BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS131A06

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD94991.1|  cytoplasmic aconitate hydratase                        353   3e-119   Arabidopsis thaliana [mouse-ear cress]
gb|EEC83021.1|  hypothetical protein OsI_28098                          357   6e-117   Oryza sativa Indica Group [Indian rice]
ref|NP_001136484.1|  uncharacterized protein LOC100216599               353   8e-116   
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        364   1e-115   Cucumis melo [Oriental melon]
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    355   1e-115   
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        362   7e-115   Nicotiana tomentosiformis
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     357   1e-114   Eucalyptus grandis [rose gum]
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        362   1e-114   Sesamum indicum [beniseed]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    361   1e-114   Cucumis sativus [cucumbers]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        360   1e-114   Solanum lycopersicum
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    360   2e-114   Solanum tuberosum [potatoes]
ref|XP_004159202.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    360   2e-114   
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    360   4e-114   Glycine max [soybeans]
ref|NP_001159192.1|  uncharacterized protein LOC100304277               339   4e-114   
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    357   5e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        360   5e-114   Nicotiana sylvestris
ref|XP_010100637.1|  Aconitate hydratase                                358   8e-114   
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             358   1e-113   Phaseolus vulgaris [French bean]
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             358   1e-113   Populus trichocarpa [western balsam poplar]
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    353   2e-113   
gb|KDP22711.1|  hypothetical protein JCGZ_01813                         358   2e-113   Jatropha curcas
gb|EEE68177.1|  hypothetical protein OsJ_26310                          357   2e-113   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE71240.1|  putative cytoplasmic aconitate hydratase               338   2e-113   Trifolium pratense [peavine clover]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        358   2e-113   Glycine soja [wild soybean]
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    357   2e-113   Glycine max [soybeans]
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        357   3e-113   Prunus mume [ume]
sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    348   3e-113   Solanum tuberosum [potatoes]
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          357   3e-113   Sorghum bicolor [broomcorn]
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             357   4e-113   Prunus persica
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        355   4e-113   Glycine soja [wild soybean]
gb|KJB62843.1|  hypothetical protein B456_009G439700                    341   4e-113   Gossypium raimondii
gb|ADM34980.1|  cytosolic aconitase                                     355   6e-113   Pyrus pyrifolia [sha li]
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      355   6e-113   Gossypium arboreum [tree cotton]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        357   7e-113   Eucalyptus grandis [rose gum]
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        357   7e-113   Populus euphratica
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         354   8e-113   Arabidopsis thaliana [mouse-ear cress]
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        354   8e-113   Glycine soja [wild soybean]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        356   8e-113   Fragaria vesca subsp. vesca
dbj|BAG16527.1|  putative aconitase                                     356   8e-113   Capsicum chinense [bonnet pepper]
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    356   1e-112   Glycine max [soybeans]
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    356   1e-112   
emb|CDY18054.1|  BnaC07g04160D                                          355   1e-112   Brassica napus [oilseed rape]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    355   2e-112   Arabis alpina [alpine rockcress]
emb|CAN62964.1|  hypothetical protein VITISV_029521                     343   2e-112   Vitis vinifera
gb|KJB60835.1|  hypothetical protein B456_009G327800                    355   2e-112   Gossypium raimondii
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    355   2e-112   Glycine max [soybeans]
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    355   2e-112   Tarenaya hassleriana [spider flower]
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   351   2e-112   Citrus sinensis [apfelsine]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             355   2e-112   
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        355   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             355   2e-112   Eutrema salsugineum [saltwater cress]
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    355   3e-112   Phoenix dactylifera
gb|KHG08189.1|  hypothetical protein F383_11434                         352   3e-112   Gossypium arboreum [tree cotton]
ref|NP_178634.2|  aconitate hydratase 3                                 354   4e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93088.1|  BnaA03g38100D                                          354   4e-112   
emb|CDX97969.1|  BnaA06g07200D                                          354   5e-112   
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    354   5e-112   
gb|KJB50479.1|  hypothetical protein B456_008G173400                    354   5e-112   Gossypium raimondii
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    354   6e-112   Elaeis guineensis
gb|KJB30565.1|  hypothetical protein B456_005G149700                    352   8e-112   Gossypium raimondii
gb|ADZ57218.1|  aconitase protein                                       351   9e-112   Litchi chinensis [litchi]
ref|XP_007045642.1|  Aconitase 3                                        353   1e-111   
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    353   1e-111   Cicer arietinum [garbanzo]
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    353   1e-111   Gossypium arboreum [tree cotton]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           351   1e-111   Nicotiana tabacum [American tobacco]
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        353   1e-111   
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    353   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   351   1e-111   Nelumbo nucifera [Indian lotus]
emb|CDY50945.1|  BnaC03g74450D                                          353   1e-111   Brassica napus [oilseed rape]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        353   2e-111   Vitis vinifera
gb|KJB30569.1|  hypothetical protein B456_005G149700                    352   2e-111   Gossypium raimondii
emb|CBE71058.1|  aconitate hydratase 2                                  350   2e-111   Citrus clementina [clementine]
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        352   2e-111   Solanum lycopersicum
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        352   2e-111   Nelumbo nucifera [Indian lotus]
ref|XP_008785076.1|  PREDICTED: putative aconitate hydratase, cyt...    337   3e-111   
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    352   3e-111   Brassica rapa
gb|KJB30566.1|  hypothetical protein B456_005G149700                    352   3e-111   Gossypium raimondii
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    352   3e-111   Nicotiana sylvestris
gb|AAP30039.1|  aconitase                                               350   4e-111   Solanum pennellii
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    352   4e-111   Populus euphratica
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    352   4e-111   
gb|KJB62847.1|  hypothetical protein B456_009G440000                    351   6e-111   Gossypium raimondii
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   347   7e-111   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   351   7e-111   Citrus sinensis [apfelsine]
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    342   7e-111   
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    351   7e-111   Nicotiana tomentosiformis
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             351   8e-111   Citrus clementina [clementine]
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    349   9e-111   
ref|XP_003605929.1|  Aconitate hydratase                                350   1e-110   Medicago truncatula
gb|ADP03320.1|  aconitate hydratase                                     333   1e-110   Pinus pinaster [cluster pine]
