKYFVEEVV+GVDE
Sbjct  1    MAGNEWINGYLEAILSTGASAIEDKTPSSTTTSSHLNLAERANFNPTKYFVEEVVTGVDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            TDLHRTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR A+RR EREQGRK
Sbjct  61   TDLHRTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEDLQRSANRRLEREQGRK  120

Query  577  DVTEDMS  597
            DVTEDMS
Sbjct  121  DVTEDMS  127



>gb|ABW89596.1| sucrose phosphate synthase B [Medicago sativa]
Length=683

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQG-HFNPTKYFVEEVVSGVDETDL  405
            MAGNEWINGYLEAILD+G ++  VE +  V     E G HFNPTKYFVEEVVS VDE+DL
Sbjct  1    MAGNEWINGYLEAILDTGGASTTVEEQHRVTAAARESGDHFNPTKYFVEEVVSAVDESDL  60

Query  406  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            HRTW+KVVATRNT ERSSRLENMCWRIWHL RKKK++E E LQRLA+RRWE EQGR+D T
Sbjct  61   HRTWLKVVATRNTRERSSRLENMCWRIWHLARKKKKVEGEELQRLAYRRWEIEQGRRDAT  120

Query  586  EDMS  597
            ED+S
Sbjct  121  EDLS  124



>gb|KHN11970.1| Putative sucrose-phosphate synthase 3 [Glycine soja]
Length=1063

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL +G  A  V+ +        E GHFNPT+YFVEEVVS VDE+DLH
Sbjct  1    MAGNEWINGYLEAILSTGTGAGTVDEQMQKAVTPPESGHFNPTQYFVEEVVSSVDESDLH  60

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEGEELQRFANRRWEREQGRRDATE  120

Query  589  DMS  597
            D+S
Sbjct  121  DLS  123



>ref|XP_003545147.1| PREDICTED: probable sucrose-phosphate synthase 3-like [Glycine 
max]
Length=1063

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL +G  A  V+ +        E GHFNPT+YFVEEVVS VDE+DLH
Sbjct  1    MAGNEWINGYLEAILSTGTGAGTVDEQMQKAVTPPESGHFNPTQYFVEEVVSSVDESDLH  60

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHL RKKKQLE E LQR A+RRWEREQGR+D TE
Sbjct  61   RTWIKVVATRNTRERSSRLENMCWRIWHLARKKKQLEGEELQRFANRRWEREQGRRDATE  120

Query  589  DMS  597
            D+S
Sbjct  121  DLS  123



>gb|KHM99635.1| Putative sucrose-phosphate synthase 3 [Glycine soja]
Length=1055

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL +GAS IE E KPA +  + + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIE-EQKPAPVTLK-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E +QR+  RR EREQGR++ TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEEVQRVTSRRLEREQGRREATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_003532093.1| PREDICTED: probable sucrose-phosphate synthase 3-like [Glycine 
max]
Length=1055

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL +GAS IE E KPA +  + + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIE-EQKPAPVTLK-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E +QR+  RR EREQGR++ TE
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEEVQRVTSRRLEREQGRREATE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_002892252.1| ATSPS3F [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68511.1| ATSPS3F [Arabidopsis lyrata subsp. lyrata]
Length=1062

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+  +FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQAAVNLREGDGQYFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  580  VTEDMS  597
             TED+S
Sbjct  121  ATEDLS  126



>ref|XP_006418081.1| hypothetical protein EUTSA_v10006639mg [Eutrema salsugineum]
 gb|ESQ36434.1| hypothetical protein EUTSA_v10006639mg [Eutrema salsugineum]
Length=1066

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 108/127 (85%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR--GEQGHFNPTKYFVEEVVSGVDE  396
            MAGNEWINGYLEAILDS A  IE  + KP A +N R  GE  +FNPTKYFVEEVV+GVDE
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEEQQQKPQAALNLRDGGEGQYFNPTKYFVEEVVTGVDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            TDLHRTWIKVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+
Sbjct  61   TDLHRTWIKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVANRRLEREQGRR  120

Query  577  DVTEDMS  597
            D TED+S
Sbjct  121  DATEDLS  127



>ref|NP_171984.2| sucrose-phosphate synthase [Arabidopsis thaliana]
 sp|Q8RY24.1|SPSA3_ARATH RecName: Full=Probable sucrose-phosphate synthase 3; AltName: 
Full=Sucrose phosphate synthase 3F; Short=AtSPS3F; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase [Arabidopsis 
thaliana]
 gb|AAL84949.1| At1g04920/F13M7_7 [Arabidopsis thaliana]
 gb|AAN72222.1| At1g04920/F13M7_7 [Arabidopsis thaliana]
 gb|AEE27759.1| sucrose-phosphate synthase [Arabidopsis thaliana]
 gb|AHL38971.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1062

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+  +FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQASVNLREGDGQYFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  580  VTEDMS  597
             TED+S
Sbjct  121  ATEDLS  126



>gb|AAF40445.1|AC004809_3 Strong similarity to the sucrose-phosphate synthase from Craterostigma 
plantagineum gb|Y11795 [Arabidopsis thaliana]
Length=1064

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+  +FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQASVNLREGDGQYFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  580  VTEDMS  597
             TED+S
Sbjct  121  ATEDLS  126



>gb|KHN18081.1| Putative sucrose-phosphate synthase 3 [Glycine soja]
Length=1053

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWI+GYLEAIL +GAS IE E KPA +  + + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWIDGYLEAILSTGASTIE-EQKPAPVTLK-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E +QR+  RRWEREQG ++  E
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEEVQRVTSRRWEREQGLREAAE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_003553129.1| PREDICTED: probable sucrose-phosphate synthase 3-like [Glycine 
max]
Length=1053

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWI+GYLEAIL +GAS IE E KPA +  + + GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWIDGYLEAILSTGASTIE-EQKPAPVTLK-DGGHFNPTKYFVEEVVASVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            RTWIKVVATRNT ERSSRLENMCWRIWHLTRKKKQLE E +QR+  RRWEREQG ++  E
Sbjct  59   RTWIKVVATRNTRERSSRLENMCWRIWHLTRKKKQLEWEEVQRVTSRRWEREQGLREAAE  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|XP_004166159.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cucumis 
sativus]
Length=1071

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 108/130 (83%), Gaps = 8/130 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVIN---HRGEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILD+GA+AIE E KPA      +  ++GHFNPTKYFVEEVVSGVDE+
Sbjct  1    MAGNEWINGYLEAILDTGATAIE-EQKPASAAAAANLTDRGHFNPTKYFVEEVVSGVDES  59

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKK----QLELEGLQRLAHRRWEREQ  567
            DLHRTW+KVVATRNT ERSSRLENMCWRIWHLTRKK     QLE E LQR  +RR ERE+
Sbjct  60   DLHRTWLKVVATRNTRERSSRLENMCWRIWHLTRKKNSFCVQLEWEELQRSTNRRLERER  119

Query  568  GRKDVTEDMS  597
            GR DVTEDMS
Sbjct  120  GRMDVTEDMS  129



>ref|XP_006306646.1| hypothetical protein CARUB_v10008160mg [Capsella rubella]
 gb|EOA39544.1| hypothetical protein CARUB_v10008160mg [Capsella rubella]
Length=1064

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHRGEQG-HFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP A +N R   G +FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQAALNLREADGQYFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  580  VTEDMS  597
              ED+S
Sbjct  121  AAEDLS  126



>ref|XP_003617418.1| Sucrose-phosphate synthase [Medicago truncatula]
 gb|AET00377.1| sucrose-phosphate synthase family protein [Medicago truncatula]
Length=1058

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 103/125 (82%), Gaps = 2/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA-IEVESKPAVINHRGEQG-HFNPTKYFVEEVVSGVDETD  402
            MAGNEWINGYLEAIL +G  A   VE +  V     E G HFNPTKYFVEEVVS VDE+D
Sbjct  1    MAGNEWINGYLEAILSTGGGASTTVEEQQRVAAAARESGDHFNPTKYFVEEVVSAVDESD  60

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHRTW+KVVATRNT ERSSRLENMCWRIWHL RKKK++E E LQRLA+RRWEREQGR+D 
Sbjct  61   LHRTWLKVVATRNTRERSSRLENMCWRIWHLARKKKKVEGEELQRLAYRRWEREQGRRDA  120

Query  583  TEDMS  597
            TED+S
Sbjct  121  TEDLS  125



>ref|XP_010457558.1| PREDICTED: LOW QUALITY PROTEIN: probable sucrose-phosphate synthase 
3 [Camelina sativa]
Length=1065

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEDTQQKPQAAVNLREGDGQFFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  580  VTEDMS  597
             TE +S
Sbjct  121  ATEVLS  126



>ref|XP_010484393.1| PREDICTED: probable sucrose-phosphate synthase 3 [Camelina sativa]
Length=983

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP-AVINHR-GEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP A +N R G+   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEDTQQKPQAAVNLREGDGQFFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRLEREQGRRD  120

Query  580  VTEDMS  597
             TE +S
Sbjct  121  ATEVLS  126



>emb|CDX89776.1| BnaA10g03060D [Brassica napus]
Length=1064

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP--AVINHRGEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP  +V    GE   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQTSVALRDGEGEFFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVANRRLEREQGRRD  120

Query  580  VTEDM  594
             TED+
Sbjct  121  ATEDL  125



>ref|XP_003599818.1| Sucrose-phosphate synthase [Medicago truncatula]
Length=1065

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 104/142 (73%), Gaps = 21/142 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWINGYLEAIL +GAS IE +  P      G  GHFNPTKYFVEEVV+ VDE+DL+
Sbjct  1    MAGNEWINGYLEAILSTGASTIEEQKPPQAALRDG--GHFNPTKYFVEEVVASVDESDLY  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ-------------------LELEGL  531
            RTW+KVVATRNT ERSSRLENMCWRIWHL RKKKQ                   LE E +
Sbjct  59   RTWVKVVATRNTRERSSRLENMCWRIWHLARKKKQLVRRGMRTDQALFPWESNSLEWEEV  118

Query  532  QRLAHRRWEREQGRKDVTEDMS  597
            QRLA+RRWEREQGR+D TEDMS
Sbjct  119  QRLANRRWEREQGRRDATEDMS  140



>ref|XP_010929745.1| PREDICTED: LOW QUALITY PROTEIN: probable sucrose-phosphate synthase 
2 [Elaeis guineensis]
Length=1074

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 102/131 (78%), Gaps = 9/131 (7%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES---KPAV------INHRGEQGHFNPTKYFVEEVV  381
            M GNEWINGYLEAILDSGA+ +  +    +PA         H  + GHFNPTKYFVEEVV
Sbjct  1    MVGNEWINGYLEAILDSGAATVSEDHQHHRPAASPKKERCGHHFDPGHFNPTKYFVEEVV  60

Query  382  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  561
            SGVDE DLHRTWIKVVATR+++ERS+RLENMCWRIWHL RKKKQ+E E  QR A  RWE+
Sbjct  61   SGVDEHDLHRTWIKVVATRDSLERSARLENMCWRIWHLARKKKQMEWEDFQRKAKHRWEQ  120

Query  562  EQGRKDVTEDM  594
            EQGRKD TED+
Sbjct  121  EQGRKDATEDL  131



>ref|XP_010475162.1| PREDICTED: probable sucrose-phosphate synthase 3 [Camelina sativa]
 ref|XP_010475163.1| PREDICTED: probable sucrose-phosphate synthase 3 [Camelina sativa]
 ref|XP_010475164.1| PREDICTED: probable sucrose-phosphate synthase 3 [Camelina sativa]
Length=1061

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP--AVINHRGEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP  AV    G+   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEDTQQKPQTAVNLREGDGQFFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRIANRRMEREQGRRD  120

Query  580  VTEDMS  597
             TE +S
Sbjct  121  ATEVLS  126



>emb|CDY18270.1| BnaC05g02930D [Brassica napus]
Length=1065

 Score =   184 bits (468),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 4/126 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP--AVINHR-GEQGHFNPTKYFVEEVVSGVDE  396
            MAGNEWINGYLEAILDS A  IE  + KP  +V   R GE   FNPTKYFVEEVV+GVDE
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQTSVTALRDGEGEFFNPTKYFVEEVVTGVDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            TDLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+RR EREQGR+
Sbjct  61   TDLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVANRRLEREQGRR  120

Query  577  DVTEDM  594
            D TED+
Sbjct  121  DATEDL  126



>ref|XP_009119233.1| PREDICTED: probable sucrose-phosphate synthase 3 [Brassica rapa]
Length=1064

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 102/125 (82%), Gaps = 3/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKP--AVINHRGEQGHFNPTKYFVEEVVSGVDET  399
            MAGNEWINGYLEAILDS A  IE  + KP  +V    GE   FNPTKYFVEEVV+GVDET
Sbjct  1    MAGNEWINGYLEAILDSQAQGIEETQQKPQTSVALRDGEGEFFNPTKYFVEEVVTGVDET  60

Query  400  DLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKD  579
            DLHRTW+KVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A+R   REQGR+D
Sbjct  61   DLHRTWLKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVANRSVTREQGRRD  120

Query  580  VTEDM  594
             TED+
Sbjct  121  ATEDL  125



>gb|KFK42840.1| hypothetical protein AALP_AA1G045800 [Arabis alpina]
Length=1068

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 103/129 (80%), Gaps = 6/129 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKP----AVINHR--GEQGHFNPTKYFVEEVVSGV  390
            MAGNEWINGYLEAILDS    IE + +       +N R  GE   FNPTKYFVEEVV+GV
Sbjct  1    MAGNEWINGYLEAILDSQTQGIEEQQQQQKPQGALNLREGGEGQFFNPTKYFVEEVVTGV  60

Query  391  DETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQG  570
            DETDLHRTWIKVVATRN+ ER+SRLENMCWRIWHLTRKKKQLE E  QR+A RR EREQG
Sbjct  61   DETDLHRTWIKVVATRNSRERNSRLENMCWRIWHLTRKKKQLEWEDSQRVASRRMEREQG  120

Query  571  RKDVTEDMS  597
            R+D TED+S
Sbjct  121  RRDATEDLS  129



>gb|AEO46461.1| sucrose phosphate synthase B [Saccharum hybrid cultivar ROC22]
Length=1074

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 101/132 (77%), Gaps = 9/132 (7%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAI---------EVESKPAVINHRGEQGHFNPTKYFVEEVV  381
            MAGNEWINGYLEAILDS ASA          +  S     + RG   +FNP+ YFVEEVV
Sbjct  1    MAGNEWINGYLEAILDSRASAGGGGGGGGGGDPRSPTKAASPRGPHMNFNPSHYFVEEVV  60

Query  382  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  561
             GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR++ RR E+
Sbjct  61   KGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQRISARRKEQ  120

Query  562  EQGRKDVTEDMS  597
            EQ R++ TED++
Sbjct  121  EQVRREATEDLA  132



>ref|XP_008794976.1| PREDICTED: probable sucrose-phosphate synthase 2 [Phoenix dactylifera]
Length=1084

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 96/136 (71%), Gaps = 14/136 (10%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEV--------------ESKPAVINHRGEQGHFNPTKYF  366
            M GNEWINGYLEAILDSGA+ +                  K     H  + GHFNPTKYF
Sbjct  1    MVGNEWINGYLEAILDSGAATVAEDHHHHHHRPAAAAASPKKKRGGHHFDPGHFNPTKYF  60

Query  367  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  546
            VEEVVSGVDE DLHRTWI VVATR++ ERS+RLENMCWRIWHL RKKKQ+E E  QR   
Sbjct  61   VEEVVSGVDEHDLHRTWIMVVATRDSRERSARLENMCWRIWHLARKKKQMEWEDFQRKEK  120

Query  547  RRWEREQGRKDVTEDM  594
             RWE+EQGRKD TED+
Sbjct  121  HRWEQEQGRKDATEDL  136



>ref|NP_001105694.1| sucrose-phosphate synthase [Zea mays]
 sp|P31927.1|SPSA_MAIZE RecName: Full=Sucrose-phosphate synthase; AltName: Full=UDP-glucose-fructose-phosphate 
glucosyltransferase [Zea mays]
 gb|AAA33513.1| sucrose phosphate synthase [Zea mays]
 gb|AFW84161.1| sucrose phosphate synthase1 [Zea mays]
Length=1068