emb|CDP10817.1|  unnamed protein product                                350   1e-110   Coffea canephora [robusta coffee]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             350   1e-110   Capsella rubella
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    350   2e-110   Camelina sativa [gold-of-pleasure]
ref|NP_001159229.1|  uncharacterized protein LOC100304315               342   4e-110   
ref|XP_006376779.1|  aconitate hydratase family protein                 349   4e-110   Populus trichocarpa [western balsam poplar]
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    349   5e-110   Brassica rapa
emb|CBE71057.1|  aconitate hydratase 3                                  347   5e-110   Citrus clementina [clementine]
gb|AAO62410.1|  aconitase                                               347   7e-110   Solanum pennellii
ref|XP_002524184.1|  aconitase, putative                                348   9e-110   Ricinus communis
ref|XP_006828850.1|  hypothetical protein AMTR_s00001p00156400          348   1e-109   Amborella trichopoda
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    348   1e-109   Solanum tuberosum [potatoes]
gb|ADP03120.1|  aconitate hydratase                                     330   1e-109   Pinus sylvestris [Scotch pine]
gb|KJB48278.1|  hypothetical protein B456_008G061900                    346   1e-109   Gossypium raimondii
gb|ADP03151.1|  aconitate hydratase                                     330   1e-109   Pinus sylvestris [Scotch pine]
gb|ADP03134.1|  aconitate hydratase                                     330   1e-109   Pinus sylvestris [Scotch pine]
gb|ADP03123.1|  aconitate hydratase                                     330   1e-109   Pinus sylvestris [Scotch pine]
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   337   1e-109   Citrus sinensis [apfelsine]
gb|ABK25210.1|  unknown                                                 337   2e-109   Picea sitchensis
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   347   2e-109   Citrus sinensis [apfelsine]
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    345   2e-109   Cucurbita maxima [Boston marrow]
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             348   2e-109   Citrus clementina [clementine]
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              340   2e-109   
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    343   2e-109   Medicago truncatula
gb|ADP03144.1|  aconitate hydratase                                     330   2e-109   Pinus sylvestris [Scotch pine]
gb|KHG02134.1|  hypothetical protein F383_25649                         347   3e-109   Gossypium arboreum [tree cotton]
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        345   3e-109   Gossypium arboreum [tree cotton]
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                347   4e-109   Erythranthe guttata [common monkey flower]
ref|XP_002870438.1|  predicted protein                                  346   4e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    347   4e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002530635.1|  aconitase, putative                                344   4e-109   Ricinus communis
gb|AAC26045.1|  aconitase-iron regulated protein 1                      344   5e-109   Citrus limon [lemon]
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    346   5e-109   Camelina sativa [gold-of-pleasure]
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   341   6e-109   
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   344   7e-109   
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    341   8e-109   
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        344   8e-109   Gossypium arboreum [tree cotton]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    346   8e-109   Nelumbo nucifera [Indian lotus]
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        345   9e-109   Vitis vinifera
gb|KGN48958.1|  Aconitase                                               343   1e-108   
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              341   1e-108   
ref|XP_004158846.1|  PREDICTED: aconitate hydratase-like                321   1e-108   
gb|ADP03143.1|  aconitate hydratase                                     328   1e-108   Pinus sylvestris [Scotch pine]
ref|XP_004134842.1|  PREDICTED: aconitate hydratase 1-like              343   1e-108   Cucumis sativus [cucumbers]
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                345   1e-108   Erythranthe guttata [common monkey flower]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     343   2e-108   Cucumis melo [Oriental melon]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   343   2e-108   Pyrus x bretschneideri [bai li]
ref|XP_003612247.1|  Aconitate hydratase                                343   2e-108   Medicago truncatula
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              342   2e-108   Pyrus x bretschneideri [bai li]
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              342   2e-108   Pyrus x bretschneideri [bai li]
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    343   4e-108   Camelina sativa [gold-of-pleasure]
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    344   4e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS48231.1|  Putative aconitate hydratase, cytoplasmic               341   4e-108   Triticum urartu
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   337   5e-108   Citrus sinensis [apfelsine]
ref|XP_007046597.1|  Aconitase 1                                        341   8e-108   
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    343   8e-108   Sesamum indicum [beniseed]
ref|XP_002532564.1|  aconitase, putative                                342   1e-107   
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   341   1e-107   Vitis vinifera
gb|EMS45933.1|  Putative aconitate hydratase, cytoplasmic               340   1e-107   Triticum urartu
gb|KDP23953.1|  hypothetical protein JCGZ_25341                         340   1e-107   Jatropha curcas
emb|CBI24446.3|  unnamed protein product                                341   1e-107   Vitis vinifera
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    342   2e-107   
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    342   2e-107   Nicotiana sylvestris
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          342   2e-107   Sorghum bicolor [broomcorn]
ref|XP_003596988.1|  Aconitate hydratase                                342   3e-107   Medicago truncatula
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    343   3e-107   Nicotiana tomentosiformis
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   337   4e-107   Citrus sinensis [apfelsine]
gb|AAL13084.1|  putative aconitase                                      339   4e-107   Prunus avium [gean]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             339   4e-107   Prunus persica
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    341   5e-107   Elaeis guineensis
gb|KDP39136.1|  hypothetical protein JCGZ_00893                         341   5e-107   Jatropha curcas
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    341   7e-107   Elaeis guineensis
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    340   7e-107   Setaria italica
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               339   7e-107   
ref|NP_001119125.1|  aconitate hydratase 1                              336   8e-107   Arabidopsis thaliana [mouse-ear cress]
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     337   8e-107   Gossypium arboreum [tree cotton]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    340   1e-106   Brachypodium distachyon [annual false brome]
ref|XP_006383042.1|  aconitate hydratase family protein                 338   1e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   338   1e-106   Populus euphratica
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   338   1e-106   Prunus mume [ume]
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    340   2e-106   Phoenix dactylifera
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   337   2e-106   Citrus sinensis [apfelsine]
emb|CBE71056.1|  aconitate hydratase 1                                  337   2e-106   Citrus clementina [clementine]
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   337   2e-106   Citrus sinensis [apfelsine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   337   2e-106   Citrus sinensis [apfelsine]
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   337   2e-106   Citrus sinensis [apfelsine]
gb|ACK56134.1|  putative aconitase                                      315   2e-106   Dimocarpus longan [longan]
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             337   2e-106   Citrus clementina [clementine]
dbj|BAJ92965.1|  predicted protein                                      339   2e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    339   3e-106   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ85661.1|  predicted protein                                      338   3e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    336   6e-106   Arabis alpina [alpine rockcress]
ref|NP_195308.1|  aconitate hydratase 1                                 336   6e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   336   6e-106   Citrus sinensis [apfelsine]
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    334   6e-106   Camelina sativa [gold-of-pleasure]
gb|EEE58288.1|  hypothetical protein OsJ_09326                          335   1e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    337   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     333   1e-105   Eucalyptus grandis [rose gum]
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             337   2e-105   Capsella rubella
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             335   2e-105   Capsella rubella
emb|CDX69174.1|  BnaC01g02790D                                          335   2e-105   
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   335   2e-105   Brassica rapa
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    337   2e-105   Cicer arietinum [garbanzo]
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    336   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             335   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    335   3e-105   
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    334   3e-105   Glycine max [soybeans]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             334   3e-105   Phaseolus vulgaris [French bean]
ref|NP_001048898.1|  Os03g0136900                                       336   3e-105   
gb|EEC74472.1|  hypothetical protein OsI_09921                          336   3e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    336   4e-105   Phoenix dactylifera
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              334   5e-105   Brassica rapa
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             335   6e-105   Eutrema salsugineum [saltwater cress]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    335   6e-105   Camelina sativa [gold-of-pleasure]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    335   9e-105   Solanum tuberosum [potatoes]
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    335   1e-104   Camelina sativa [gold-of-pleasure]
emb|CDY24823.1|  BnaA08g14870D                                          333   1e-104   Brassica napus [oilseed rape]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   333   1e-104   Eucalyptus grandis [rose gum]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    335   1e-104   Brachypodium distachyon [annual false brome]
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     333   1e-104   Eucalyptus grandis [rose gum]
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   333   1e-104   Glycine max [soybeans]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             333   1e-104   Eutrema salsugineum [saltwater cress]
emb|CDX75532.1|  BnaA01g01700D                                          333   2e-104   
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               342   2e-104   
ref|XP_010113288.1|  Aconitate hydratase 1                              333   3e-104   
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    333   3e-104   Arabis alpina [alpine rockcress]
gb|KHN41868.1|  Aconitate hydratase 1                                   332   3e-104   Glycine soja [wild soybean]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              332   4e-104   Camelina sativa [gold-of-pleasure]
emb|CDY66424.1|  BnaAnng22230D                                          333   5e-104   Brassica napus [oilseed rape]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    333   6e-104   Brassica rapa
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              331   8e-104   Cicer arietinum [garbanzo]
emb|CDY41626.1|  BnaC03g62580D                                          331   8e-104   Brassica napus [oilseed rape]
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        331   8e-104   Glycine soja [wild soybean]
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   330   8e-104   Tarenaya hassleriana [spider flower]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   330   1e-103   Fragaria vesca subsp. vesca
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   330   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              330   1e-103   Camelina sativa [gold-of-pleasure]
emb|CDY14291.1|  BnaA08g14220D                                          332   1e-103   Brassica napus [oilseed rape]
emb|CAB36543.1|  putative aconitase                                     329   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             331   4e-103   
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             330   6e-103   
ref|NP_567763.2|  aconitase 2                                           330   9e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              325   1e-101   Tarenaya hassleriana [spider flower]
gb|AAK91447.1|  AT4g26970/F10M23_310                                    327   2e-101   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05740.1|  unnamed protein product                                325   5e-101   Coffea canephora [robusta coffee]
ref|XP_007020807.1|  Aconitase 3                                        322   1e-100   
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          323   2e-100   Sorghum bicolor [broomcorn]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    322   5e-100   Zea mays [maize]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    322   5e-100   Zea mays [maize]
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             321   5e-100   
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             320   8e-100   
ref|XP_007020811.1|  Aconitase 3                                        318   6e-99    
ref|XP_006830449.1|  hypothetical protein AMTR_s00115p00015570          313   2e-97    
gb|ACR36825.1|  unknown                                                 305   4e-97    Zea mays [maize]
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              312   7e-97    Eucalyptus grandis [rose gum]
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     312   1e-96    Eucalyptus grandis [rose gum]
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              306   1e-96    
ref|XP_001780674.1|  predicted protein                                  310   4e-96    
ref|XP_009361096.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    303   1e-95    
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    305   5e-95    Cucumis melo var. conomon [snake cucumber]
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             307   1e-94    
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             307   1e-94    
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    305   4e-94    Zea mays [maize]
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               306   6e-94    Triticum urartu
emb|CAA58046.1|  aconitase                                              305   7e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    305   1e-93    Zea mays [maize]
ref|XP_010443094.1|  PREDICTED: aconitate hydratase 3, mitochondr...    301   2e-93    
ref|NP_001147431.1|  aconitase2                                         303   2e-93    Zea mays [maize]
ref|XP_001779205.1|  predicted protein                                  303   2e-93    
ref|XP_010443093.1|  PREDICTED: aconitate hydratase 3, mitochondr...    301   3e-93    
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               303   6e-93    
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    301   7e-93    Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                301   1e-92    
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    301   2e-92    Camelina sativa [gold-of-pleasure]
gb|KJB17578.1|  hypothetical protein B456_003G006000                    300   2e-92    Gossypium raimondii
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    300   1e-91    
ref|XP_001770969.1|  predicted protein                                  297   3e-91    
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    285   6e-90    
ref|XP_002866068.1|  hypothetical protein ARALYDRAFT_918634             274   5e-89    
emb|CDY56501.1|  BnaAnng14360D                                          289   1e-87    Brassica napus [oilseed rape]
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   283   6e-86    
ref|XP_010046453.1|  PREDICTED: aconitate hydratase, cytoplasmic        256   1e-83    
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   271   5e-81    
ref|XP_007132547.1|  hypothetical protein PHAVU_011G1037000g            249   6e-81    Phaseolus vulgaris [French bean]
ref|XP_006108771.1|  PREDICTED: cytoplasmic aconitate hydratase-like    251   2e-80    Myotis lucifugus
ref|XP_005862173.1|  PREDICTED: cytoplasmic aconitate hydratase-like    250   3e-80    
ref|XP_002766275.1|  Aconitate hydratase, cytoplasmic, putative         252   4e-80    Perkinsus marinus ATCC 50983
ref|XP_008586142.1|  PREDICTED: cytoplasmic aconitate hydratase         246   8e-78    Galeopterus variegatus [Malayan flying lemur]