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 100/132 (76%), Gaps = 9/132 (7%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA---------IEVESKPAVINHRGEQGHFNPTKYFVEEVV  381
            MAGNEWINGYLEAILDS  S+          +  S     + RG   +FNP+ YFVEEVV
Sbjct  1    MAGNEWINGYLEAILDSHTSSRGAGGGGGGGDPRSPTKAASPRGAHMNFNPSHYFVEEVV  60

Query  382  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  561
             GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR++ RR E+
Sbjct  61   KGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQRISARRKEQ  120

Query  562  EQGRKDVTEDMS  597
            EQ R++ TED++
Sbjct  121  EQVRREATEDLA  132



>gb|AAR84220.1| sucrose-phosphate synthase [Triticum aestivum]
Length=188

 Score =   159 bits (403),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 99/139 (71%), Gaps = 16/139 (12%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVE----------------SKPAVINHRGEQGHFNPTK  360
            MAGNEWINGYLEAILDSGAS                        +  + RG    FNPT 
Sbjct  1    MAGNEWINGYLEAILDSGASGGGGGGGSGAGAGGGGGGGGGDPKSSSSPRGPHTIFNPTT  60

Query  361  YFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRL  540
            YFVEEVV GVDE+DLHRTWIKVVATRN  ERSSRLENMCWRIWHL RKKKQLE+EG+QR+
Sbjct  61   YFVEEVVKGVDESDLHRTWIKVVATRNARERSSRLENMCWRIWHLARKKKQLEIEGIQRM  120

Query  541  AHRRWEREQGRKDVTEDMS  597
            + R+ E+E+ R++ TED+S
Sbjct  121  SARQNEQEKVRREATEDLS  139



>ref|XP_008674664.1| PREDICTED: sucrose-phosphate synthase-like [Zea mays]
Length=1079

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 14/137 (10%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA--------------IEVESKPAVINHRGEQGHFNPTKYF  366
            MAGNEWINGYLEAILDS  S+              +   S     + RG   +FNP+ YF
Sbjct  1    MAGNEWINGYLEAILDSRTSSGGGGGGGGGDPRSPVAGASPTKGASPRGPHMNFNPSHYF  60

Query  367  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  546
            VEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR++ 
Sbjct  61   VEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQRISA  120

Query  547  RRWEREQGRKDVTEDMS  597
            RR E+EQ R++ TED++
Sbjct  121  RRKEQEQVRREATEDLA  137



>ref|XP_002458991.1| hypothetical protein SORBIDRAFT_03g043900 [Sorghum bicolor]
 gb|EES04111.1| hypothetical protein SORBIDRAFT_03g043900 [Sorghum bicolor]
Length=1081

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 100/141 (71%), Gaps = 18/141 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA------------------IEVESKPAVINHRGEQGHFNP  354
            MAGNEWINGYLEAILDS  +A                  +   S     + RG   +FNP
Sbjct  1    MAGNEWINGYLEAILDSRTTAGGGGGGGGGGGGGDPRSPVAGASPTKAASPRGPHMNFNP  60

Query  355  TKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQ  534
            + YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+Q
Sbjct  61   SHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGMQ  120

Query  535  RLAHRRWEREQGRKDVTEDMS  597
            R++ RR E+EQ R++ TED++
Sbjct  121  RISARRKEQEQVRREATEDLA  141



>ref|XP_004491325.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cicer 
arietinum]
Length=1053

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 94/124 (76%), Gaps = 7/124 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSG-ASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  405
            MAGNEWINGYLEAIL +G A++  VE +  V     E GHFNP KYFVEEVVS VDE+DL
Sbjct  1    MAGNEWINGYLEAILSTGVAASTTVEEQQRVAATAAESGHFNPIKYFVEEVVSAVDESDL  60

Query  406  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            HRTW+KVVATRNT ERSSRLENMCWRIWHL RKKKQLE            EREQGR+D T
Sbjct  61   HRTWLKVVATRNTRERSSRLENMCWRIWHLARKKKQLE------GXXXXXEREQGRRDAT  114

Query  586  EDMS  597
            ED+S
Sbjct  115  EDLS  118



>gb|AAC49379.1| sucrose phosphate synthase [Oryza sativa Indica Group]
Length=1049

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 102/132 (77%), Gaps = 9/132 (7%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA--------IEVESKPA-VINHRGEQGHFNPTKYFVEEVV  381
            MAGNEWINGYLEAILDSG +A        ++  S  A   + RG   +FNPT YFVEEVV
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGVDPRSPAAGAASPRGPHMNFNPTHYFVEEVV  60

Query  382  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  561
             GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+ R++ RR E+
Sbjct  61   KGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGILRISARRKEQ  120

Query  562  EQGRKDVTEDMS  597
            EQ R++ +ED++
Sbjct  121  EQVRRETSEDLA  132



>ref|XP_006645236.1| PREDICTED: probable sucrose-phosphate synthase 1-like [Oryza 
brachyantha]
Length=1083

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 100/140 (71%), Gaps = 17/140 (12%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVI---NHRGEQG--------------HFNPT  357
            MAGNEWINGYLEAILDSG +A              HRGE                +FNPT
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGDAAGRRRHRGEPAPQLRGXXSPRGLHMNFNPT  60

Query  358  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  537
             YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR
Sbjct  61   HYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQR  120

Query  538  LAHRRWEREQGRKDVTEDMS  597
            ++ RR E+EQ R++ TED++
Sbjct  121  ISARRKEQEQVRRETTEDLA  140



>emb|CDM85683.1| unnamed protein product [Triticum aestivum]
Length=1069

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 100/140 (71%), Gaps = 17/140 (12%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-----------------VESKPAVINHRGEQGHFNPT  357
            MAGNEWINGYLEAILDSGAS                    V    +  + RG    FNPT
Sbjct  1    MAGNEWINGYLEAILDSGASGGGGGGGGGGGSGGGGGGAGVGDPKSSSSPRGPHTIFNPT  60

Query  358  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  537
             YFVEEVV GVDE+DLHRTWIKVVATRN  ERSSRLENMCWRIWHL RKKKQLE+EG+QR
Sbjct  61   TYFVEEVVKGVDESDLHRTWIKVVATRNARERSSRLENMCWRIWHLARKKKQLEIEGIQR  120

Query  538  LAHRRWEREQGRKDVTEDMS  597
            ++ R+ E+EQ R++ TED+S
Sbjct  121  MSARQKEQEQVRREATEDLS  140



>gb|KDO42450.1| hypothetical protein CISIN_1g001705mg [Citrus sinensis]
Length=1024

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 98/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINH----RGEQGH-FNPTKYFVEEVVSGVD  393
            MAGNEWINGYLEAILD+G+   ++      ++     + ++G  F+PTKYFVEEV++  D
Sbjct  1    MAGNEWINGYLEAILDAGSGKTKMNDGKFKLSKFEETKQKEGQLFSPTKYFVEEVINSFD  60

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            E+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  E  QRLA RR EREQGR
Sbjct  61   ESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWEDAQRLAKRRLEREQGR  120

Query  574  KDVTEDMS  597
             D  +D+S
Sbjct  121  NDAADDLS  128



>ref|XP_006478341.1| PREDICTED: probable sucrose-phosphate synthase 4-like [Citrus 
sinensis]
Length=1024

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 98/128 (77%), Gaps = 5/128 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINH----RGEQGH-FNPTKYFVEEVVSGVD  393
            MAGNEWINGYLEAILD+G+   ++      ++     + ++G  F+PTKYFVEEV++  D
Sbjct  1    MAGNEWINGYLEAILDAGSGKTKMNDGKFKLSKFEETKQKEGQLFSPTKYFVEEVINSFD  60

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            E+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  E  QRLA RR EREQGR
Sbjct  61   ESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWEDAQRLAKRRLEREQGR  120

Query  574  KDVTEDMS  597
             D  +D+S
Sbjct  121  NDAADDLS  128



>ref|XP_003564935.1| PREDICTED: sucrose-phosphate synthase [Brachypodium distachyon]
Length=1078

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 99/135 (73%), Gaps = 12/135 (9%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDS------------GASAIEVESKPAVINHRGEQGHFNPTKYFVE  372
            MAGNEWINGYLEAILDS               +    +  +  + RG   +F+PT YFVE
Sbjct  1    MAGNEWINGYLEAILDSGGAAAGGGAGGGDPKSAVAGAGASSASPRGPHMNFSPTHYFVE  60

Query  373  EVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRR  552
            EVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQLELEG+QR++ R+
Sbjct  61   EVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLELEGIQRMSARQ  120

Query  553  WEREQGRKDVTEDMS  597
             E+EQ R++ TED++
Sbjct  121  KEQEQVRREATEDLA  135



>sp|A2WYE9.2|SPSA1_ORYSI RecName: Full=Probable sucrose-phosphate synthase 1; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase [Oryza 
sativa Indica Group]
 sp|Q0JGK4.2|SPSA1_ORYSJ RecName: Full=Probable sucrose-phosphate synthase 1; AltName: 
Full=Sucrose phosphate synthase 1F; Short=OsSPS1F; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase [Oryza 
sativa Japonica Group]
 dbj|BAD87626.1| sucrose phosphate synthase [Oryza sativa Japonica Group]
Length=1084

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 102/148 (69%), Gaps = 25/148 (17%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA------------------------IEVESKPA-VINHRG  333
            MAGNEWINGYLEAILDSG +A                        ++  S  A   + RG
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPRSPAAGAASPRG  60

Query  334  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  513
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  514  LELEGLQRLAHRRWEREQGRKDVTEDMS  597
            LELEG+ R++ RR E+EQ R++ +ED++
Sbjct  121  LELEGILRISARRKEQEQVRRETSEDLA  148



>gb|KDP31602.1| hypothetical protein JCGZ_14827 [Jatropha curcas]
Length=1016

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 94/128 (73%), Gaps = 5/128 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVI-----NHRGEQGHFNPTKYFVEEVVSGVD  393
            MAGN+WINGYLEAILD G+S  +       I     +   E   FNPTKYFVEEVV+  D
Sbjct  1    MAGNDWINGYLEAILDVGSSLRKRNDGKVKIAKFEESKEKEDKLFNPTKYFVEEVVNSFD  60

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            E+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  QRLA R+ EREQGR
Sbjct  61   ESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDAQRLARRQLEREQGR  120

Query  574  KDVTEDMS  597
             D  +D+S
Sbjct  121  DDAEDDLS  128



>dbj|BAA08304.1| sucrose phosphate synthase [Oryza sativa Japonica Group]
Length=1084

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 100/148 (68%), Gaps = 25/148 (17%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEV-----------------------ESKP--AVINHRG  333
            MAGNEWINGYLEAILDSG +A                           S P     + RG
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPSSPTTGTTSPRG  60

Query  334  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  513
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  514  LELEGLQRLAHRRWEREQGRKDVTEDMS  597
            LELEG+ R++ RR E+EQ R++ +ED++
Sbjct  121  LELEGILRISARRKEQEQVRRETSEDLA  148



>emb|CAC81823.1| sucrose-phosphate synthase [Beta vulgaris]
Length=214

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 5/128 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            MAGN+WIN YLEAILD G   I+  +     +        E+GHF+P++YFVEEV++G D
Sbjct  1    MAGNDWINSYLEAILDVGGQGIDASNAKTSSSSPSSLLLRERGHFSPSRYFVEEVITGFD  60

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  +TR+  ER++RLEN+CWRIW+L RKKKQ+E E  QR A R  ERE+GR
Sbjct  61   ETDLHRSWVRAASTRSPQERNTRLENLCWRIWNLARKKKQIEGEEAQRSAKRHIEREKGR  120

Query  574  KDVTEDMS  597
            ++ T DMS
Sbjct  121  REATADMS  128



>ref|XP_007019751.1| Sucrose-phosphate synthase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY16976.1| Sucrose-phosphate synthase family protein isoform 2 [Theobroma 
cacao]
Length=1027

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 95/130 (73%), Gaps = 7/130 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA-------IEVESKPAVINHRGEQGHFNPTKYFVEEVVSG  387
            MAGNEWINGYLEAILD G+         +++   P       E+  F+PTKYFVEEV++ 
Sbjct  1    MAGNEWINGYLEAILDVGSGTRKRYDGQLKIAKFPEHKVQVKEEKVFSPTKYFVEEVINS  60

Query  388  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  567
             DE+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  +RLA RR EREQ
Sbjct  61   FDESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDARRLAKRRLEREQ  120

Query  568  GRKDVTEDMS  597
            GR D  +D+S
Sbjct  121  GRNDAADDLS  130



>ref|XP_007019750.1| Sucrose-phosphate synthase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16975.1| Sucrose-phosphate synthase family protein isoform 1 [Theobroma 
cacao]
Length=1024

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 95/130 (73%), Gaps = 7/130 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA-------IEVESKPAVINHRGEQGHFNPTKYFVEEVVSG  387
            MAGNEWINGYLEAILD G+         +++   P       E+  F+PTKYFVEEV++ 
Sbjct  1    MAGNEWINGYLEAILDVGSGTRKRYDGQLKIAKFPEHKVQVKEEKVFSPTKYFVEEVINS  60

Query  388  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  567
             DE+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  +RLA RR EREQ
Sbjct  61   FDESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDARRLAKRRLEREQ  120

Query  568  GRKDVTEDMS  597
            GR D  +D+S
Sbjct  121  GRNDAADDLS  130



>ref|XP_002521744.1| sucrose phosphate syntase, putative [Ricinus communis]
 gb|EEF40554.1| sucrose phosphate syntase, putative [Ricinus communis]
Length=1021

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 94/128 (73%), Gaps = 5/128 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVI-----NHRGEQGHFNPTKYFVEEVVSGVD  393
            MAGN+WINGYLEAILD G S  +       I     +   E   F+PT+YFVEEV++  D
Sbjct  1    MAGNDWINGYLEAILDVGNSLRKRNDGKLKIAKYEESKEKEDKSFSPTRYFVEEVINSFD  60

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            E+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKK++E +  QRLA RR EREQGR
Sbjct  61   ESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKKIEWDDAQRLAKRRLEREQGR  120

Query  574  KDVTEDMS  597
             D  ED+S
Sbjct  121  NDAAEDLS  128



>ref|XP_002319320.2| sucrose-phosphate synthase family protein [Populus trichocarpa]
 gb|EEE95243.2| sucrose-phosphate synthase family protein [Populus trichocarpa]
Length=1020

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES----KPAVINHRGEQGHFNPTKYFVEEVVSGVDE  396
            MA NEWINGYLEAILD G+  ++  S    K A      E   F+P KYFVEEV++  DE
Sbjct  1    MARNEWINGYLEAILDVGSGVMKKRSDGRLKIAKFQQVKEDKLFSPIKYFVEEVINSFDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            +DLHRTW+K++ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  QRLA RR EREQGR 
Sbjct  61   SDLHRTWVKMIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDAQRLAKRRLEREQGRN  120

Query  577  DVTEDMS  597
            D  +D+S
Sbjct  121  DAADDLS  127



>ref|XP_011011070.1| PREDICTED: probable sucrose-phosphate synthase 4 [Populus euphratica]
Length=1020

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES----KPAVINHRGEQGHFNPTKYFVEEVVSGVDE  396
            MA NEWINGYLEAILD G+  ++  S    K A      E   F+P KYFVEEV++  DE
Sbjct  1    MARNEWINGYLEAILDVGSGIMKKRSDGRLKIAKFQQVKEDKLFSPIKYFVEEVINSFDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            +DLHRTW+K++ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  QRLA RR EREQGR 
Sbjct  61   SDLHRTWVKMIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDAQRLAKRRLEREQGRN  120

Query  577  DVTEDMS  597
            D  +D+S
Sbjct  121  DAADDLS  127



>ref|XP_006836877.1| hypothetical protein AMTR_s00099p00104230 [Amborella trichopoda]
 gb|ERM99730.1| hypothetical protein AMTR_s00099p00104230 [Amborella trichopoda]
Length=1053

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 95/128 (74%), Gaps = 6/128 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAV-----INHRGEQGHFNPTKYFVEEVVSGVD  393
            MAGNEWINGYLEAILD GA  +E  SK +         +  +G  +PTKYFV +VV+G D
Sbjct  1    MAGNEWINGYLEAILDVGAK-LEEGSKNSAWAKLDEGSKNSKGFIDPTKYFVGQVVTGFD  59

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETD H+TWIKV+ATRNT ER++RLENMCWRIWHL RKKK++E +  +RLA R  +REQGR
Sbjct  60   ETDFHKTWIKVIATRNTRERNNRLENMCWRIWHLARKKKKIEWDDARRLAKRYLKREQGR  119