ref|XP_011404037.1|  PREDICTED: cytoplasmic aconitate hydratase         259   9e-78    
ref|XP_001016756.1|  aconitate hydratase                                260   2e-77    Tetrahymena thermophila SB210
ref|XP_003884224.1|  Iron regulatory protein-like protein, related      259   1e-76    
gb|AGC69746.1|  putative iron regulatory protein                        258   1e-76    
ref|XP_002784977.1|  aconitase, putative                                237   1e-75    
dbj|BAM18054.1|  iron regulatory protein 1A                             244   2e-75    
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         253   2e-75    
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         253   4e-75    
gb|ENN73657.1|  hypothetical protein YQE_09735                          238   5e-75    
ref|XP_010787894.1|  PREDICTED: cytoplasmic aconitate hydratase-like    240   5e-75    
ref|XP_003506017.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    253   5e-75    
ref|XP_010081789.1|  PREDICTED: cytoplasmic aconitate hydratase         247   5e-75    
gb|KFV01523.1|  Cytoplasmic aconitate hydratase                         247   7e-75    
emb|CAA04136.1|  iron regulatory protein                                239   7e-75    
pdb|3SNP|A  Chain A, Crystal Structure Analysis Of Iron Regulator...    253   7e-75    
ref|XP_002788756.1|  aconitase, putative                                251   7e-75    
ref|XP_007614514.1|  PREDICTED: cytoplasmic aconitate hydratase         253   8e-75    
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    253   9e-75    
gb|ERE84356.1|  cytoplasmic aconitate hydratase-like protein            253   1e-74    
ref|XP_005326228.1|  PREDICTED: cytoplasmic aconitate hydratase         252   1e-74    
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         252   2e-74    
ref|XP_004905303.1|  PREDICTED: cytoplasmic aconitate hydratase i...    252   2e-74    
gb|EGT30572.1|  CBN-ACO-1 protein                                       252   2e-74    
ref|XP_001464867.1|  putative aconitase                                 252   2e-74    
ref|XP_004632076.1|  PREDICTED: cytoplasmic aconitate hydratase         251   2e-74    
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         251   2e-74    
ref|XP_002776365.1|  aconitase, putative                                251   3e-74    
gb|ACF33175.1|  aconitase-1                                             251   3e-74    
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         251   3e-74    
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         248   3e-74    
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         248   4e-74    
ref|XP_005078925.1|  PREDICTED: cytoplasmic aconitate hydratase         251   5e-74    
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         251   5e-74    
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    251   5e-74    
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    248   5e-74    
ref|XP_006759955.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    251   5e-74    
gb|EPQ05177.1|  Cytoplasmic aconitate hydratase                         234   5e-74    
ref|XP_002643981.1|  C. briggsae CBR-ACO-1 protein                      250   6e-74    
ref|XP_003109738.1|  CRE-ACO-1 protein                                  250   7e-74    
gb|KHN74276.1|  putative cytoplasmic aconitate hydratase                251   7e-74    
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    250   7e-74    
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    250   7e-74    
ref|XP_006759954.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    250   8e-74    
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  249   8e-74    
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         250   9e-74    
emb|CAP35039.2|  Protein CBR-ACO-1                                      250   9e-74    
gb|KFO19757.1|  Cytoplasmic aconitate hydratase                         251   9e-74    
gb|AFI44047.1|  iron regulatory protein                                 250   1e-73    
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         250   1e-73    
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    249   1e-73    
ref|XP_010724498.1|  PREDICTED: cytoplasmic aconitate hydratase         249   1e-73    
ref|XP_006759953.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    250   1e-73    
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    249   1e-73    
ref|XP_008517260.1|  PREDICTED: cytoplasmic aconitate hydratase         249   1e-73    
ref|XP_001682457.1|  putative aconitase                                 249   1e-73    
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         249   1e-73    
ref|XP_004428436.1|  PREDICTED: cytoplasmic aconitate hydratase i...    249   2e-73    
ref|XP_002765934.1|  aconitase, putative                                249   2e-73    
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         249   2e-73    
gb|ELK33131.1|  Cytoplasmic aconitate hydratase                         250   2e-73    
ref|XP_004658446.1|  PREDICTED: cytoplasmic aconitate hydratase         249   2e-73    
gb|KFG42597.1|  aconitate hydratase ACN/IRP                             250   2e-73    
gb|ESS32610.1|  aconitate hydratase ACN/IRP                             250   2e-73    
gb|EPR62226.1|  aconitate hydratase ACN/IRP                             250   2e-73    
emb|CAA43455.1|  iron response element binding protein                  249   2e-73    
gb|KFH13093.1|  aconitate hydratase ACN/IRP                             250   2e-73    
ref|XP_002366326.1|  aconitate hydratase, putative                      250   2e-73    
ref|XP_004428435.1|  PREDICTED: cytoplasmic aconitate hydratase i...    249   2e-73    
gb|KFG60936.1|  aconitate hydratase ACN/IRP                             250   2e-73    
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       249   2e-73    
ref|XP_006123150.1|  PREDICTED: cytoplasmic aconitate hydratase i...    249   2e-73    
gb|AAH05454.1|  Aconitase 1                                             249   2e-73    
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase         249   2e-73    
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   2e-73    
ref|XP_003357777.1|  PREDICTED: cytoplasmic aconitate hydratase         249   2e-73    
emb|CAD20353.1|  cytoplasmic aconitase                                  249   2e-73    
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         248   2e-73    
gb|AJQ30117.1|  aconitate hydratase 1                                   249   2e-73    
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         249   3e-73    
ref|XP_008154889.1|  PREDICTED: cytoplasmic aconitate hydratase         249   3e-73    
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         245   3e-73    
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         245   3e-73    
ref|XP_004482427.1|  PREDICTED: cytoplasmic aconitate hydratase         249   3e-73    
ref|XP_004392229.1|  PREDICTED: cytoplasmic aconitate hydratase         249   3e-73    
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         245   3e-73    
ref|NP_509898.1|  Protein ACO-1                                         248   3e-73    
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    248   3e-73    
gb|KFV55230.1|  Cytoplasmic aconitate hydratase                         246   3e-73    
ref|XP_008494051.1|  PREDICTED: cytoplasmic aconitate hydratase         248   3e-73    
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...    248   3e-73    
ref|XP_009968191.1|  PREDICTED: cytoplasmic aconitate hydratase         246   4e-73    
gb|EDL98627.1|  rCG55067                                                248   4e-73    
ref|XP_006727401.1|  PREDICTED: cytoplasmic aconitate hydratase         248   4e-73    
ref|XP_003470870.1|  PREDICTED: cytoplasmic aconitate hydratase         248   4e-73    
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         248   5e-73    
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    248   5e-73    
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    248   5e-73    
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    248   5e-73    
ref|XP_011411874.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    247   5e-73    
ref|XP_001952191.1|  PREDICTED: cytoplasmic aconitate hydratase-like    248   6e-73    
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         248   6e-73    
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase         248   6e-73    
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...    248   6e-73    
gb|EHJ78892.1|  iron regulatory protein 1                               236   6e-73    
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    248   6e-73    
ref|XP_002126781.1|  PREDICTED: cytoplasmic aconitate hydratase         248   6e-73    
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         244   7e-73    
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase         248   7e-73    
ref|XP_008693317.1|  PREDICTED: cytoplasmic aconitate hydratase         247   7e-73    
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         247   8e-73    
ref|XP_009872328.1|  PREDICTED: cytoplasmic aconitate hydratase         247   8e-73    
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         247   8e-73    
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         247   8e-73    
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         247   8e-73    
ref|XP_005963977.1|  PREDICTED: cytoplasmic aconitate hydratase         247   8e-73    
ref|XP_003874065.1|  putative aconitase                                 247   8e-73    
ref|XP_001563981.1|  putative aconitase                                 247   8e-73    
ref|XP_004275114.1|  PREDICTED: cytoplasmic aconitate hydratase i...    247   8e-73    
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         247   9e-73    
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         245   9e-73    
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...    247   9e-73    
ref|XP_010122172.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-72    
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         245   1e-72    
ref|XP_009698540.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...    247   1e-72    
gb|KFP65041.1|  Cytoplasmic aconitate hydratase                         247   1e-72    
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    247   1e-72    
gb|ACU19654.1|  unknown                                                 228   1e-72    
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...    247   1e-72    
ref|XP_002928311.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
ref|XP_007116533.1|  PREDICTED: cytoplasmic aconitate hydratase i...    247   1e-72    
ref|XP_008882045.1|  aconitate hydratase ACN/IRP                        248   1e-72    
ref|XP_009573519.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
ref|XP_009283305.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
gb|EZA62627.1|  Cytoplasmic aconitate hydratase                         245   1e-72    
emb|CCW61236.1|  unnamed protein product                                247   1e-72    
ref|XP_010837907.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
ref|XP_007076652.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         247   1e-72    
gb|KIH47318.1|  putative aconitate hydratase 1                          245   1e-72    
gb|AAA69900.1|  iron-responsive regulatory protein/iron regulator...    246   1e-72    
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase         246   1e-72    
gb|AAF99681.1|AF261088_1  iron regulatory protein 1                     245   1e-72    
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase         246   1e-72    
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         246   1e-72    
ref|XP_005909205.1|  PREDICTED: cytoplasmic aconitate hydratase         246   1e-72    
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         246   1e-72    
ref|NP_001069059.1|  cytoplasmic aconitate hydratase                    246   1e-72    
ref|XP_010290546.1|  PREDICTED: cytoplasmic aconitate hydratase         229   2e-72    
tpg|DAA27049.1|  TPA: cytoplasmic aconitate hydratase                   246   2e-72    
ref|XP_004600431.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
ref|XP_010806017.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   2e-72    
ref|XP_005209909.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   2e-72    
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
ref|XP_007116532.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   2e-72    
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              246   2e-72    
ref|XP_008921492.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    246   2e-72    
gb|KFP02434.1|  Cytoplasmic aconitate hydratase                         246   2e-72    
ref|XP_004765422.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
ref|XP_004004476.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   2e-72    
ref|XP_008200453.1|  PREDICTED: cytoplasmic aconitate hydratase-like    246   2e-72    
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
ref|XP_010224488.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
ref|XP_010697897.1|  aconitase, putative                                246   2e-72    
ref|XP_004677765.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
ref|XP_010169631.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
ref|XP_003407686.1|  PREDICTED: cytoplasmic aconitate hydratase         246   2e-72    
gb|ELR46544.1|  Cytoplasmic aconitate hydratase                         246   2e-72    
emb|CCW69174.1|  unnamed protein product                                246   2e-72    
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    246   3e-72    
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         246   3e-72    
ref|XP_011148978.1|  PREDICTED: cytoplasmic aconitate hydratase-like    246   3e-72    
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase         246   3e-72    
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         246   3e-72    
ref|XP_006716840.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   3e-72    
gb|AAA03251.1|  chimeric iron-responsive element-binding protein,...    246   3e-72    
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   3e-72    
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...    246   3e-72    
ref|XP_006809760.1|  PREDICTED: cytoplasmic aconitate hydratase-like    244   3e-72    
ref|NP_002188.1|  cytoplasmic aconitate hydratase                       246   3e-72    
ref|XP_009942226.1|  PREDICTED: cytoplasmic aconitate hydratase         246   3e-72    
ref|XP_010888583.1|  PREDICTED: cytoplasmic aconitate hydratase-like    241   3e-72    
ref|XP_004047955.1|  PREDICTED: cytoplasmic aconitate hydratase         246   3e-72    
ref|XP_006939263.1|  PREDICTED: cytoplasmic aconitate hydratase         246   3e-72    
ref|XP_004004477.1|  PREDICTED: cytoplasmic aconitate hydratase i...    246   4e-72    
ref|XP_003699654.1|  PREDICTED: cytoplasmic aconitate hydratase         246   4e-72    
ref|XP_006025029.1|  PREDICTED: cytoplasmic aconitate hydratase         245   4e-72    
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase         245   4e-72    
ref|XP_011347901.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    246   4e-72    
gb|EJY70620.1|  Aconitate hydratase 1 family protein                    245   4e-72    
ref|XP_011347824.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    245   5e-72    
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase         245   5e-72    
gb|EPY31043.1|  aconitase                                               245   5e-72    
gb|EPY23614.1|  aconitate hydratase 1                                   245   5e-72    
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                    245   6e-72    
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase         245   6e-72    
gb|EHH24050.1|  hypothetical protein EGK_07631                          245   6e-72    
gb|EHH57327.1|  hypothetical protein EGM_06925                          245   6e-72    
gb|ACJ70654.1|  cytoplasmic aconitase/iron-regulatory protein           245   6e-72    
gb|KFB40343.1|  AGAP007258-PA-like protein                              245   7e-72    
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase         244   7e-72    
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase         244   7e-72    
ref|XP_006060333.1|  PREDICTED: cytoplasmic aconitate hydratase i...    244   8e-72    
ref|XP_004390991.1|  PREDICTED: cytoplasmic aconitate hydratase         244   8e-72    
ref|XP_001462506.1|  hypothetical protein                               239   8e-72    
ref|XP_006863078.1|  PREDICTED: cytoplasmic aconitate hydratase         244   8e-72    
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase         244   9e-72    
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-71    
ref|XP_006913749.1|  PREDICTED: cytoplasmic aconitate hydratase-like    244   1e-71    
ref|XP_010197370.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-71    
gb|EJY64435.1|  Aconitate hydratase 1 family protein                    244   1e-71    
ref|XP_002413165.1|  RNA-binding translational regulator IRP, put...    244   1e-71    
ref|XP_538698.2|  PREDICTED: cytoplasmic aconitate hydratase            244   1e-71    
ref|XP_010177495.1|  PREDICTED: cytoplasmic aconitate hydratase         244   1e-71    
ref|XP_004031131.1|  hypothetical protein IMG5_146680                   244   2e-71    
ref|XP_007948891.1|  PREDICTED: cytoplasmic aconitate hydratase         244   2e-71    
gb|EAR86332.2|  cytoplasmic-like aconitate hydratase                    244   2e-71    
ref|XP_001637006.1|  predicted protein                                  243   2e-71    
ref|XP_008996396.1|  PREDICTED: cytoplasmic aconitate hydratase         243   2e-71    
ref|XP_002194651.1|  PREDICTED: cytoplasmic aconitate hydratase         243   2e-71    