Query  574  KDVTEDMS  597
            KD   DMS
Sbjct  120  KDAAADMS  127



>gb|ADG01610.1| sucrose phosphate synthase [Xerophyta humilis]
Length=1080

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 99/129 (77%), Gaps = 7/129 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGAS---AIEVESKPAVINHRGEQG---HFNPTK-YFVEEVVSG  387
            MAGNEWINGYLEAILDSG +   A E + +      R       HFNPT+ Y VEEVV+G
Sbjct  1    MAGNEWINGYLEAILDSGGAGGGATEKDQQRRQQQKRSGAAVVEHFNPTRVYLVEEVVTG  60

Query  388  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  567
            VDETDLHRTWIKVVATR++ ERSSRLENMCWRIWHLTRKKKQLE E  QR+  RR EREQ
Sbjct  61   VDETDLHRTWIKVVATRSSRERSSRLENMCWRIWHLTRKKKQLEWEENQRITSRRLEREQ  120

Query  568  GRKDVTEDM  594
            GR+D TEDM
Sbjct  121  GRRDATEDM  129



>ref|XP_008786458.1| PREDICTED: probable sucrose-phosphate synthase 4 [Phoenix dactylifera]
Length=1040

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGAS---AIEVESKPAVINH----RGEQGHFNPTKYFVEEVVSG  387
            MAGNEW+NGYLEAILD+GA         S P+ +       G++  ++PTKYFVEEVV  
Sbjct  1    MAGNEWLNGYLEAILDAGAKRSVGSRQRSHPSALEKEELGNGKEPGYSPTKYFVEEVVDR  60

Query  388  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  567
             DETDLH+TWIKVVATRN+ ERS+RLEN+CWRIWHL RKKKQ++ +  QRLA RR E+ +
Sbjct  61   CDETDLHKTWIKVVATRNSQERSNRLENLCWRIWHLARKKKQIKRDDAQRLAKRREEQRR  120

Query  568  GRKDVTEDMS  597
            G KD  ED+S
Sbjct  121  GSKDAAEDIS  130



>ref|XP_002873988.1| ATSPS1F [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50247.1| ATSPS1F [Arabidopsis lyrata subsp. lyrata]
Length=1045

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAILD G    +  S P+++    E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQGLDDARSSPSLLLR--ERGRFTPSRYFVEEVITGYDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W+K VATR+  ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++ T 
Sbjct  59   RSWVKAVATRSPQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLEREKGRREATA  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>ref|NP_197528.1| sucrose phosphate synthase 1F [Arabidopsis thaliana]
 sp|Q94BT0.1|SPSA1_ARATH RecName: Full=Sucrose-phosphate synthase 1; AltName: Full=Sucrose-phosphate 
synthase 1F; Short=AtSPS1F; AltName: Full=Sucrose-phosphate 
synthase 5.1; Short=AtSPS5.1; AltName: Full=UDP-glucose-fructose-phosphate 
glucosyltransferase [Arabidopsis 
thaliana]
 gb|AAK64015.1| putative sucrose-phosphate synthase [Arabidopsis thaliana]
 gb|AAL85065.1| putative sucrose-phosphate synthase [Arabidopsis thaliana]
 gb|AED92824.1| sucrose phosphate synthase 1F [Arabidopsis thaliana]
 gb|AHL38616.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1043

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAILD G    +  S P+++    E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQGLDDARSSPSLLLR--ERGRFTPSRYFVEEVITGYDETDLH  58

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W+K VATR+  ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++ T 
Sbjct  59   RSWVKAVATRSPQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLEREKGRREATA  118

Query  589  DMS  597
            DMS
Sbjct  119  DMS  121



>sp|P31928.1|SPSA_SPIOL RecName: Full=Sucrose-phosphate synthase; AltName: Full=UDP-glucose-fructose-phosphate 
glucosyltransferase [Spinacia oleracea]
 gb|AAA20092.1| sucrose phosphate synthase [Spinacia oleracea]
Length=1056

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 6/128 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES-----KPAVINHRGEQGHFNPTKYFVEEVVSGVD  393
            MAGN+WIN YLEAILD G   I+  +      P  +  R E+GHF+P++YFVEEV+SG D
Sbjct  1    MAGNDWINSYLEAILDVGGQGIDASTGKTSTAPPSLLLR-ERGHFSPSRYFVEEVISGFD  59

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  +TR+  ER++RLEN+CWRIW+L RKKKQ+E E  QRLA R  ERE+GR
Sbjct  60   ETDLHRSWVRAASTRSPQERNTRLENLCWRIWNLARKKKQIEGEEAQRLAKRHVERERGR  119

Query  574  KDVTEDMS  597
            ++ T DMS
Sbjct  120  REATADMS  127



>gb|KJB65850.1| hypothetical protein B456_010G116100 [Gossypium raimondii]
 gb|KJB65851.1| hypothetical protein B456_010G116100 [Gossypium raimondii]
Length=1047

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    E +S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+WI+  ATR   ER++RLENMCWRIW+L RKKKQLE E +QR A R  ERE+GR++ T 
Sbjct  57   RSWIRAAATRGPKERNTRLENMCWRIWNLARKKKQLEGEEVQRNAKRHLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_008443934.1| PREDICTED: probable sucrose-phosphate synthase 1 [Cucumis melo]
Length=1150

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES-KPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  405
            MAGN+WIN YLEAILD G    E +S K +      E+GHF+PT+YFVEEV++G DE+DL
Sbjct  97   MAGNDWINSYLEAILDVGPGIDEAKSAKQSSSLLLRERGHFSPTRYFVEEVITGFDESDL  156

Query  406  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            +R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T
Sbjct  157  YRSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRMAKRRLEREKGRREAT  216

Query  586  EDMS  597
             DMS
Sbjct  217  ADMS  220



>ref|XP_007199693.1| hypothetical protein PRUPE_ppa000716mg [Prunus persica]
 gb|EMJ00892.1| hypothetical protein PRUPE_ppa000716mg [Prunus persica]
Length=1025

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQ----GHFNPTKYFVEEVVSGVDE  396
            MAGN+W+NGYLEAILD+G++  ++      I    EQ      F+PTKYFVEEV++  DE
Sbjct  1    MAGNDWLNGYLEAILDAGSNTRKMNDGRVKIAKFEEQVKEEKMFSPTKYFVEEVINSFDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            +DLHRTW+KV+ATRNT ERS+RLEN CWRIWHL RKKKQ+  +  +RLA RR EREQGR 
Sbjct  61   SDLHRTWVKVIATRNTRERSNRLENTCWRIWHLARKKKQIAWDDARRLAKRRLEREQGRH  120

Query  577  DVTEDMS  597
            D  +D+S
Sbjct  121  DAEDDLS  127



>ref|XP_010252403.1| PREDICTED: probable sucrose-phosphate synthase 4 [Nelumbo nucifera]
Length=1054

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 100/149 (67%), Gaps = 26/149 (17%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES------------KPAVINHRGEQGH---------  345
            MAGNEWINGYLEAILD+G SA +               +P  I++R E+           
Sbjct  1    MAGNEWINGYLEAILDAGISATKSRKNGGGGGGHDRSFRPGRISNRKEESEEKESKVEET  60

Query  346  ----FNPT-KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKK  510
                F+PT KYFVEEVV+  DE+DLHRTWI V+ATRNT ER++RLENMCWRIWHL RKKK
Sbjct  61   NLSLFSPTTKYFVEEVVNSFDESDLHRTWIAVIATRNTRERNNRLENMCWRIWHLVRKKK  120

Query  511  QLELEGLQRLAHRRWEREQGRKDVTEDMS  597
            Q+E +  QRLA RR EREQGR D  ED+S
Sbjct  121  QIEWDDAQRLAKRRIEREQGRNDAAEDLS  149



>ref|XP_008237831.1| PREDICTED: probable sucrose-phosphate synthase 4 [Prunus mume]
Length=1023

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQ----GHFNPTKYFVEEVVSGVDE  396
            MAGN+W+NGYLEAILD+G++  ++      I    EQ      F+PTKYFVEEV++  DE
Sbjct  1    MAGNDWLNGYLEAILDAGSNTRKMNDGRVKIAKFEEQVKEENMFSPTKYFVEEVINSFDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            +DLHRTW+KV+ATRNT ERS+RLEN CWRIWHL RKKKQ+  +  +RLA RR ERE GR 
Sbjct  61   SDLHRTWVKVIATRNTRERSNRLENTCWRIWHLARKKKQIAWDDARRLAKRRLEREHGRN  120

Query  577  DVTEDMS  597
            D  +D+S
Sbjct  121  DAEDDLS  127



>ref|XP_010048168.1| PREDICTED: probable sucrose-phosphate synthase 1 [Eucalyptus 
grandis]
 gb|KCW80349.1| hypothetical protein EUGRSUZ_C01715 [Eucalyptus grandis]
Length=1040

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEW+N YLEAILD G +  + +S   ++    E+G F+PT+YFVE+V++G DETDLH
Sbjct  1    MAGNEWVNSYLEAILDVGPALDDPKSSSLLLR---ERGRFSPTRYFVEQVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L RKKKQLE E  QR+A RR E E+GR++ T 
Sbjct  58   RSWLRAAATRSPQERNTRLENMCWRIWNLARKKKQLEGEEAQRIAKRRLEHERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>ref|XP_007011815.1| Sucrose phosphate synthase 1F [Theobroma cacao]
 gb|EOY29434.1| Sucrose phosphate synthase 1F [Theobroma cacao]
Length=1050

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G   I+V     ++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGP-GIDVAKSSLLLR---ERGHFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR   ER++RLENMCWRIW+L RKKKQLE E  QR    R ERE+GRK+ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARKKKQLEGEEAQRKVKCRLERERGRKEATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_009348252.1| PREDICTED: LOW QUALITY PROTEIN: probable sucrose-phosphate synthase 
4, partial [Pyrus x bretschneideri]
Length=630

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 95/131 (73%), Gaps = 8/131 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQ--------GHFNPTKYFVEEVVS  384
            MAGN+W+NGYLEAILD+G +  + +     I+   E+          FNPTKYFVEEVV+
Sbjct  1    MAGNDWLNGYLEAILDAGNNMRKRDDGRQKISKFEEKFEEQVKADKFFNPTKYFVEEVVN  60

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              DE++LHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  +RL  RR +RE
Sbjct  61   SFDESELHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDARRLVKRRLDRE  120

Query  565  QGRKDVTEDMS  597
            QGR D  +D+S
Sbjct  121  QGRHDAEDDLS  131



>gb|AHE93347.1| sucrose phosphate synthase 1 [Camellia sinensis]
Length=1051

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVE+V++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEQVITGFDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E +QR+A RR ERE+GRK+ T 
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEVQRMAKRRLERERGRKEATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_002324874.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
 gb|EEF03439.1| sucrose-phosphate synthase family protein [Populus trichocarpa]
Length=1054

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD     ++ +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVDPGIVDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  A R+T ER++RLENMCWRIW+L RKKKQLE E  QR+A R  ERE+GRK+ T 
Sbjct  57   RSWLRAAAMRSTQERNTRLENMCWRIWNLARKKKQLEGEEAQRIAKRHLERERGRKEATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|NP_001267857.1| sucrose-phosphate synthase 1 [Vitis vinifera]
 gb|AAW82754.1| sucrose-phosphate synthase 1 [Vitis vinifera]
Length=1043

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 97/150 (65%), Gaps = 27/150 (18%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGAS-----AIEVESKPAVINHRGEQGH----------------  345
            MAGNEWINGYLEAILD+G+S      +E   + +   + G +                  
Sbjct  1    MAGNEWINGYLEAILDAGSSRNGLRVVEDGDEKSNSKNNGSRRRRFVEGKVRIGRLEEKE  60

Query  346  ------FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKK  507
                  FNPTKYFVEEVV+  DE+DLHRTWIKV+ATRN+ +RS+RLENMCWRIWHL RKK
Sbjct  61   KEKEEVFNPTKYFVEEVVNSFDESDLHRTWIKVIATRNSRDRSNRLENMCWRIWHLARKK  120

Query  508  KQLELEGLQRLAHRRWEREQGRKDVTEDMS  597
            KQ+  +  QRL  RR EREQGR D  +D+S
Sbjct  121  KQIAWDDAQRLTKRRLEREQGRHDAADDLS  150



>ref|XP_010062352.1| PREDICTED: probable sucrose-phosphate synthase 4 [Eucalyptus 
grandis]
 gb|KCW69478.1| hypothetical protein EUGRSUZ_F02931 [Eucalyptus grandis]
Length=1031

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 15/137 (11%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE--------------VESKPAVINHRGEQGHFNPTKYF  366
            MAGNEWINGYLEAILD+G   ++              V +     N R E   F+PT+YF
Sbjct  1    MAGNEWINGYLEAILDAGRYNVKRRGDGKIGGGGKGGVVATEFDGNER-EGSLFSPTRYF  59

Query  367  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  546
            VEEVV+  DE+DLH+TWIKV+ATRNT ER++RLENMCWRIWHL RKKKQ+  +  QRLA 
Sbjct  60   VEEVVNSFDESDLHKTWIKVIATRNTRERNNRLENMCWRIWHLARKKKQIAWDDAQRLAK  119

Query  547  RRWEREQGRKDVTEDMS  597
            RR EREQGR +  +D+S
Sbjct  120  RRLEREQGRSEAADDLS  136



>ref|XP_002972277.1| sucrose phosphate synthase [Selaginella moellendorffii]
 gb|EFJ26363.1| sucrose phosphate synthase [Selaginella moellendorffii]
Length=1104

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 93/136 (68%), Gaps = 17/136 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESK----PAVINHRGEQGHFNPTKYFVEEVVSGVDE  396
            MAGNEWINGYLEAILDSG    E  +     PA  +  G    FN +KYFVEEVVSG DE
Sbjct  1    MAGNEWINGYLEAILDSGVGIDEQRASDRKAPASPDLLG----FNASKYFVEEVVSGFDE  56

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLEL---------EGLQRLAHR  549
            TD+HRTW+K  ATRN  ERS+RLEN+CWRIWHLTRKKKQ            E  QR++HR
Sbjct  57   TDIHRTWVKATATRNVRERSARLENLCWRIWHLTRKKKQASFCPLWFFFLAEHAQRVSHR  116

Query  550  RWEREQGRKDVTEDMS  597
            + +REQG  + TED+S
Sbjct  117  KIQREQGLLETTEDLS  132



>gb|ABG67969.1| putative sucrose phosphate synthase [Gossypium hirsutum]
Length=581

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_006582436.1| PREDICTED: probable sucrose-phosphate synthase 4-like isoform 
X2 [Glycine max]
Length=582

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 94/131 (72%), Gaps = 9/131 (7%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGASAIEVESKPAVIN--------HRGEQGHFNPT-KYFVEEVVS  384
            A NEW+NGYLEAILD G+S  E ++   V N        H+ E+  FNPT KYFVEEVV+
Sbjct  3    AVNEWLNGYLEAILDVGSSVKEKKNDGKVKNFAKFEQEKHQREEKLFNPTTKYFVEEVVN  62

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              +E DL+RTW+KV A RNT ERS+RLENMCWRIWHLTRKKKQ+  +  QRLA +R +RE
Sbjct  63   SFNEHDLYRTWVKVTARRNTRERSNRLENMCWRIWHLTRKKKQIAWDDAQRLARKRLDRE  122

Query  565  QGRKDVTEDMS  597
            QGR D   D+S
Sbjct  123  QGRNDAANDLS  133



>ref|XP_008348712.1| PREDICTED: probable sucrose-phosphate synthase 4 [Malus domestica]
Length=1024

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGH----FNPTKYFVEEVVSGVDE  396
            MAGN+W+NGYLEAILD+G +  + +     I+   EQ      FNPTKYFVEEVV+  DE
Sbjct  1    MAGNDWLNGYLEAILDAGNNTRKRDDGRQKISKFEEQVKAEKLFNPTKYFVEEVVNSFDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            ++LHRTWIKV+ATRN+ E S+RLEN CWRIWHL RKKKQ+  +  QRL  RR +REQGR+
Sbjct  61   SELHRTWIKVIATRNSREHSNRLENTCWRIWHLARKKKQMAWDDAQRLVKRRLDREQGRR  120

Query  577  DVTEDMS  597
            D  +D+S
Sbjct  121  DAEDDLS  127



>ref|XP_008381670.1| PREDICTED: probable sucrose-phosphate synthase 4 [Malus domestica]
Length=1024

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 92/127 (72%), Gaps = 4/127 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGH----FNPTKYFVEEVVSGVDE  396
            MAGN+W+NGYLEAILD+G +  +       I    EQ      F+PTKYFVEEVV+  DE
Sbjct  1    MAGNDWLNGYLEAILDAGNNTRKRNDGRQKIAKFEEQVKAEKLFSPTKYFVEEVVNSFDE  60

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            ++LHRTW+KV+ATRNT E S+RLENMCWRIWHL RKKKQ+  +  QRL  RR EREQGR 
Sbjct  61   SELHRTWVKVIATRNTRESSNRLENMCWRIWHLARKKKQIAWDDAQRLVKRRLEREQGRN  120

Query  577  DVTEDMS  597
            D  +D+S
Sbjct  121  DAEDDLS  127



>ref|XP_010696531.1| PREDICTED: sucrose-phosphate synthase [Beta vulgaris subsp. vulgaris]
Length=1052

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 5/128 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            MAGN+WIN YLEAILD G   I+  +     +        E+GHF+P++YFVEEV++G D
Sbjct  1    MAGNDWINSYLEAILDVGGQGIDASNAKTSSSSPSSLLLRERGHFSPSRYFVEEVITGFD  60

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  +TR+  ER++RLEN+CWRIW+L RKKKQ+E E  QR A R  ERE+GR
Sbjct  61   ETDLHRSWVRAASTRSPQERNTRLENLCWRIWNLARKKKQIEGEEAQRSAKRHIEREKGR  120

Query  574  KDVTEDMS  597
            ++ T DMS
Sbjct  121  REATADMS  128



>ref|XP_006483396.1| PREDICTED: probable sucrose-phosphate synthase 1-like isoform 
X1 [Citrus sinensis]
 gb|KDO61793.1| hypothetical protein CISIN_1g001557mg [Citrus sinensis]
Length=1054

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAILD G    + +S   +     E+G F+PT+YFVE+V++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEQVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+WI+  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QR A RR ERE+GRK+ + 
Sbjct  57   RSWIRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRKAKRRLERERGRKEASA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_006450383.1| hypothetical protein CICLE_v10007312mg [Citrus clementina]
 gb|ESR63623.1| hypothetical protein CICLE_v10007312mg [Citrus clementina]
Length=1054

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAILD G    + +S   +     E+G F+PT+YFVE+V++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEQVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+WI+  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QR A RR ERE+GRK+ + 
Sbjct  57   RSWIRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRKAKRRLERERGRKEASA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_010520567.1| PREDICTED: sucrose-phosphate synthase 1 [Tarenaya hassleriana]
Length=1061

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    +  S   +     E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDARSSLLL----RERGRFTPSRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W+K VATR+  ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++ T 
Sbjct  57   RSWVKAVATRSPQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLEREKGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_011036585.1| PREDICTED: probable sucrose-phosphate synthase 1 [Populus euphratica]
Length=1054

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD      + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVDPGIDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  A R+T ER++RLENMCWRIW+L RKKKQLE E  QR+A R  ERE+GRK+ T 
Sbjct  57   RSWLRAAAMRSTQERNTRLENMCWRIWNLARKKKQLEGEEAQRIAKRHLERERGRKEATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_002515487.1| sucrose phosphate syntase, putative [Ricinus communis]
 gb|EEF46936.1| sucrose phosphate syntase, putative [Ricinus communis]
Length=1024

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD      E +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVDPGIDEAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+WI+  A R+T ER++RLENMCWRIW+L RKKKQLE E +QR A R  ERE+GR++ T 
Sbjct  57   RSWIRAAAMRSTQERNTRLENMCWRIWNLARKKKQLEGEEVQRKAKRNVERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|EPS71734.1| sucrose-phosphate synthase 1, partial [Genlisea aurea]
Length=1036

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 95/125 (76%), Gaps = 3/125 (2%)
 Frame = +1

Query  223  RKMAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  402
            R MAGN+WIN YLEAILD G S I+ E KP+++    E+G F+PT+YFVEEV++G DETD
Sbjct  6    RLMAGNDWINSYLEAILDVGGSGID-EGKPSLLLR--ERGRFSPTRYFVEEVITGYDETD  62

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHR+WI+  ATR+  ER++RLENMCWRIW+L R KKQ E +  QR+A R  ERE+G ++ 
Sbjct  63   LHRSWIRAQATRSPQERNTRLENMCWRIWNLARLKKQHEEKEAQRIAKRHIERERGLREA  122

Query  583  TEDMS  597
              DMS
Sbjct  123  VADMS  127



>ref|XP_004292975.1| PREDICTED: probable sucrose-phosphate synthase 1 [Fragaria vesca 
subsp. vesca]
Length=1066

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+NGYLEAILD G    + +S  +++    E+G F+PT+YFVEEV++  DETDLH
Sbjct  1    MAGNDWVNGYLEAILDVGPGLDDAKSSSSLLLR--ERGRFSPTRYFVEEVITRYDETDLH  58

Query  409  RTWIKVVAT-RNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            R+W++  AT R+  ER++RLENMCWRIW+L RKK QLE E  QR A RR ERE GR++ T
Sbjct  59   RSWVRAAATARSAEERNTRLENMCWRIWNLARKKNQLEGEEAQRTASRRLEREMGRREAT  118

Query  586  EDMS  597
            EDMS
Sbjct  119  EDMS  122



>gb|KJB27353.1| hypothetical protein B456_004G292800 [Gossypium raimondii]
Length=937

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>dbj|BAP47500.1| sucrose phosphate synthase [Gentiana triflora]
Length=1048

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEVVSG DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVVSGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+WI+  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QRL  R  ERE+GR++   
Sbjct  57   RSWIRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQRLKKRHLEREKGRREAVA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>emb|CDY45096.1| BnaA02g04800D [Brassica napus]
Length=972

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAILD G    +  ++P+++    E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQPLDD--ARPSLLLR--ERGRFTPSRYFVEEVITGYDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            ++W K VATR+T ER++RLENMCWRIW+L R+KKQ E +  QRLA R  ERE+GR+++T+
Sbjct  57   KSWTKAVATRSTQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRPLERERGRREITD  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_009404836.1| PREDICTED: probable sucrose-phosphate synthase 4 [Musa acuminata 
subsp. malaccensis]
Length=1043

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 94/136 (69%), Gaps = 13/136 (10%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGA-------------SAIEVESKPAVINHRGEQGHFNPTKYFV  369
            MAGNEWINGYLEAILD+G              SA++     +  +  G    ++PTKYFV
Sbjct  1    MAGNEWINGYLEAILDAGPKQPLRLRDRNFSFSALKQLVVRSASSGGGGVERYSPTKYFV  60

Query  370  EEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHR  549
            EEVVS  D+ DLH+TW KVVATRN+ ER++RLENMCWRIWHL RKKKQ++ E  QRL+ +
Sbjct  61   EEVVSRFDDADLHKTWTKVVATRNSQERNNRLENMCWRIWHLARKKKQIQWEEAQRLSKK  120

Query  550  RWEREQGRKDVTEDMS  597
            R EREQG KD   D+S
Sbjct  121  RREREQGSKDAAADIS  136



>gb|AFM46031.1| sucrose phosphate synthase [Gossypium hirsutum]
Length=1028

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|KHG17450.1| Solanesyl diphosphate synthase 1 [Gossypium arboreum]
Length=1045

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_003526395.1| PREDICTED: probable sucrose-phosphate synthase 4-like isoform 
X1 [Glycine max]
Length=1037

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 94/131 (72%), Gaps = 9/131 (7%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGASAIEVESKPAVIN--------HRGEQGHFNPT-KYFVEEVVS  384
            A NEW+NGYLEAILD G+S  E ++   V N        H+ E+  FNPT KYFVEEVV+
Sbjct  3    AVNEWLNGYLEAILDVGSSVKEKKNDGKVKNFAKFEQEKHQREEKLFNPTTKYFVEEVVN  62

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              +E DL+RTW+KV A RNT ERS+RLENMCWRIWHLTRKKKQ+  +  QRLA +R +RE
Sbjct  63   SFNEHDLYRTWVKVTARRNTRERSNRLENMCWRIWHLTRKKKQIAWDDAQRLARKRLDRE  122

Query  565  QGRKDVTEDMS  597
            QGR D   D+S
Sbjct  123  QGRNDAANDLS  133



>gb|EEE55897.1| hypothetical protein OsJ_04561 [Oryza sativa Japonica Group]
Length=1240

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 102/164 (62%), Gaps = 41/164 (25%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA------------------------IEVESKPA-VINHRG  333
            MAGNEWINGYLEAILDSG +A                        ++  S  A   + RG
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPRSPAAGAASPRG  60

Query  334  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  513
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  514  ----------------LELEGLQRLAHRRWEREQGRKDVTEDMS  597
                            LELEG+ R++ RR E+EQ R++ +ED++
Sbjct  121  ACIDLSLSFSFFLVFMLELEGILRISARRKEQEQVRRETSEDLA  164



>gb|AAC23914.1| sucrose-phosphate synthase [Musa acuminata AAA Group]
Length=502

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLHR  411
            AGN+WIN YLEAILD+G S   +++  + +  R E+G F+P +YFVEEV++G DETDL++
Sbjct  1    AGNDWINSYLEAILDAGPS---IDAAKSSLLLR-ERGRFSPARYFVEEVITGYDETDLYK  56

Query  412  TWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTED  591
            TW++  A R+  ER++RLENMCWRIW+L RKK+Q+E E  QRL+ RR ERE+ R+D T D
Sbjct  57   TWVRAAAMRSPQERNTRLENMCWRIWNLARKKEQIEGEEAQRLSKRRLEREKARRDATAD  116

Query  592  MS  597
            MS
Sbjct  117  MS  118



>gb|KJB27352.1| hypothetical protein B456_004G292800 [Gossypium raimondii]
Length=1048

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|KHG17451.1| Solanesyl diphosphate synthase 1 [Gossypium arboreum]
Length=1041

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGNFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR   ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T 
Sbjct  57   RSWVRAAATRGPKERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|EEC72045.1| hypothetical protein OsI_04951 [Oryza sativa Indica Group]
Length=1240

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 102/164 (62%), Gaps = 41/164 (25%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA------------------------IEVESKPA-VINHRG  333
            MAGNEWINGYLEAILDSG +A                        ++  S  A   + RG
Sbjct  1    MAGNEWINGYLEAILDSGGAAGGGGGGGGGGGGGGGGGGGGGGGGVDPRSPAAGAASPRG  60

Query  334  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  513
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  514  ----------------LELEGLQRLAHRRWEREQGRKDVTEDMS  597
                            LELEG+ R++ RR E+EQ R++ +ED++
Sbjct  121  ACIDLSLSFSFFLVFMLELEGILRISARRKEQEQVRRETSEDLA  164



>ref|XP_008795846.1| PREDICTED: probable sucrose-phosphate synthase 1 [Phoenix dactylifera]
Length=1053

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            M GN+WIN YLEAILD+G  AI+      ++  RG    F+PT+YFVEEV++G DETDL+
Sbjct  1    MPGNDWINSYLEAILDAGP-AIDASKSSLLLRERGS---FSPTRYFVEEVITGFDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E   R++  R ERE+GRKDVT 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEALRMSKHRLERERGRKDVTA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|AAF06792.1|AF194022_1 sucrose-6-phosphate synthase A [Nicotiana tabacum]
 gb|AHZ89840.1| sucrose-phosphate synthase [Nicotiana tabacum]
Length=1054

 Score =   150 bits (378),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G     +E K + +  R E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPG---IEDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  Q +A RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQWMAKRRQEREKGRREAVA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>emb|CBI17025.3| unnamed protein product [Vitis vinifera]
Length=1018

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGAS--AIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  402
            MAGNEWINGYLEAILD+G+S   + V       ++    G      YFVEEVV+  DE+D
Sbjct  1    MAGNEWINGYLEAILDAGSSRNGLRVVEDGDEKSNSKNNGSRRRRFYFVEEVVNSFDESD  60

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHRTWIKV+ATRN+ +RS+RLENMCWRIWHL RKKKQ+  +  QRL  RR EREQGR D 
Sbjct  61   LHRTWIKVIATRNSRDRSNRLENMCWRIWHLARKKKQIAWDDAQRLTKRRLEREQGRHDA  120

Query  583  TEDMS  597
             +D+S
Sbjct  121  ADDLS  125



>gb|KHG18731.1| putative sucrose-phosphate synthase 4 [Gossypium arboreum]
Length=1043

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 17/140 (12%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVE-----SKPAVINHRG------------EQGHFNPT  357
            MAGNEWIN YLEAILD+G+S  + +     +K A   H              E+  F+ T
Sbjct  1    MAGNEWINSYLEAILDAGSSTKKRDDYVKLTKDAKFQHDNKQHQQQQQQLLKEEKPFSTT  60

Query  358  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  537
            +YFVEEV++  DE+DL+RTW+KV+ATRN+ ER++RLENMCWRIWHL RKKKQ+  +  +R
Sbjct  61   RYFVEEVITSFDESDLYRTWVKVIATRNSRERNNRLENMCWRIWHLARKKKQIAWDDARR  120

Query  538  LAHRRWEREQGRKDVTEDMS  597
            LA RR EREQGR D  +D+S
Sbjct  121  LAKRRLEREQGRNDAADDLS  140



>gb|AGA82513.1| sucrose phosphate synthase, partial [Camellia sinensis]
Length=1051

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 93/122 (76%), Gaps = 4/122 (3%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLHR  411
             GN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVE+V++G DETDL+R
Sbjct  2    GGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEQVITGFDETDLYR  57

Query  412  TWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTED  591
            +W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E +QR+A RR ERE+GRK+ T D
Sbjct  58   SWVRAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEVQRMAKRRLERERGRKEATAD  117

Query  592  MS  597
            MS
Sbjct  118  MS  119



>gb|KHG18729.1| putative sucrose-phosphate synthase 4 [Gossypium arboreum]
Length=1341

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 17/140 (12%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVE-----SKPAVINHRG------------EQGHFNPT  357
            MAGNEWIN YLEAILD+G+S  + +     +K A   H              E+  F+ T
Sbjct  1    MAGNEWINSYLEAILDAGSSTKKRDDYVKLTKDAKFQHDNKQHQQQQQQLLKEEKPFSTT  60

Query  358  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  537
            +YFVEEV++  DE+DL+RTW+KV+ATRN+ ER++RLENMCWRIWHL RKKKQ+  +  +R
Sbjct  61   RYFVEEVITSFDESDLYRTWVKVIATRNSRERNNRLENMCWRIWHLARKKKQIAWDDARR  120

Query  538  LAHRRWEREQGRKDVTEDMS  597
            LA RR EREQGR D  +D+S
Sbjct  121  LAKRRLEREQGRNDAADDLS  140



>emb|CBI21066.3| unnamed protein product [Vitis vinifera]
Length=1034

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAI+D+G +  + +S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWLNSYLEAIIDAGPNLGDAKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W +  ATR+  ER++RLENMCWRIW+L RKKKQLE E  QR+A R  + E+GR++ T 
Sbjct  57   RSWARASATRSPQERNTRLENMCWRIWNLARKKKQLEGEEAQRVAKRHIDHERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_002282808.1| PREDICTED: probable sucrose-phosphate synthase 1 [Vitis vinifera]
Length=1058

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAI+D+G +  + +S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWLNSYLEAIIDAGPNLGDAKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W +  ATR+  ER++RLENMCWRIW+L RKKKQLE E  QR+A R  + E+GR++ T 
Sbjct  57   RSWARASATRSPQERNTRLENMCWRIWNLARKKKQLEGEEAQRVAKRHIDHERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_009774296.1| PREDICTED: probable sucrose-phosphate synthase [Nicotiana sylvestris]
Length=1054

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G     +E K + +  R E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPG---LEDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  Q +A RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQWMAKRRQEREKGRREAVA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_010910717.1| PREDICTED: probable sucrose-phosphate synthase 4, partial [Elaeis 
guineensis]
Length=433

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 93/130 (72%), Gaps = 7/130 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVIN-------HRGEQGHFNPTKYFVEEVVSG  387
            MAGNEW+NGYLEAILD+GA       +P + +         G++  ++PTKYFVEEVV+ 
Sbjct  1    MAGNEWLNGYLEAILDAGAKRSIGSRQPTLPSVFEKEEVGNGKELGYSPTKYFVEEVVNQ  60