>dbj|BAD94991.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=328

 Score =   353 bits (907),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  142  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  201

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  202  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  261

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  262  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  321

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  322  IRNLSKQ  328



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   357 bits (917),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DT
Sbjct  435  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDT  494

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  495  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  554

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+N++EIRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYV
Sbjct  555  LGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYV  614

Query  543  IRQLSKQ  563
            IR L++ 
Sbjct  615  IRNLAQN  621



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   353 bits (906),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  T
Sbjct  377  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHAT  436

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  437  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  496

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP+N++EIRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  497  LGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYV  556

Query  543  IRQLS  557
            IR L+
Sbjct  557  IRNLA  561



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   364 bits (934),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DT
Sbjct  803  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDT  862

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  863  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  922

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLPSNI+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  923  LGLTGHERYSIDLPSNISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFNHGGILPYV  982

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  983  IRNLIKQ  989



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   355 bits (912),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G+DT
Sbjct  472  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGQDT  531

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  532  VILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  591

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+NI EIRPGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGILPYV
Sbjct  592  LGLTGHERYTIHLPTNILEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYYNHGGILPYV  651

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  652  IRNLSKQ  658



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   362 bits (928),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAM+YKS G+DT
Sbjct  811  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYKSAGQDT  870

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  871  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  930

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP NI+EIRPGQDVTV+T+ GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  931  LGLTGHERYTIDLPENISEIRPGQDVTVRTETGKSFTCTVRFDTEVELAYFNHGGILPYV  990

Query  543  IRQLSKQ  563
            IRQL+KQ
Sbjct  991  IRQLTKQ  997



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   357 bits (915),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAM+YKS G DT
Sbjct  609  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGHDT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGED D+
Sbjct  669  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDTDT  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLPSNI+EIRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGILPYV
Sbjct  729  LGLTGHERYSIDLPSNISEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYV  788

Query  543  IRQLSKQ  563
            IR L  Q
Sbjct  789  IRNLINQ  795



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   362 bits (928),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAAM+YKS G+DT
Sbjct  815   SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGQDT  874

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  875   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  934

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+IDLPS I++IRPGQDVTV TD+GK FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  935   LGLTGHERYTIDLPSKISDIRPGQDVTVVTDSGKQFTCTVRFDTEVELAYFNHGGILPYV  994

Query  543   IRQLSKQ  563
             IRQL+KQ
Sbjct  995   IRQLTKQ  1001



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   361 bits (926),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DT
Sbjct  803  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDT  862

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  863  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  922

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP NI+EIRPGQDV+V TD+GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  923  LGLTGHERYSIDLPDNISEIRPGQDVSVTTDSGKSFTCTVRFDTEVELAYFNHGGILPYV  982

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  983  IRNLIKQ  989



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   360 bits (925),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DT
Sbjct  795  SYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMKYKSAGQDT  854

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDADS
Sbjct  855  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADS  914

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  915  LGLTGHERYTIDLPDNISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILPYV  974

Query  543  IRQLSKQ  563
            IRQLS+Q
Sbjct  975  IRQLSQQ  981



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DT
Sbjct  795  SYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMKYKSAGQDT  854

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDADS
Sbjct  855  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADS  914

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  915  LGLTGHERYTIDLPDNISEIRPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYV  974

Query  543  IRQLSKQ  563
            IRQLS+Q
Sbjct  975  IRQLSQQ  981



>ref|XP_004159202.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Cucumis sativus]
Length=989

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYKS G+DT
Sbjct  803  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYKSAGQDT  862

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  863  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  922

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP NI+EIRPGQDV++ TD+GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  923  LGLTGHERYSIDLPDNISEIRPGQDVSITTDSGKSFTCTVRFDTEVELAYFNHGGILPYV  982

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  983  IRNLIKQ  989



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   360 bits (923),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DT
Sbjct  798  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDT  857

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFK+GEDAD+
Sbjct  858  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADT  917

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EIRPGQDVTV T  GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  918  LGLTGHERYTIDLPSNISEIRPGQDVTVTTTTGKSFTCTVRFDTEVELAYFNHGGILPYV  977

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  978  IRNLIKQ  984



>ref|NP_001159192.1| uncharacterized protein LOC100304277 [Zea mays]
 gb|ACN25362.1| unknown [Zea mays]
Length=287

 Score =   339 bits (869),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DT
Sbjct  101  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDT  160

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLC+KAGEDAD+
Sbjct  161  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADT  220

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYV
Sbjct  221  LGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYV  280

Query  543  IRQLSKQ  563
             R++++Q
Sbjct  281  ARKIAEQ  287



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   357 bits (917),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  772  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+N++EIRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYV
Sbjct  832  LGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYV  891

Query  543  IRQLSKQ  563
            IR L++ 
Sbjct  892  IRNLAQN  898



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   360 bits (923),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAM+YKS G+DT
Sbjct  810  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYKSAGQDT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  870  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP NI+EIRPGQDV V+TD GK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  930  LGLTGHERYTIDLPENISEIRPGQDVAVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYV  989

Query  543  IRQLSKQ  563
            IRQL+KQ
Sbjct  990  IRQLTKQ  996



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   358 bits (918),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYKS G DT
Sbjct  752  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYKSAGHDT  811

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI KSFE IHRSNLVGMGI+PLCFKAGEDA++
Sbjct  812  IILAGAEYGSGSSRDWAAKGPMLLGVKAVITKSFERIHRSNLVGMGIIPLCFKAGEDAET  871