Query  388  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  567
             D+TD H+TWIKVVA RN+ ER++RLEN+CWRIW L RKKKQ++ +    LA RR EREQ
Sbjct  61   FDDTDHHKTWIKVVAKRNSQERNNRLENLCWRIWQLARKKKQIKWDDASGLAKRRKEREQ  120

Query  568  GRKDVTEDMS  597
            G KD  +D+S
Sbjct  121  GSKDAAKDLS  130



>gb|AAC60545.2| sucrose-phosphate synthase [Spinacia oleracea]
Length=1056

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 6/128 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES-----KPAVINHRGEQGHFNPTKYFVEEVVSGVD  393
            MAGN+WIN YLEAILD G   I+  +      P  +  R E+GHF+P++YFVEEV+SG D
Sbjct  1    MAGNDWINSYLEAILDIGGQGIDASTGKTSTAPPSLLLR-ERGHFSPSRYFVEEVISGFD  59

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W+ +       ER++RLEN+CWRIW+L RKKKQ+E E  QRLA R  ERE+GR
Sbjct  60   ETDLHRSWVALHQLAGPQERNTRLENLCWRIWNLARKKKQIEGEEAQRLAKRHVERERGR  119

Query  574  KDVTEDMS  597
            ++ T DMS
Sbjct  120  REATADMS  127



>tpg|DAA56138.1| TPA: putative sucrose-phosphate synthase family protein [Zea 
mays]
Length=1127

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 100/185 (54%), Gaps = 62/185 (34%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA--------------IEVESKPAVINHRGEQGHFNPTKYF  366
            MAGNEWINGYLEAILDS  S+              +   S     + RG   +FNP+ YF
Sbjct  1    MAGNEWINGYLEAILDSRTSSGGGGGGGGGDPRSPVAGASPTKGASPRGPHMNFNPSHYF  60

Query  367  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ-----------  513
            VEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ           
Sbjct  61   VEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQLDGEVTIDQAC  120

Query  514  -------------------------------------LELEGLQRLAHRRWEREQGRKDV  582
                                                 LELEG+QR++ RR E+EQ R++ 
Sbjct  121  MVGCGAFRIQNPTLNCDVTSKKKLFADLQCFIAVHIKLELEGIQRISARRKEQEQVRREA  180

Query  583  TEDMS  597
            TED++
Sbjct  181  TEDLA  185



>emb|CDP11522.1| unnamed protein product [Coffea canephora]
Length=1039

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 97/150 (65%), Gaps = 27/150 (18%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKP--AVINHRG-----------------------  333
            MAGNEW+NGYLEAILD+G+      S+    + NH+                        
Sbjct  1    MAGNEWLNGYLEAILDAGSGRNSDGSREEEKIKNHKSTSPSLRKRFDEKLKFEKFEAWKE  60

Query  334  -EQGH-FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKK  507
             E G  F+PTKYFVEEVV+  DE+DL+RTWIKVVATRN+ ER++RLENMCWRIWHL RKK
Sbjct  61   KEAGKLFSPTKYFVEEVVNSFDESDLYRTWIKVVATRNSRERNNRLENMCWRIWHLARKK  120

Query  508  KQLELEGLQRLAHRRWEREQGRKDVTEDMS  597
            KQ+  +  Q+L  RR ERE+GR D  +D+S
Sbjct  121  KQIAWDDAQKLVKRRLEREKGRSDAADDLS  150



>ref|XP_002969539.1| sucrose phosphate synthase [Selaginella moellendorffii]
 gb|EFJ29627.1| sucrose phosphate synthase [Selaginella moellendorffii]
Length=1030

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 94/132 (71%), Gaps = 16/132 (12%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSG-ASAIE------VESKPA--VINHRGEQGHFNPTKYFVEEVV  381
            MAGNEWINGYLEAILD+G A  I+      +ES PA  ++         N TKYF++EVV
Sbjct  1    MAGNEWINGYLEAILDTGTAGTIDYQQQRLLESSPARRIVA-------VNATKYFIQEVV  53

Query  382  SGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWER  561
            SG DETD+H+TW+K    RN+ ERS+RLEN+CWRIWH++RK+KQ+E    QR+A R +E 
Sbjct  54   SGFDETDIHQTWMKATVCRNSKERSARLENLCWRIWHISRKRKQIEWANTQRVADRHFEH  113

Query  562  EQGRKDVTEDMS  597
            EQGRKD  +D+ 
Sbjct  114  EQGRKDAADDLC  125



>gb|KJB59576.1| hypothetical protein B456_009G262100 [Gossypium raimondii]
Length=956

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 17/140 (12%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVE-----SKPAVINHRGEQGH------------FNPT  357
            MAGNEWIN YLEAILD+G+S  + +     +K A   H  +Q              F+ T
Sbjct  1    MAGNEWINSYLEAILDAGSSTKKRDDDVKLTKDAKFQHDNKQHQEQQQQLLKEEKPFSTT  60

Query  358  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  537
            +YFVEEV++  DE+DL+RTW+KV+ATRN+ ER++RLENMCWRIWHL RKKKQ+  +  +R
Sbjct  61   RYFVEEVITSFDESDLYRTWVKVIATRNSRERNNRLENMCWRIWHLARKKKQIAWDDARR  120

Query  538  LAHRRWEREQGRKDVTEDMS  597
            LA RR EREQGR D  +D+S
Sbjct  121  LAKRRLEREQGRNDAADDLS  140



>ref|NP_001289997.1| probable sucrose-phosphate synthase [Beta vulgaris subsp. vulgaris]
 sp|P49031.1|SPSA_BETVU RecName: Full=Probable sucrose-phosphate synthase; AltName: Full=UDP-glucose-fructose-phosphate 
glucosyltransferase [Beta 
vulgaris]
 emb|CAA57500.1| sucrose-phosphate synthase [Beta vulgaris subsp. vulgaris]
Length=1045

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR   RR E E+GR++ T 
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLENEEAQRKTKRRMELERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>emb|CDX94270.1| BnaC02g29300D [Brassica napus]
Length=473

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 8/131 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH-------FNPTKYFVEEVVS  384
            MA NEWIN YLEAILD G S  +  ES   ++   G+          F+P KYFVEEVV+
Sbjct  1    MARNEWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKEPQEKVFSPIKYFVEEVVN  60

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +   RL+ RR ERE
Sbjct  61   SFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWDDGIRLSKRRDERE  120

Query  565  QGRKDVTEDMS  597
            +GR D  ED+S
Sbjct  121  KGRNDAEEDLS  131



>gb|KJB59577.1| hypothetical protein B456_009G262100 [Gossypium raimondii]
Length=1036

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 17/140 (12%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVE-----SKPAVINHRGEQGH------------FNPT  357
            MAGNEWIN YLEAILD+G+S  + +     +K A   H  +Q              F+ T
Sbjct  1    MAGNEWINSYLEAILDAGSSTKKRDDDVKLTKDAKFQHDNKQHQEQQQQLLKEEKPFSTT  60

Query  358  KYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQR  537
            +YFVEEV++  DE+DL+RTW+KV+ATRN+ ER++RLENMCWRIWHL RKKKQ+  +  +R
Sbjct  61   RYFVEEVITSFDESDLYRTWVKVIATRNSRERNNRLENMCWRIWHLARKKKQIAWDDARR  120

Query  538  LAHRRWEREQGRKDVTEDMS  597
            LA RR EREQGR D  +D+S
Sbjct  121  LAKRRLEREQGRNDAADDLS  140



>ref|XP_006397097.1| hypothetical protein EUTSA_v10028384mg [Eutrema salsugineum]
 gb|ESQ38550.1| hypothetical protein EUTSA_v10028384mg [Eutrema salsugineum]
Length=1029

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 92/131 (70%), Gaps = 8/131 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH-------FNPTKYFVEEVVS  384
            MA NEWIN YLEAILD G S  +  ES   ++   G+          F+P KYFVEEVV+
Sbjct  1    MARNEWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKEHQEKVFSPIKYFVEEVVN  60

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +   RL+ RR ERE
Sbjct  61   SFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWDDGIRLSKRRDERE  120

Query  565  QGRKDVTEDMS  597
            QGR D  ED+S
Sbjct  121  QGRNDAEEDLS  131



>gb|KDP33569.1| hypothetical protein JCGZ_07140 [Jatropha curcas]
Length=1055

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 14/128 (11%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHR-----GEQGHFNPTKYFVEEVVSGVD  393
            MAGN+WIN YL+AILD           P + N +      E+G F+PT+YFVEEV++G D
Sbjct  1    MAGNDWINSYLDAILDV---------DPGIDNAKLSLLLRERGRFSPTRYFVEEVITGFD  51

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  A R+T ER++RLENMCWRIW+L RKKKQLE E LQR   R+ ERE+GR
Sbjct  52   ETDLHRSWLRAAAMRSTQERNTRLENMCWRIWNLARKKKQLEGEELQRKNKRQLERERGR  111

Query  574  KDVTEDMS  597
            ++ T DMS
Sbjct  112  REATADMS  119



>ref|XP_006352069.1| PREDICTED: probable sucrose-phosphate synthase 4-like [Solanum 
tuberosum]
Length=1033

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 93/141 (66%), Gaps = 18/141 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGA--------SAIEVESKPAVINHRG----------EQGHFNP  354
            MA NEW+NGYLEAILD G+          + +E       H            ++  F+P
Sbjct  1    MAENEWLNGYLEAILDVGSERNGSRQKKPLSIEESSNNFKHNNMEENLRLEIHKEKLFSP  60

Query  355  TKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQ  534
            TKYFVEEVV+  DE+DLHRTWIKVVATRN+ ER++RLENMCWRIWHLTRKKKQ+  +  Q
Sbjct  61   TKYFVEEVVNSFDESDLHRTWIKVVATRNSRERNNRLENMCWRIWHLTRKKKQIAWDDAQ  120

Query  535  RLAHRRWEREQGRKDVTEDMS  597
            +L  RR E E+GR D  ED+S
Sbjct  121  KLVKRRVELEKGRFDAAEDLS  141



>ref|XP_004250761.1| PREDICTED: probable sucrose-phosphate synthase 4 [Solanum lycopersicum]
Length=1029

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 92/137 (67%), Gaps = 14/137 (10%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGH--------------FNPTKYF  366
            MA NEW+NGYLEAILD G+       K  + ++  +  +              F+PTKYF
Sbjct  1    MAENEWLNGYLEAILDVGSERNGSRQKKPISSNNFKHNNMEEILRLEIHKEKLFSPTKYF  60

Query  367  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  546
            VEEVV+  DE+DLHRTWIKVVATRN  ER++RLENMCWRIWHLTRKKKQ+  +  Q+L  
Sbjct  61   VEEVVNSFDESDLHRTWIKVVATRNCRERNNRLENMCWRIWHLTRKKKQIAWDDAQKLVK  120

Query  547  RRWEREQGRKDVTEDMS  597
            RR E E+GR D  ED+S
Sbjct  121  RRVELEKGRFDAAEDLS  137



>ref|XP_002449293.1| hypothetical protein SORBIDRAFT_05g007310 [Sorghum bicolor]
 gb|EES08281.1| hypothetical protein SORBIDRAFT_05g007310 [Sorghum bicolor]
Length=1071

 Score =   146 bits (368),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 73/144 (51%), Positives = 96/144 (67%), Gaps = 24/144 (17%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGA-----------------SAIEVESKPAVINHRGEQGH-----  345
            AGNEWINGYLEAILD+G+                   +   + P ++   G  GH     
Sbjct  4    AGNEWINGYLEAILDAGSRLRGQRQGYGGGAGAAPPPLTTAALPRLLAEAG--GHQAAAA  61

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            ++PT+YFVEEVVS  D+ DLH+TW KVVATRN+ ERS+RLEN+CWRIWH+ RK KQ+E E
Sbjct  62   YSPTRYFVEEVVSRFDDRDLHKTWTKVVATRNSQERSNRLENLCWRIWHVARKTKQVEWE  121

Query  526  GLQRLAHRRWEREQGRKDVTEDMS  597
              ++LA RR E+EQG ++V E++S
Sbjct  122  YSRQLARRRLEQEQGSREVAEELS  145



>gb|ADG01611.1| sucrose phosphate synthase [Xerophyta humilis]
Length=1062

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILDSG   I+ + +  ++    E+G F+PT YFVEEV+SG DETDL+
Sbjct  1    MAGNDWINSYLEAILDSGR--IDGDKQSLLLR---ERGRFSPTAYFVEEVISGFDETDLY  55

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            ++W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  Q  A RR ERE+ R++   
Sbjct  56   KSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQHSAKRRLEREKARREAAA  115

Query  589  DMS  597
            DMS
Sbjct  116  DMS  118



>ref|XP_009128722.1| PREDICTED: probable sucrose-phosphate synthase 4 [Brassica rapa]
Length=1029

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 8/131 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH-------FNPTKYFVEEVVS  384
            MA NEWIN YLEAILD G S  +  ES   ++   G+          F+P KYFVEEVV+
Sbjct  1    MARNEWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKEPQEKVFSPIKYFVEEVVN  60

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +   RL+ RR ERE
Sbjct  61   SFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWDDGIRLSKRRDERE  120

Query  565  QGRKDVTEDMS  597
            +GR D  ED+S
Sbjct  121  KGRNDAEEDLS  131



>gb|KFK25382.1| hypothetical protein AALP_AA8G106300 [Arabis alpina]
Length=1060

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 98/128 (77%), Gaps = 8/128 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            MAGN+W+N YL+AIL   A+   + ++P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MAGNDWVNSYLDAIL---AAEPGLAAEPRIGNPKSSLLLRERGHFSPTRYFVEEVITGFD  57

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E + ++R+A R  ERE+ R
Sbjct  58   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNVKRVAKRNLEREKAR  117

Query  574  KDVTEDMS  597
            K+++ DMS
Sbjct  118  KEMSVDMS  125



>emb|CDY41124.1| BnaA02g23460D [Brassica napus]
Length=1047

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 8/131 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH-------FNPTKYFVEEVVS  384
            MA NEWIN YLEAILD G S  +  ES   ++   G+          F+P KYFVEEVV+
Sbjct  1    MARNEWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKEPQEKVFSPIKYFVEEVVN  60

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +   RL+ RR ERE
Sbjct  61   SFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWDDGIRLSKRRDERE  120

Query  565  QGRKDVTEDMS  597
            +GR D  ED+S
Sbjct  121  KGRNDAEEDLS  131



>ref|XP_010456485.1| PREDICTED: probable sucrose-phosphate synthase 2 [Camelina sativa]
Length=953

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 14/128 (11%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            M GN+W+N YLEAIL          ++P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MVGNDWVNSYLEAIL---------AAEPGIGNSKSSLLLRERGHFSPTRYFVEEVITGFD  51

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+ R
Sbjct  52   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKRAAKRQLEREKAR  111

Query  574  KDVTEDMS  597
            ++VT DMS
Sbjct  112  REVTADMS  119



>ref|XP_007148633.1| hypothetical protein PHAVU_005G002600g [Phaseolus vulgaris]
 gb|ESW20627.1| hypothetical protein PHAVU_005G002600g [Phaseolus vulgaris]
Length=1030

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 93/137 (68%), Gaps = 20/137 (15%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGASA--------------IEVESKPAVINHRGEQGHFNPT-KYF  366
            A NEW+NGYLEAILD G+S                E E+K    + R E+  FNPT KYF
Sbjct  3    AVNEWLNGYLEAILDVGSSVRKKKKNDGKVKIAKFEEENK----DERVEK-LFNPTTKYF  57

Query  367  VEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAH  546
            VEEVV+  DE DL+RTW+KV ATRN  ERS+RLENMCWRIWHLTRKKKQ+  +  QRLA 
Sbjct  58   VEEVVNSFDEHDLYRTWVKVTATRNIRERSNRLENMCWRIWHLTRKKKQIACDDAQRLAR  117

Query  547  RRWEREQGRKDVTEDMS  597
            RR +RE+GR D   D+S
Sbjct  118  RRLDREEGRNDAANDLS  134



>ref|XP_010419666.1| PREDICTED: probable sucrose-phosphate synthase 2 [Camelina sativa]
Length=1039

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 14/128 (11%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            M GN+W+N YLEAIL          ++P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MVGNDWVNSYLEAIL---------AAEPGIGNSKSSLLLRERGHFSPTRYFVEEVITGFD  51

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+ R
Sbjct  52   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKRAAKRQLEREKAR  111

Query  574  KDVTEDMS  597
            ++VT DMS
Sbjct  112  REVTADMS  119



>ref|XP_010491806.1| PREDICTED: probable sucrose-phosphate synthase 2 [Camelina sativa]
Length=1039