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI++IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPY 
Sbjct  872  LGLTGHERYTIDLPSNISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYA  931

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  932  IRNLIKQ  938



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   358 bits (919),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVG KTVHIPTGEKLYVFDAA RYK+EGKDT
Sbjct  797  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGAKTVHIPTGEKLYVFDAAQRYKAEGKDT  856

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  857  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  916

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS I+EIRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGILPYV
Sbjct  917  LGLTGHERYTIDLPSKISEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYV  976

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  977  IRNLIKQ  983



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   358 bits (920),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/187 (91%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYKS G DT
Sbjct  813  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKSAGYDT  872

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK G+DAD+
Sbjct  873  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKDGQDADT  932

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLPSNI EIRPGQDVTV TDNGK+F CTVRFDTEVELAYFNHGGILPY 
Sbjct  933  LGLTGHERYSIDLPSNIGEIRPGQDVTVTTDNGKSFICTVRFDTEVELAYFNHGGILPYA  992

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  993  IRNLMKQ  999



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  T
Sbjct  609  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHAT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  669  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP+N++EIRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  729  LGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYV  788

Query  543  IRQLS  557
            IR L+
Sbjct  789  IRNLA  793



>gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   358 bits (919),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYVFDAAM+YK+ G DT
Sbjct  812  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMKYKTAGHDT  871

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAG+DAD+
Sbjct  872  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADT  931

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI++IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  932  LGLTGHERYTIDLPSNISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  991

Query  543  IRQLSKQ  563
            IR L K+
Sbjct  992  IRNLMKE  998



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   357 bits (916),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKTVH+PTGEKLYVFDAA++YKSEG DT
Sbjct  770  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTVHVPTGEKLYVFDAALKYKSEGHDT  829

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  830  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  889

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+N++EIRPGQD+TV TDNGK+FTCT+RFDTEVELAYFNHGGILPYV
Sbjct  890  LGLTGHERYTIDLPTNVSEIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFNHGGILPYV  949

Query  543  IRQLSKQ  563
            IR L++ 
Sbjct  950  IRNLAQN  956



>dbj|BAE71240.1| putative cytoplasmic aconitate hydratase [Trifolium pratense]
Length=316

 Score =   338 bits (867),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+M+RGTFANIR+VNKLL+GEVGPKTVH+PTGEKL+VFDAA RYK+ G  T
Sbjct  129  SYGSRRGNDEVMSRGTFANIRIVNKLLNGEVGPKTVHVPTGEKLFVFDAAERYKAAGHAT  188

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  189  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADT  248

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ I+EI+PGQDVTV TDNGK+FTCT RFDTEVEL YFNHGGILPYV
Sbjct  249  LGLTGHERYTIDLPNKISEIKPGQDVTVTTDNGKSFTCTARFDTEVELEYFNHGGILPYV  308

Query  543  IRQL  554
            IR L
Sbjct  309  IRNL  312



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   358 bits (918),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DT
Sbjct  798  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDT  857

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFK+GEDAD+
Sbjct  858  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADT  917

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EIRPGQDVTV T+ GK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  918  LGLTGHERYTIDLPSNISEIRPGQDVTVTTNTGKSFTCTVRFDTEVELAYFNNGGILPYV  977

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  978  IRNLIKQ  984



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   357 bits (917),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK+EG+DT
Sbjct  798  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAQRYKAEGQDT  857

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFK+GEDAD+
Sbjct  858  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADT  917

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EIRPGQDVTV T+ GK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  918  LGLTGHERYTIDLPSNISEIRPGQDVTVTTNTGKSFTCTVRFDTEVELAYFNNGGILPYV  977

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  978  IRNLIKQ  984



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   357 bits (917),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK++G DT
Sbjct  808  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYKADGHDT  867

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  868  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  927

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS+I+EI+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGIL YV
Sbjct  928  LGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILHYV  987

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  988  IRNLSKQ  994



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVH+P+GEKL VFDAAM+YKS G+ T
Sbjct  430  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQST  489

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  490  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  549

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YV
Sbjct  550  LGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCIVRFDTEVELAYFNHGGILQYV  609

Query  543  IRQLSKQ  563
            IRQL+++
Sbjct  610  IRQLTQR  616



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   357 bits (917),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L+GEVGPKT+H+PTGEKLYVFDAAMRYKSEG  T
Sbjct  808  SYGSRRGNDEIMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLYVFDAAMRYKSEGHAT  867

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  868  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  927

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP+N++EIRPGQDVTV TDNGK+FTCT+RFDTEVELAYFNHGGILPYV
Sbjct  928  LGLTGHERYSIDLPANLSEIRPGQDVTVITDNGKSFTCTLRFDTEVELAYFNHGGILPYV  987

Query  543  IRQLS  557
            IR L+
Sbjct  988  IRNLA  992



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   357 bits (916),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK++G DT
Sbjct  810  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAATRYKADGHDT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  870  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS+I+EI+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGIL YV
Sbjct  930  LGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILHYV  989

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  990  IRNLSKQ  996



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   355 bits (912),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKLYVFDAA RYK+ G+DT
Sbjct  732  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAATRYKASGQDT  791

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  792  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  851

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LPS INEIRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGILPYV
Sbjct  852  LGLTGHERYTIELPSIINEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYV  911

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  912  IRNLIKQ  918



>gb|KJB62843.1| hypothetical protein B456_009G439700, partial [Gossypium raimondii]
Length=417

 Score =   341 bits (875),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+V+KLL GEVGPKT+H+PTGEKLYV+DAAMRYK+ G+DT
Sbjct  231  SYGSRRGNDEVMARGTFANIRIVSKLLKGEVGPKTIHVPTGEKLYVYDAAMRYKAAGQDT  290

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKG MLLGVKAVI KSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  291  IVLAGAEYGSGSSRDWAAKGQMLLGVKAVITKSFERIHRSNLVGMGIIPLCFKPGEDADS  350

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP+ I+EIRPGQDVTV T  GK+FTCTVRFDTEVELAYF+HGGILP+V
Sbjct  351  LGLTGHERYSIDLPNKISEIRPGQDVTVTTVTGKSFTCTVRFDTEVELAYFDHGGILPFV  410

Query  543  IRQLSKQ  563
            IR L+K+
Sbjct  411  IRNLNKE  417



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   355 bits (910),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL+VFDAA RYK++G DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  772  IVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EI+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGIL YV
Sbjct  832  LGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYV  891