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 14/128 (11%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            M GN+W+N YLEAIL          ++P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MVGNDWVNSYLEAIL---------AAEPGIGNSKSSLLLRERGHFSPTRYFVEEVITGFD  51

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+ R
Sbjct  52   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKRAAKRQLEREKAR  111

Query  574  KDVTEDMS  597
            ++VT DMS
Sbjct  112  REVTADMS  119



>ref|XP_004971065.1| PREDICTED: probable sucrose-phosphate synthase 1-like [Setaria 
italica]
Length=169

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 77/123 (63%), Gaps = 25/123 (20%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEV-------------------------ESKPAVINHRG  333
            MAGNEWINGYLEAILDS  +A                             S     + RG
Sbjct  1    MAGNEWINGYLEAILDSRTAAGGSGGGGGGGGGVGVGGGGGDPKSLAAGASPTGATSPRG  60

Query  334  EQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  513
               +FNPT YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RLENMCWRIWHL RKKKQ
Sbjct  61   PHMNFNPTHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRLENMCWRIWHLARKKKQ  120

Query  514  LEL  522
            + +
Sbjct  121  VRI  123



>gb|AJG44460.1| sucrose phosphate synthase, partial [Lilium davidii var. unicolor]
Length=197

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 5/128 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            MAGN+WIN YLEAILDSG   I     P     +      E+G F+PT+YFVEEV++G D
Sbjct  1    MAGNDWINSYLEAILDSGGPGIADAGGPGNAASKKSLLLRERGRFSPTRYFVEEVITGFD  60

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDL+++W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E   R + RR ERE+GR
Sbjct  61   ETDLYKSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEALRQSKRRLERERGR  120

Query  574  KDVTEDMS  597
            +D T DMS
Sbjct  121  RDATADMS  128



>ref|XP_002871456.1| ATSPS2F [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47715.1| ATSPS2F [Arabidopsis lyrata subsp. lyrata]
Length=1044

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 6/128 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            M GN+W+N YLEAIL +    I     P + N +      E+GHF+PT+YFVEEV++G D
Sbjct  1    MVGNDWVNSYLEAIL-AAEPGIGNSKSPGIGNSKSSLLLRERGHFSPTRYFVEEVITGFD  59

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+ R
Sbjct  60   ETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKREAKRQREREKAR  119

Query  574  KDVTEDMS  597
            ++VT +MS
Sbjct  120  REVTAEMS  127



>dbj|BAA19241.1| Sucrose-Phosphate Synthase [Saccharum officinarum]
Length=1047

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  286  SAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRL  465
            S +   S     + RG   +FNP+ YFVEEVV GVDE+DLHRTWIKVVATRN  ERS+RL
Sbjct  8    SPVAGASPTKAASPRGPHMNFNPSHYFVEEVVKGVDESDLHRTWIKVVATRNARERSTRL  67

Query  466  ENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTEDM  594
            ENMCWRIWHL RKKKQLELEG+QR++ RR E+EQ  ++ TED+
Sbjct  68   ENMCWRIWHLARKKKQLELEGIQRISARRKEQEQVPREPTEDL  110



>gb|AFW61932.1| putative sucrose-phosphate synthase family protein [Zea mays]
Length=217

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 94/141 (67%), Gaps = 18/141 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG---------------EQGHFNPTKY  363
            MAGN+WIN YLEAILD+G +A ++ +     + R                E+G F+P +Y
Sbjct  1    MAGNDWINSYLEAILDAGGAAGDLSAAAGSGDGRDGTAVEKRDKSSLMLRERGRFSPARY  60

Query  364  FVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLA  543
            FVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   RL+
Sbjct  61   FVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRLS  120

Query  544  HRRWEREQGRK---DVTEDMS  597
             +R E E+ R+   D++ED+S
Sbjct  121  KQRMEFEKARQYAADLSEDLS  141



>gb|AAP94624.1| sucrose phosphate synthase [Viscum album subsp. album]
Length=1019

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAILD+     + +S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNCYLEAILDADPGIGDAKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L R KKQLE +  +R A    +RE+GR +   
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARTKKQLEGDAARRKAKHHLDRERGRXEAAA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_008678023.1| PREDICTED: probable sucrose-phosphate synthase 5 [Zea mays]
 gb|AFW60527.1| putative sucrose-phosphate synthase family protein [Zea mays]
Length=1051

 Score =   141 bits (355),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 69/136 (51%), Positives = 93/136 (68%), Gaps = 14/136 (10%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSG------------ASAIEVESKPAVINHRGEQGH--FNPTKYFV  369
            AGNEWINGYLEAILD+G            A+++       +    G+QG   ++PT+YFV
Sbjct  3    AGNEWINGYLEAILDAGTRLRGPWQQQGGAASLTAALPRLLAEAGGQQGAAAYSPTRYFV  62

Query  370  EEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHR  549
            EEVVS  D+ DLH+TW KVVA RN+ ERS+RL N+CWRIWH+ RKKKQ++ E  ++LA R
Sbjct  63   EEVVSRFDDRDLHKTWTKVVAMRNSQERSNRLVNLCWRIWHVARKKKQVQREYARQLAQR  122

Query  550  RWEREQGRKDVTEDMS  597
            R E+E G ++  E++S
Sbjct  123  RLEQELGSREAAEELS  138



>ref|XP_006286964.1| hypothetical protein CARUB_v10000113mg [Capsella rubella]
 gb|EOA19862.1| hypothetical protein CARUB_v10000113mg [Capsella rubella]
Length=1049

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 96/130 (74%), Gaps = 8/130 (6%)
 Frame = +1

Query  229  MAGNEWINGYLEAIL--DSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSG  387
            M GN+W+N YLEAIL  + G S  +  S+P   + +      E+GHF+PT+YFVEEV++G
Sbjct  1    MVGNDWVNSYLEAILAAEPGISNSK-SSQPGTGDSKSSLLLRERGHFSPTRYFVEEVITG  59

Query  388  VDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQ  567
             DETDLHR+W++  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R+ ERE+
Sbjct  60   FDETDLHRSWVQAAATRSPQERNTRLENLCWRIWNLARQKKQVEGKNAKRAAKRQLEREK  119

Query  568  GRKDVTEDMS  597
             R++VT +MS
Sbjct  120  ARREVTAEMS  129



>ref|XP_008441196.1| PREDICTED: probable sucrose-phosphate synthase 4 [Cucumis melo]
 ref|XP_008441197.1| PREDICTED: probable sucrose-phosphate synthase 4 [Cucumis melo]
Length=1028

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGAS----AIEVESKPAVINHRGEQGH-FNPTKYFVEEVVSGVDE  396
             GNEW++GYLEAILD G++      E +++ A    + ++G  F PTKYFVEEVV   DE
Sbjct  3    GGNEWLHGYLEAILDVGSNNRSKKQEGKNRIARFEDKQKKGKLFCPTKYFVEEVVYSFDE  62

Query  397  TDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRK  576
            +DL++TW KV+ATRN+ +R++RLENMCWRIWHL RKKK++     Q+L +RR EREQGR 
Sbjct  63   SDLYKTWTKVIATRNSRDRNNRLENMCWRIWHLARKKKRIAWNDEQKLTNRRLEREQGRS  122

Query  577  DVTEDMS  597
            D ++D+S
Sbjct  123  DASDDLS  129



>ref|XP_006399612.1| hypothetical protein EUTSA_v10012643mg [Eutrema salsugineum]
 gb|ESQ41065.1| hypothetical protein EUTSA_v10012643mg [Eutrema salsugineum]
Length=881

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+P++YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPSRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KK++E +  +R A R+ ER++ RK+VT 
Sbjct  57   RSWVQAAATRSPQERNTRLENLCWRIWNLARQKKKVEGKNAKRAAKRQLERDKARKEVTA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_010110858.1| hypothetical protein L484_005397 [Morus notabilis]
 gb|EXC28554.1| hypothetical protein L484_005397 [Morus notabilis]
Length=148

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 75/95 (79%), Gaps = 4/95 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    +V+S   +     E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDVKSSLLL----RERGHFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQ  513
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQ
Sbjct  57   RSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQ  91



>ref|XP_010455412.1| PREDICTED: probable sucrose-phosphate synthase 4 [Camelina sativa]
Length=1049

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 91/143 (64%), Gaps = 21/143 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKDHQDKVFGDMNTKDHQEKV  60

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  526  GLQRLAHRRWEREQGRKDVTEDM  594
               RL+ RR EREQGR D  ED+
Sbjct  121  DGIRLSKRRIEREQGRNDAEEDL  143



>dbj|BAD43701.1| sucrose-phosphate synthase - like protein [Arabidopsis thaliana]
Length=1050

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 92/143 (64%), Gaps = 21/143 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGE--------------------QGH  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                    +  
Sbjct  1    MARNDWINSYLEAILDVGTSKKKRFESNSKIVQKLGDINSKDHQEKVFGDMNGKDHQEKV  60

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  526  GLQRLAHRRWEREQGRKDVTEDM  594
               RL+ RR EREQGR D  ED+
Sbjct  121  DGVRLSKRRIEREQGRNDAEEDL  143



>ref|NP_192750.2| probable sucrose-phosphate synthase 4 [Arabidopsis thaliana]
 ref|NP_001031609.1| probable sucrose-phosphate synthase 4 [Arabidopsis thaliana]
 sp|F4JLK2.1|SPSA4_ARATH RecName: Full=Probable sucrose-phosphate synthase 4; AltName: 
Full=Sucrose phosphate synthase 4F; Short=AtSPS4F; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase [Arabidopsis 
thaliana]
 gb|AEE82844.1| probable sucrose-phosphate synthase 4 [Arabidopsis thaliana]
 gb|AEE82845.1| probable sucrose-phosphate synthase 4 [Arabidopsis thaliana]
 gb|AHL38703.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=1050

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 92/143 (64%), Gaps = 21/143 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGE--------------------QGH  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                    +  
Sbjct  1    MARNDWINSYLEAILDVGTSKKKRFESNSKIVQKLGDINSKDHQEKVFGDMNGKDHQEKV  60

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  526  GLQRLAHRRWEREQGRKDVTEDM  594
               RL+ RR EREQGR D  ED+
Sbjct  121  DGVRLSKRRIEREQGRNDAEEDL  143



>ref|XP_010555013.1| PREDICTED: probable sucrose-phosphate synthase 2 [Tarenaya hassleriana]
Length=1044

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+WI+  ATR+  ER++RLEN+CWRIW+L R+KKQ+E +  +R A R  ERE+ R++ T 
Sbjct  57   RSWIQAAATRSPQERNTRLENLCWRIWNLARQKKQIEGKYAKRAAKRHLERERARREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_010437512.1| PREDICTED: probable sucrose-phosphate synthase 4 [Camelina sativa]
Length=1050

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 91/143 (64%), Gaps = 21/143 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKDHQDKVFGDMNTKDHQEKV  60

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  526  GLQRLAHRRWEREQGRKDVTEDM  594
               RL+ RR EREQGR D  ED+
Sbjct  121  DGIRLSKRRIEREQGRNDAEEDL  143



>ref|XP_006286963.1| hypothetical protein CARUB_v10000112mg [Capsella rubella]
 gb|EOA19861.1| hypothetical protein CARUB_v10000112mg [Capsella rubella]
Length=1049

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 91/143 (64%), Gaps = 21/143 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKDHQDKVFGDMNRKDHQEKV  60

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  526  GLQRLAHRRWEREQGRKDVTEDM  594
               RL+ RR EREQGR D  ED+
Sbjct  121  DGIRLSKRRIEREQGRNDAEEDL  143



>emb|CAB39764.1| sucrose-phosphate synthase-like protein [Arabidopsis thaliana]
 emb|CAB78135.1| sucrose-phosphate synthase-like protein [Arabidopsis thaliana]
Length=1083

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 92/143 (64%), Gaps = 21/143 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGE--------------------QGH  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                    +  
Sbjct  1    MARNDWINSYLEAILDVGTSKKKRFESNSKIVQKLGDINSKDHQEKVFGDMNGKDHQEKV  60

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  526  GLQRLAHRRWEREQGRKDVTEDM  594
               RL+ RR EREQGR D  ED+
Sbjct  121  DGVRLSKRRIEREQGRNDAEEDL  143



>dbj|BAD94390.1| sucrose-phosphate synthase - like protein [Arabidopsis thaliana]
 dbj|BAD94960.1| sucrose-phosphate synthase - like protein [Arabidopsis thaliana]
 dbj|BAF01835.1| sucrose-phosphate synthase - like protein [Arabidopsis thaliana]
Length=1050

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 92/143 (64%), Gaps = 21/143 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGE--------------------QGH  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                    +  
Sbjct  1    MARNDWINSYLEAILDVGTSKKKRFESNSKIVQKLGDINSKDHQEKVFGDMNGKDHQEKV  60

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  526  GLQRLAHRRWEREQGRKDVTEDM  594
               RL+ RR EREQGR D  ED+
Sbjct  121  DGVRLSKRRIEREQGRNDAEEDL  143



>ref|XP_009607707.1| PREDICTED: probable sucrose-phosphate synthase 4 [Nicotiana tomentosiformis]
Length=1045

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 93/153 (61%), Gaps = 30/153 (20%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGA--SAIEVESKPAVINHRGE----------------------  336
            MA NEW+NGYLEAILD+G   +  + E K A I  R                        
Sbjct  1    MAENEWLNGYLEAILDAGTDRNGTQKERKAASIEDRNNLKNTSVRDNNKIEETLRFEKFE  60

Query  337  ------QGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLT  498
                  +  F+PT YFVEEVV+  DE+DLH+TWIKVVATRN+ ER++RLENMCWRIWHL 
Sbjct  61   IQKEKAEKLFSPTTYFVEEVVNSFDESDLHKTWIKVVATRNSRERNNRLENMCWRIWHLA  120

Query  499  RKKKQLELEGLQRLAHRRWEREQGRKDVTEDMS  597
            RKKKQ+  +  Q+L  RR E E+GR D  ED+S
Sbjct  121  RKKKQIAWDDAQKLVIRRLELEKGRFDALEDLS  153



>ref|XP_002872492.1| ATSPS4F [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48751.1| ATSPS4F [Arabidopsis lyrata subsp. lyrata]
Length=1051

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 91/144 (63%), Gaps = 22/144 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNSKDHQDKVFGDMNSKDHHQEK  60

Query  346  -FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLEL  522
             F+P KYFVEEVV+  DE+DL++TWIKV+ATRNT ERS+RLEN+CWRIWHL RKKKQ+  
Sbjct  61   VFSPIKYFVEEVVNSFDESDLYKTWIKVIATRNTRERSNRLENICWRIWHLARKKKQIVW  120

Query  523  EGLQRLAHRRWEREQGRKDVTEDM  594
            +   RL+ RR EREQGR D  ED+
Sbjct  121  DDGIRLSKRRIEREQGRNDAEEDL  144



>gb|EYU22701.1| hypothetical protein MIMGU_mgv1a000604mg [Erythranthe guttata]
Length=1047

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 91/150 (61%), Gaps = 27/150 (18%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKP---------------------------AVINH  327
            M  NEW+NGYLEAILD+G +  + ++K                             V   
Sbjct  1    MGQNEWLNGYLEAILDAGKARDKADNKTLKNSIRKKLDGDEDDIVDGKLKFQTMEIVSKD  60

Query  328  RGEQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKK  507
            + +   F+PTKYFVEEVV+G DE DLHRTWIKV+ATRN   R++RLENMCWRIWHL RKK
Sbjct  61   KQDVKIFSPTKYFVEEVVNGFDEADLHRTWIKVIATRNYRLRNNRLENMCWRIWHLARKK  120

Query  508  KQLELEGLQRLAHRRWEREQGRKDVTEDMS  597
            KQ+ L+  Q+L   + EREQGR    ED+S
Sbjct  121  KQIALDAAQKLVKWKIEREQGRSIAAEDLS  150



>ref|XP_010241591.1| PREDICTED: probable sucrose-phosphate synthase 1 [Nelumbo nucifera]
Length=1063

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    E +S   ++    E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSSSLLLR---ERGRFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR   ER++RLENMCWRIW+L RKKKQ+E E  QR+A  R ERE+GR++ T 
Sbjct  58   RSWVRAAATRGPKERNTRLENMCWRIWNLARKKKQIEGEEAQRMAKHRLERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>gb|EMS59564.1| hypothetical protein TRIUR3_20316 [Triticum urartu]
Length=217

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (69%), Gaps = 8/128 (6%)
 Frame = +1

Query  235  GNEWINGYLEAILDSGA-------SAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVD  393
            GNEWINGYLEAILD+G+       S   +E  PA+ +       +NPT+YFVEEVV   D
Sbjct  4    GNEWINGYLEAILDAGSKLRVQGVSLPPLEPAPALASEES-SAAYNPTRYFVEEVVRSFD  62

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            +  LH+TW KVVA RN+ ER++RLEN+CWRIW++ R+KKQ+E +  Q +A R+ E+E G 
Sbjct  63   DQALHKTWTKVVAMRNSQERNNRLENLCWRIWNVARQKKQVERDYSQEVARRKLEQELGS  122

Query  574  KDVTEDMS  597
             +  ED++
Sbjct  123  LEAAEDLA  130



>ref|XP_009358563.1| PREDICTED: probable sucrose-phosphate synthase 1 [Pyrus x bretschneideri]
Length=1055

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRLERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>ref|XP_008336979.1| PREDICTED: probable sucrose-phosphate synthase 1 [Malus domestica]
Length=1055

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRLERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>dbj|BAJ90127.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1056

 Score =   139 bits (349),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 8/128 (6%)
 Frame = +1

Query  235  GNEWINGYLEAILDSGA-------SAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVD  393
            GNEWINGYLEAILD+G+       S   +E  PA+ +       +NPT+YFVEEVV   D
Sbjct  4    GNEWINGYLEAILDAGSKLRVQGVSLPPLEPAPALASEE-SSATYNPTRYFVEEVVRSFD  62

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            +  LH+TW KVVA RN+ ERS+RLEN+CWRIW++ R+KKQ+E +  Q +A R+ E+E G 
Sbjct  63   DQALHKTWTKVVAMRNSQERSNRLENLCWRIWNVARQKKQVERDYSQEVARRKLEQELGS  122

Query  574  KDVTEDMS  597
            ++  ED+S
Sbjct  123  REAAEDLS  130



>gb|AAN11294.1| sucrose phosphate synthase [Oncidium hybrid cultivar]
Length=1061

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 98/123 (80%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD+G S   +++  + +  R E+G F+PTKYFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGPS---IDASKSSLLLR-ERGRFSPTKYFVEEVITGFDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            ++W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QRL+ RR ERE+GR+D T 
Sbjct  57   KSWLRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRLSKRRLERERGRRDATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|AEG78833.1| sucrose phosphate synthase [Dendrobium catenatum]
Length=1061

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD+G  AI+      ++    E+G F+PTKYFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGP-AIDASKSSLLLR---ERGRFSPTKYFVEEVITGFDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            ++W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QRL+ RR ERE+GR+D T 
Sbjct  57   KSWLRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRLSKRRLERERGRRDATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_011093228.1| PREDICTED: probable sucrose-phosphate synthase 1 [Sesamum indicum]
Length=1044

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD   + I+ +    ++    E+G F+P +YFVEEV++G +ETDLH
Sbjct  1    MAGNDWINSYLEAILDVD-TGIDDQKSSLLLR---ERGRFSPAQYFVEEVITGFNETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  + RN+ ER++RLENMCWRIW L R+KKQ+E E  QR A R  ERE+ R++ T 
Sbjct  57   RSWVRASSIRNSEERNTRLENMCWRIWTLARRKKQIEGEEAQRRAKRHLEREKARREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|ABA64520.1| sucrose-phosphate synthase isoform C [Nicotiana tabacum]
Length=1045

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 93/153 (61%), Gaps = 30/153 (20%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGA--SAIEVESKPAVINHRGE----------------------  336
            MA NEW+NGYLEAILD+G   +  + E K + I  R                        
Sbjct  1    MAENEWLNGYLEAILDAGTDRNGTQKERKASSIEDRNNLKNTSVRDNNKIEETLRFEKFE  60

Query  337  ------QGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLT  498
                  +  F+PT YFVEEVV+  DE+DLH+TWIKVVATRN+ ER++RLENMCWRIWHL 
Sbjct  61   IQKEKAEKLFSPTTYFVEEVVNSFDESDLHKTWIKVVATRNSRERNNRLENMCWRIWHLA  120

Query  499  RKKKQLELEGLQRLAHRRWEREQGRKDVTEDMS  597
            RKKKQ+  +  Q+L  RR E E+GR D  ED+S
Sbjct  121  RKKKQIAWDDAQKLVIRRLELEKGRFDALEDLS  153



>gb|EYU32355.1| hypothetical protein MIMGU_mgv1a000596mg [Erythranthe guttata]
Length=1050

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILD--SGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETD  402
            MAGN+WIN YLEAILD  +G       +  +      E+G F+P +YFVEEV++G +ETD
Sbjct  1    MAGNDWINSYLEAILDVDTGGINDNNNNNKSSSLLLRERGRFSPAQYFVEEVITGFNETD  60

Query  403  LHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDV  582
            LHR+W++  + RN+ ER++RLENMCWRIW L RKKKQ+E+E  QR   RR ERE   ++ 
Sbjct  61   LHRSWVRASSIRNSEERNTRLENMCWRIWTLARKKKQIEVEESQRRTKRRLERENAHREA  120

Query  583  TEDMS  597
            T DMS
Sbjct  121  TADMS  125



>ref|XP_009340653.1| PREDICTED: probable sucrose-phosphate synthase 1 [Pyrus x bretschneideri]
 ref|XP_009340654.1| PREDICTED: probable sucrose-phosphate synthase 1 [Pyrus x bretschneideri]
Length=1055

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWTLARQKKQLEGEEAQRMAKRRLERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>ref|XP_004138659.1| PREDICTED: probable sucrose-phosphate synthase 4-like [Cucumis 
sativus]
 gb|KGN63084.1| hypothetical protein Csa_2G401440 [Cucumis sativus]
Length=1029

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 91/131 (69%), Gaps = 12/131 (9%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGASAIEVESKPAVINHR--------GEQGH-FNPTKYFVEEVVS  384
             GNEW++GYLEAILD G++     SK     HR         ++G  F PTKYFVEEVV 
Sbjct  3    GGNEWLHGYLEAILDVGSNN---RSKKQGGKHRIARFDQDKQKKGKLFCPTKYFVEEVVY  59

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              DE+DL++TW KV+ATRNT +R++RLENMCWRIWHL RKKK++     Q+L  RR ERE
Sbjct  60   SFDESDLYKTWTKVIATRNTRDRNNRLENMCWRIWHLARKKKRIAWNDEQKLTTRRLERE  119

Query  565  QGRKDVTEDMS  597
            QGR D ++D+S
Sbjct  120  QGRSDASDDLS  130



>gb|AEN84000.1| sucrose-phosphate synthase [Cucumis sativus]
Length=1029

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 91/131 (69%), Gaps = 12/131 (9%)
 Frame = +1

Query  232  AGNEWINGYLEAILDSGASAIEVESKPAVINHR--------GEQGH-FNPTKYFVEEVVS  384
             GNEW++GYLEAILD G++     SK     HR         ++G  F PTKYFVEEVV 
Sbjct  3    GGNEWLHGYLEAILDVGSNN---RSKKQGGKHRIARFDQDKQKKGKLFCPTKYFVEEVVY  59

Query  385  GVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWERE  564
              DE+DL++TW KV+ATRNT +R++RLENMCWRIWHL RKKK++     Q+L  RR ERE
Sbjct  60   SFDESDLYKTWTKVIATRNTRDRNNRLENMCWRIWHLARKKKRIAWNDEQKLTTRRLERE  119

Query  565  QGRKDVTEDMS  597
            QGR D ++D+S
Sbjct  120  QGRSDASDDLS  130



>ref|XP_004290259.1| PREDICTED: probable sucrose-phosphate synthase 4 [Fragaria vesca 
subsp. vesca]
Length=1026

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 6/129 (5%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASA-----IEVESKPAVINHR-GEQGHFNPTKYFVEEVVSGV  390
            MAGN+W+NGYLEAILD+G+ +      + + K A    +  E+  F+PTKYFVEEVV+  
Sbjct  1    MAGNDWLNGYLEAILDAGSKSNTKKGSDGKQKIAKFEQQVKEEKLFSPTKYFVEEVVNSF  60

Query  391  DETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQG  570
            DE+DLHRTW+KV+ATRNT ERS+RLENMCWRIWHL RKKKQ+  +  +RLA RR ERE+G
Sbjct  61   DESDLHRTWVKVIATRNTRERSNRLENMCWRIWHLARKKKQIAWDDARRLARRRLEREKG  120

Query  571  RKDVTEDMS  597
            R D  ED+S
Sbjct  121  RHDAAEDLS  129



>emb|CDX78411.1| BnaA03g03230D [Brassica napus]
Length=1039

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+P++YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPSRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KK++E +  +R A R   RE+ RK+VT 
Sbjct  57   RSWVQAAATRSPQERNTRLENLCWRIWNLARQKKKVEGKNAKRAAKRHLLREKARKEVTA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_009131196.1| PREDICTED: probable sucrose-phosphate synthase 2 [Brassica rapa]
Length=1039

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+P++YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPSRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KK++E +  +R A R   RE+ RK+VT 
Sbjct  57   RSWVQAAATRSPQERNTRLENLCWRIWNLARQKKKVEGKNAKRAAKRHLLREKARKEVTA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_010099850.1| putative sucrose-phosphate synthase 1 [Morus notabilis]
 gb|EXB80727.1| putative sucrose-phosphate synthase 1 [Morus notabilis]
Length=1072

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 96/123 (78%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAILD G +  + +S   +     E+GHF+PT+YFVEEV++G DETDL+
Sbjct  1    MAGNDWVNSYLEAILDVGPNLDDAKSSLLL----RERGHFSPTRYFVEEVITGYDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L RKKKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQLEGEEAQRMAKRRLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>dbj|BAJ88991.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=629

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 8/128 (6%)
 Frame = +1

Query  235  GNEWINGYLEAILDSGA-------SAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVD  393
            GNEWINGYLEAILD+G+       S   +E  PA+ +       +NPT+YFVEEVV   D
Sbjct  4    GNEWINGYLEAILDAGSKLRVQGVSLPPLEPAPALASEES-SATYNPTRYFVEEVVRSFD  62

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            +  LH+TW KVVA RN+ ERS+RLEN+CWRIW++ R+KKQ+E +  Q +A R+ E+E G 
Sbjct  63   DQALHKTWTKVVAMRNSQERSNRLENLCWRIWNVARQKKQVERDYSQEVARRKLEQELGS  122

Query  574  KDVTEDMS  597
            ++  ED+S
Sbjct  123  REAAEDLS  130



>gb|KDO73470.1| hypothetical protein CISIN_1g001541mg [Citrus sinensis]
Length=1057

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>sp|O22060.1|SPSA1_CITUN RecName: Full=Probable sucrose-phosphate synthase 1; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase 1 [Citrus 
unshiu]
 dbj|BAA23213.1| sucrose-phosphate synthase [Citrus unshiu]
Length=1057

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_006453095.1| hypothetical protein CICLE_v10007311mg [Citrus clementina]
 ref|XP_006474408.1| PREDICTED: probable sucrose-phosphate synthase 1-like [Citrus 
sinensis]
 gb|ESR66335.1| hypothetical protein CICLE_v10007311mg [Citrus clementina]
Length=1057

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_010421935.1| PREDICTED: probable sucrose-phosphate synthase 4 [Camelina sativa]
Length=1050

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 90/143 (63%), Gaps = 21/143 (15%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIE-VESKPAVINHRGEQGH--------------------  345
            MA N+WIN YLEAILD G S  +  ES   ++   G+                       
Sbjct  1    MARNDWINSYLEAILDVGTSNKKRFESNSKIVQKLGDMNRKDHQDKVFGDMNTKDHQEKV  60

Query  346  FNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELE  525
            F+P KYFVEEVV+  DE+DL++TWIK +ATRNT ERS+RLEN+CWRIWHL RKKKQ+  +
Sbjct  61   FSPIKYFVEEVVNSFDESDLYKTWIKGIATRNTRERSNRLENICWRIWHLARKKKQIVWD  120

Query  526  GLQRLAHRRWEREQGRKDVTEDM  594
               RL+ RR EREQGR D  ED+
Sbjct  121  DGIRLSKRRIEREQGRNDAEEDL  143



>ref|XP_010250237.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X2 [Nelumbo 
nucifera]
Length=980

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    E +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRMAKRRLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_010250236.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X1 [Nelumbo 
nucifera]
Length=1061

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    E +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L RKKKQ+E E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWVRAAATRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRMAKRRLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_008385228.1| PREDICTED: probable sucrose-phosphate synthase 1 [Malus domestica]
 ref|XP_008354361.1| PREDICTED: probable sucrose-phosphate synthase 1 [Malus domestica]
Length=1055

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR A RR ERE+GR++ T 
Sbjct  58   RSWVRASATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRXAKRRLERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>ref|XP_008242829.1| PREDICTED: probable sucrose-phosphate synthase 1 [Prunus mume]
Length=1057

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MA N+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MASNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRVERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>gb|ABV32551.1| sucrose phosphate synthase protein 1 [Prunus persica]
Length=1057

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MA N+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MASNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRIERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>gb|EPS69735.1| hypothetical protein M569_05029 [Genlisea aurea]
Length=1050

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 4/122 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            M GN+WINGYLEAILD      E +S   +     E+G F+P +YFVEEV++G +ETDLH
Sbjct  1    MTGNDWINGYLEAILDVDVGINEKDSSLLL----RERGRFSPAQYFVEEVITGFNETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W +  A RN+ ER+ RLENMCWRIW L RKKKQ+E+E +QR A +  +RE  R++ T 
Sbjct  57   RSWARAAAIRNSEERNMRLENMCWRIWTLARKKKQIEIEEMQRKAKKTLDRETARREATA  116

Query  589  DM  594
            +M
Sbjct  117  EM  118



>ref|XP_007204296.1| hypothetical protein PRUPE_ppa000639mg [Prunus persica]
 gb|AFI57907.1| sucrose phosphate synthase 1f [Prunus persica]
 gb|EMJ05495.1| hypothetical protein PRUPE_ppa000639mg [Prunus persica]
Length=1057

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MA N+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MASNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  58   RSWVRAAATRSPQERNTRLENLCWRIWNLARQKKQLEGEEAQRMAKRRIERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>ref|XP_010111723.1| hypothetical protein L484_006594 [Morus notabilis]
 gb|EXC31562.1| hypothetical protein L484_006594 [Morus notabilis]
Length=113

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 4/96 (4%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLE ILD G    +V+S   +     E+GHF+PT YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLETILDVGPGLDDVKSSLLL----RERGHFSPTCYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQL  516
            R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQ+
Sbjct  57   RSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQV  92



>gb|AAQ14552.1|AF310160_1 sucrose-phosphate synthase [Triticum aestivum]
Length=1055

 Score =   136 bits (342),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 65/128 (51%), Positives = 88/128 (69%), Gaps = 8/128 (6%)
 Frame = +1

Query  235  GNEWINGYLEAILDSGA-------SAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVD  393
            GNEWINGYLEAILD+G+       S   +E  PA+ +       +NPT+YFVEEVV   D
Sbjct  4    GNEWINGYLEAILDAGSKLRVQGVSLPPLEPAPALASEESSAA-YNPTRYFVEEVVRSFD  62

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            +  LH+TW KVVA RN+ ER++RLEN+CWRIW++ R+KKQ+E +  Q +A R+ E+E G 
Sbjct  63   DQALHKTWTKVVAMRNSQERNNRLENLCWRIWNVARQKKQVERDYSQEVARRKQEQELGS  122

Query  574  KDVTEDMS  597
             +  ED+S
Sbjct  123  LEAAEDLS  130



>gb|EMT02687.1| Sucrose-phosphate synthase 1 [Aegilops tauschii]
Length=1069

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 89/136 (65%), Gaps = 13/136 (10%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-------------EQGHFNPTKYFV  369
            M GN+WIN YLEAILD+G +A E+ +  A                   E+G FNP +YFV
Sbjct  1    MVGNDWINSYLEAILDAGGAAGEISAASAAPGGSAAEKRRDKSSLMLRERGRFNPARYFV  60

Query  370  EEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHR  549
            EEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   R + +
Sbjct  61   EEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRSSKK  120

Query  550  RWEREQGRKDVTEDMS  597
            R ERE+ R+D   D+S
Sbjct  121  RLEREKARRDAAADLS  136



>gb|AAG01888.1| sucrose phosphate synthase [Ipomoea batatas]
Length=226

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGRGIDDAKSSLLLR----ERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+ ++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QRLA RR ERE+GR++   
Sbjct  57   RSRVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQRLAKRRQERERGRREAVA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_006659287.1| PREDICTED: probable sucrose-phosphate synthase 4-like [Oryza 
brachyantha]
Length=1070

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 18/141 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG------------------EQGHFNP  354
            MAGN+WIN YLEAILD+G +A E+ +        G                  E+G F+P
Sbjct  1    MAGNDWINSYLEAILDAGGAAQEISAAAGAGAGAGGDGAAAAEKRDKSSLMLRERGRFSP  60

Query  355  TKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQ  534
             +YFVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   
Sbjct  61   ARYFVEEVISGFDETDLYKTWVRTAAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEAS  120

Query  535  RLAHRRWEREQGRKDVTEDMS  597
            RLA +R ERE+ R+    DMS
Sbjct  121  RLAKQRLEREKARRYAAADMS  141



>ref|XP_009363963.1| PREDICTED: probable sucrose-phosphate synthase 1 [Pyrus x bretschneideri]
Length=1055

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G   ++ ++K +++    E+GHF+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLVD-DAKSSLLLR--ERGHFSPTRYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KKQLE E  QR A RR ERE+GR++ T 
Sbjct  58   RSWVRASATRSPQERNTRLENLCWRIWNLARQKKQLEGEESQRKAKRRLERERGRREATA  117

Query  589  DMS  597
            DMS
Sbjct  118  DMS  120



>ref|NP_001170108.1| putative sucrose-phosphate synthase family protein [Zea mays]
 gb|ACN35849.1| unknown [Zea mays]
Length=615

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 94/141 (67%), Gaps = 18/141 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG---------------EQGHFNPTKY  363
            MAGN+WIN YLEAILD+G +A ++ +     + R                E+G F+P +Y
Sbjct  1    MAGNDWINSYLEAILDAGGAAGDLSAAAGSGDGRDGTAVEKRDKSSLMLRERGRFSPARY  60

Query  364  FVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLA  543
            FVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   RL+
Sbjct  61   FVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRLS  120

Query  544  HRRWEREQGRK---DVTEDMS  597
             +R E E+ R+   D++ED+S
Sbjct  121  KQRMEFEKARQYAADLSEDLS  141



>gb|AFW61934.1| putative sucrose-phosphate synthase family protein [Zea mays]
Length=615

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 94/141 (67%), Gaps = 18/141 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG---------------EQGHFNPTKY  363
            MAGN+WIN YLEAILD+G +A ++ +     + R                E+G F+P +Y
Sbjct  1    MAGNDWINSYLEAILDAGGAAGDLSAAAGSGDGRDGTAVEKRDKSSLMLRERGRFSPARY  60

Query  364  FVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLA  543
            FVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   RL+
Sbjct  61   FVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRLS  120

Query  544  HRRWEREQGRK---DVTEDMS  597
             +R E E+ R+   D++ED+S
Sbjct  121  KQRMEFEKARQYAADLSEDLS  141



>gb|ACI23258.1| sucrose phosphate synthase [Gossypium hirsutum]
Length=113

 Score =   125 bits (313),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = +1

Query  265  AILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNT  444
            +ILD G    + +S   +     E+G+F+PT+YFVEEV++G DETDLHR+W++  ATR  
Sbjct  1    SILDVGPGIDDAKSSLLLR----ERGNFSPTRYFVEEVITGFDETDLHRSWVRAAATRGP  56

Query  445  MERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTEDMS  597
             ER++RLENMCWRIW+L R KK+LE+E  QR A+RR E E+GR++ T DMS
Sbjct  57   KERNTRLENMCWRIWNLARTKKKLEVEEAQRKANRRLEHERGRREATADMS  107



>ref|XP_009786823.1| PREDICTED: probable sucrose-phosphate synthase 4 [Nicotiana sylvestris]
Length=1048

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 91/155 (59%), Gaps = 32/155 (21%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGAS----------AIEVESKPAV--------------------  318
            MA NEW+NGYLEAILD+G            A  +E K +                     
Sbjct  1    MAENEWLNGYLEAILDAGTDRNGSTKKERRAASIEDKSSFKNTSVRNNNNKIEETLRFEK  60

Query  319  --INHRGEQGHFNPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWH  492
              I     +  F+PT YFVEEVV+  DE+DLH+ WIKVVATRN+ ER++RLENMCWRIWH
Sbjct  61   FEIQKEKAEKLFSPTTYFVEEVVNSFDESDLHKAWIKVVATRNSRERNNRLENMCWRIWH  120

Query  493  LTRKKKQLELEGLQRLAHRRWEREQGRKDVTEDMS  597
            L RKKKQ+  +  Q+L  RR E E+GR D  +D+S
Sbjct  121  LARKKKQIAWDDAQKLVIRRLELEKGRFDALDDLS  155



>ref|XP_009418508.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1049

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD+G S   +++  + +  R E+G F+P +YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGPS---IDAAKSSLLLR-ERGRFSPARYFVEEVITGYDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E  QRL+ RR ERE+ R+D T 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRLSKRRLERERARRDATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_009418507.1| PREDICTED: probable sucrose-phosphate synthase 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1061

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD+G S   +++  + +  R E+G F+P +YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGPS---IDAAKSSLLLR-ERGRFSPARYFVEEVITGYDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E  QRL+ RR ERE+ R+D T 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRLSKRRLERERARRDATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_006852870.1| hypothetical protein AMTR_s00033p00204130 [Amborella trichopoda]
 gb|ERN14337.1| hypothetical protein AMTR_s00033p00204130 [Amborella trichopoda]
Length=1062

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G     ++ K + +  R E+G F+PT+YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDVGTP---LDDKKSSLLLR-ERGRFSPTRYFVEEVITGFDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+WIK  +TR+  ER++RLENMCWRIW+L RKKKQ+E E  QR A RR ERE+GR+D T 
Sbjct  57   RSWIKASSTRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQRSAKRRLERERGRRDATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|ABX59534.1| sucrose phosphate synthase II [Saccharum officinarum]
Length=1060

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 19/142 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG---------------EQGHFNPTKY  363
            MAGN+WIN YLEAILD+G +A E+ +                        E+G FNP +Y
Sbjct  1    MAGNDWINSYLEAILDAGGAAGEISAAAGSGGGGDGTAGEKRDKSSLMLRERGRFNPARY  60

Query  364  FVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLA  543
            FVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E   RL+
Sbjct  61   FVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEASRLS  120

Query  544  HRRWEREQGRK----DVTEDMS  597
             RR E E+ R+    D++ED+S
Sbjct  121  KRRMELEKARQYAAADLSEDLS  142



>emb|CDX70382.1| BnaC03g04660D [Brassica napus]
Length=962

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            M GN+W+N YLEAIL   A     +SK +++    E+GHF+P++YFVEEV++G DETDLH
Sbjct  1    MVGNDWVNSYLEAIL--AAEPGIGDSKSSLLLR--ERGHFSPSRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLEN+CWRIW+L R+KK++E +  +R A R   RE+  K+VT 
Sbjct  57   RSWVQAAATRSPQERNTRLENLCWRIWNLARQKKKVEGKNAKRAAKRHLLREKALKEVTA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_009126436.1| PREDICTED: sucrose-phosphate synthase 1-like [Brassica rapa]
Length=1050

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 98/123 (80%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+W+N YLEAILD G    +  ++P+++    E+G F P++YFVEEV++G DETDLH
Sbjct  1    MAGNDWVNSYLEAILDVGQPLDD--ARPSLLLR--ERGRFTPSRYFVEEVITGYDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            ++W K VATR+T ER++RLENMCWRIW+L R+KKQ E +  QRLA RR ERE+GR++VT+
Sbjct  57   KSWTKAVATRSTQERNTRLENMCWRIWNLARQKKQHEEKEAQRLAKRRLERERGRREVTD  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|AFP23360.1| sucrose phosphate synthase [Litchi chinensis]
Length=1045

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+WI+  ATR+  ER++RLENMCWRIW+L R+KKQLE E +QR+A RR ERE+ R++ T 
Sbjct  57   RSWIRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAVQRMAKRRQERERARREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>sp|O04932.1|SPSA1_CRAPL RecName: Full=Probable sucrose-phosphate synthase 1; AltName: 
Full=UDP-glucose-fructose-phosphate glucosyltransferase 1 [Craterostigma 
plantagineum]
 emb|CAA72506.1| sucrose-phosphate synthase [Craterostigma plantagineum]
Length=1054

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 93/128 (73%), Gaps = 14/128 (11%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-----EQGHFNPTKYFVEEVVSGVD  393
            MAGN+WIN YLEAILD G         P +   +G     E+G F+PT+YFVEEVVSG D
Sbjct  1    MAGNDWINSYLEAILDVG---------PGIDEAKGSLLLRERGRFSPTRYFVEEVVSGFD  51

Query  394  ETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGR  573
            ETDLHR+WI+  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR
Sbjct  52   ETDLHRSWIRAQATRSPQERNTRLENMCWRIWNLARQKKQLENEEAQRMAKRRLERERGR  111

Query  574  KDVTEDMS  597
            ++   DMS
Sbjct  112  REAVADMS  119



>ref|XP_004167243.1| PREDICTED: LOW QUALITY PROTEIN: probable sucrose-phosphate synthase 
1-like, partial [Cucumis sativus]
Length=987

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES-KPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  405
            MAGN+WIN YLEAILD G    E +S K +      E+GHF+PT+YFVEEV++G DE+DL
Sbjct  91   MAGNDWINSYLEAILDVGPGIDEAKSAKQSSSLLLRERGHFSPTRYFVEEVITGFDESDL  150

Query  406  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            +R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E   R+A RR ERE+GR++ T
Sbjct  151  YRSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEALRMAKRRLERERGRREAT  210

Query  586  EDMS  597
             DMS
Sbjct  211  ADMS  214



>ref|XP_004150653.1| PREDICTED: probable sucrose-phosphate synthase 1-like [Cucumis 
sativus]
 gb|KGN65109.1| hypothetical protein Csa_1G224890 [Cucumis sativus]
Length=1061

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVES-KPAVINHRGEQGHFNPTKYFVEEVVSGVDETDL  405
            MAGN+WIN YLEAILD G    E +S K +      E+GHF+PT+YFVEEV++G DE+DL
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEAKSAKQSSSLLLRERGHFSPTRYFVEEVITGFDESDL  60

Query  406  HRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVT  585
            +R+W+K  ATR+  ER++RLENMCWRIW+L R+KKQLE E   R+A RR ERE+GR++ T
Sbjct  61   YRSWVKAAATRSPQERNTRLENMCWRIWNLARQKKQLEGEEALRMAKRRLERERGRREAT  120

Query  586  EDMS  597
             DMS
Sbjct  121  ADMS  124



>dbj|BAM68535.1| sucrose phosphate synthase [Mangifera indica]
Length=1056

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W +  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWARAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>dbj|BAM37540.1| sucrose phosphate synthase [Mangifera indica]
 dbj|BAM68533.1| sucrose phosphate synthase [Mangifera indica]
 dbj|BAM68534.1| sucrose phosphate synthase [Mangifera indica]
Length=1056

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGLDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W +  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+A RR ERE+GR++ T 
Sbjct  57   RSWARAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEAAQRMAKRRLERERGRREATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_003573681.1| PREDICTED: probable sucrose-phosphate synthase 4 [Brachypodium 
distachyon]
Length=1064

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 89/142 (63%), Gaps = 19/142 (13%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG-------------------EQGHFN  351
            M GN+WIN YLEAILD+G +A ++ +        G                   E+G FN
Sbjct  1    MVGNDWINSYLEAILDAGGAAGDISAASVAGGGDGPGAGGADGEKRDKSSLMLRERGRFN  60

Query  352  PTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGL  531
            P +YFVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E  
Sbjct  61   PARYFVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEEA  120

Query  532  QRLAHRRWEREQGRKDVTEDMS  597
             R + +R ERE+ R+D   D+S
Sbjct  121  SRSSKKRLEREKARRDAAADLS  142



>ref|XP_009395490.1| PREDICTED: probable sucrose-phosphate synthase 1 [Musa acuminata 
subsp. malaccensis]
Length=1059

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD+G S   +++  A +  R E+G F+PT+YFVEEV++G DETDL+
Sbjct  1    MAGNDWINSYLEAILDAGPS---IDAAKASLLLR-ERGRFSPTRYFVEEVITGFDETDLY  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            +TW++  A R+  ER++RLENMCWRIW+L RKKKQ+E E  Q ++ RR ERE+ R+D T 
Sbjct  57   KTWVRAAAMRSPQERNTRLENMCWRIWNLARKKKQIEGEEAQGISKRRLERERARRDATA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|AAL34531.1|AF439861_1 sucrose-phosphate synthase [Ipomoea batatas]
Length=1048

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    + +S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDDAKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QRLA RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEQAQRLAKRRQERERGRREAVA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>ref|XP_011084090.1| PREDICTED: probable sucrose-phosphate synthase 1 [Sesamum indicum]
Length=1053

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGN+WIN YLEAILD G    EV+S   +     E+G F+PT+YFVEEV++G DETDLH
Sbjct  1    MAGNDWINSYLEAILDVGPGIDEVKSSLLL----RERGRFSPTRYFVEEVITGFDETDLH  56

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRWEREQGRKDVTE  588
            R+W++  ATR+  ER++RLENMCWRIW+L R+KKQLE E  QR+  RR ERE+GR++   
Sbjct  57   RSWVRAQATRSPQERNTRLENMCWRIWNLARQKKQLEGEEAQRMTKRRLERERGRREAVA  116

Query  589  DMS  597
            DMS
Sbjct  117  DMS  119



>gb|ACN89831.2| sucrose phosphate synthase B3 [Medicago sativa]
Length=543

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  376  VVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLAHRRW  555
            VV+ VDE+DL+RTW+KVVATRNT ERSSRLENMCWRIWHL RKKKQLE E +QRLA+RRW
Sbjct  1    VVASVDESDLYRTWVKVVATRNTRERSSRLENMCWRIWHLARKKKQLEWEEVQRLANRRW  60

Query  556  EREQGRKDVTEDMS  597
            EREQGR+D TEDMS
Sbjct  61   EREQGRRDATEDMS  74



>emb|CDM80277.1| unnamed protein product [Triticum aestivum]
 emb|CDM80280.1| unnamed protein product [Triticum aestivum]
Length=1076

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 89/143 (62%), Gaps = 20/143 (14%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRG--------------------EQGHF  348
            M GN+WIN YLEAILD+G +A ++ +        G                    E+G F
Sbjct  1    MVGNDWINSYLEAILDAGGAAGDITAASVASAAPGGGAGSAAAEKRRDKASLMLRERGRF  60

Query  349  NPTKYFVEEVVSGVDETDLHRTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEG  528
            NP +YFVEEV+SG DETDL++TW++  A R+  ER++RLENM WRIW+L RKKKQ+E E 
Sbjct  61   NPARYFVEEVISGFDETDLYKTWVRTSAMRSPQERNTRLENMSWRIWNLARKKKQIEGEE  120

Query  529  LQRLAHRRWEREQGRKDVTEDMS  597
              R + +R ERE+ R+D   D+S
Sbjct  121  ASRSSKKRLEREKARRDAAADLS  143



>ref|XP_009802041.1| PREDICTED: probable sucrose-phosphate synthase 1 [Nicotiana sylvestris]
 ref|XP_009802042.1| PREDICTED: probable sucrose-phosphate synthase 1 [Nicotiana sylvestris]
Length=1044

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +1

Query  229  MAGNEWINGYLEAILDSGASAIEVESKPAVINHRGEQGHFNPTKYFVEEVVSGVDETDLH  408
            MAGNEWIN YLEAILD G    + +S   ++    E+G F+P +YFVEEV++G DETDLH
Sbjct  1    MAGNEWINSYLEAILDVGPPINDPKSSSLLLR---ERGRFSPARYFVEEVITGFDETDLH  57

Query  409  RTWIKVVATRNTMERSSRLENMCWRIWHLTRKKKQLELEGLQRLA  543
            R+W++  + R++ ER++RLENMCWRIW+LTRKKKQLE E  QR+A
Sbjct  58   RSWVRASSIRDSQERNTRLENMCWRIWNLTRKKKQLEGEEAQRVA  102



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510