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  892  IRNLSKQ  898



>gb|KHG18502.1| Aconitate hydratase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=933

 Score =   355 bits (911),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKLYVFDAAMRYK  G DT
Sbjct  747  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFDAAMRYKDAGYDT  806

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  807  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  866

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS I +IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  867  LGLTGHERYTIDLPSKITDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYV  926

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  927  IRNLIKQ  933



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   357 bits (915),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAM+YKS G DT
Sbjct  810  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMKYKSAGHDT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGED D+
Sbjct  870  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDTDT  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLPSNI+EIRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGILPYV
Sbjct  930  LGLTGHERYSIDLPSNISEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYV  989

Query  543  IRQLSKQ  563
            IR L  Q
Sbjct  990  IRNLINQ  996



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   357 bits (915),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIRLVNK L+GEVGPKTVHIPTGEKLYVFDAAMRYKS G DT
Sbjct  815   SYGSRRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLYVFDAAMRYKSAGYDT  874

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAG+DAD+
Sbjct  875   IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADT  934

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERYSIDLPSNI+EIRPGQDVTV TDNGK+F CTVRFDTEVELAYFNHGGIL Y 
Sbjct  935   LGLTGHERYSIDLPSNIDEIRPGQDVTVTTDNGKSFICTVRFDTEVELAYFNHGGILQYA  994

Query  543   IRQLSKQ  563
             IR L KQ
Sbjct  995   IRNLMKQ  1001



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   354 bits (909),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  832  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  891

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  892  IRNLSKQ  898



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   354 bits (909),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVHIPTGEKLYVFDAA RY + G+DT
Sbjct  717  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHIPTGEKLYVFDAATRYMASGQDT  776

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  777  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  836

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLPS I+EIRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGILPYV
Sbjct  837  LGLTGHERYSIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELDYFNHGGILPYV  896

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  897  IRNLIKQ  903



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   356 bits (914),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+P+GEKL VFDAAM+YKS G+DT
Sbjct  804  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQDT  863

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  864  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADT  923

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EI+PGQDVTV TD+GK+F CTVRFDTEVELAYFNHGGILPYV
Sbjct  924  LGLTGHERYTIDLPSNISEIKPGQDVTVTTDSGKSFVCTVRFDTEVELAYFNHGGILPYV  983

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  984  IRNLSKQ  990



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   356 bits (914),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL VFDAAM+YKS G++T
Sbjct  809  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQNT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  869  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP NI+EIRPGQDV+V+TD GK+FTCTVRFDTEVELAYFNHGGIL YV
Sbjct  929  LGLTGHERYTIDLPENISEIRPGQDVSVQTDTGKSFTCTVRFDTEVELAYFNHGGILQYV  988

Query  543  IRQLSKQ  563
            IRQL+KQ
Sbjct  989  IRQLTKQ  995



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKLYVFDAA RYK+ G+DT
Sbjct  798  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAATRYKASGQDT  857

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  858  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  917

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LPS INEIRPGQDVTV TDNGK+FTCT RFDTEVELAYFNHGGILPYV
Sbjct  918  LGLTGHERYTIELPSIINEIRPGQDVTVTTDNGKSFTCTARFDTEVELAYFNHGGILPYV  977

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  978  IRNLIKQ  984



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   356 bits (913),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL+VFDAA RYK++G DT
Sbjct  806  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLFVFDAATRYKADGHDT  865

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  866  IVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  925

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EI+PGQDVTV TDNGK FTCTVRFDTEVEL YFNHGGIL YV
Sbjct  926  LGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKAFTCTVRFDTEVELEYFNHGGILQYV  985

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  986  IRNLSKQ  992



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   355 bits (912),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  800  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  859

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDADS
Sbjct  860  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADS  919

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  920  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  979

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  980  IRNLSKQ  986



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIP+GEKL VFDAAMRYKS G+DT
Sbjct  800  SYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVFDAAMRYKSSGEDT  859

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  860  IILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADT  919

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+NI+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  920  LGLTGHERYTIHLPTNISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  979

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  980  IRNLSKQ  986



>emb|CAN62964.1| hypothetical protein VITISV_029521 [Vitis vinifera]
Length=520

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKL VFDAAM+YK+  + T
Sbjct  334  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLSVFDAAMKYKTANQGT  393

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  394  IILAGAEYGSGSSRDWAAKGPMLLGVKAXIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  453

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EIRPGQD+TV T+ GK+F CT RFDTEVELAYFNHGGILPYV
Sbjct  454  LGLTGHERYTIDLPSNIDEIRPGQDITVTTNTGKSFICTARFDTEVELAYFNHGGILPYV  513

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  514  IRNLIKQ  520



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKLYVFDAAMRYK  G DT
Sbjct  804  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFDAAMRYKDAGYDT  863

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  864  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  923

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS I +IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  924  LGLTGHERYTIDLPSKITDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYV  983

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  984  IRNLIKQ  990



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVHIPTGEKLYVFDAA RY + G+DT
Sbjct  793  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHIPTGEKLYVFDAATRYMASGQDT  852

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  853  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  912

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLPS I+EIRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGILPYV
Sbjct  913  LGLTGHERYSIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELDYFNHGGILPYV  972

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  973  IRNLIKQ  979



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   355 bits (912),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/187 (90%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G+DT
Sbjct  812  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGQDT  871

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  872  VILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  931

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+NI EIRPGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGILPYV
Sbjct  932  LGLTGHERYTIHLPTNILEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYYNHGGILPYV  991

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  992  IRNLSKQ  998



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  T
Sbjct  609  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  669  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+V
Sbjct  729  LGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFV  788

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  789  IRNLIKQ  795



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  807  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  866

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  867  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  926

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  927  LGLTGHERYTINLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  986

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  987  IRNLSKQ  993



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL+VFDAA RYK++G DT
Sbjct  808  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDT  867

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  868  IVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  927

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EI+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGIL YV
Sbjct  928  LGLTGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYV  987

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  988  IRNLSKQ  994



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL+GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  809  SYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  869  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  929  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  989  IRNLSKQ  995



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   355 bits (911),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKLYVFD AMRYK++G DT
Sbjct  822   SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLYVFDVAMRYKADGHDT  881

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMG++PLCFK G+DADS
Sbjct  882   IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVIPLCFKPGQDADS  941

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+IDLPSNINEIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  942   LGLTGHERYTIDLPSNINEIRPGQDVTVVTDAGKSFTCTVRFDTEVELAYFNHGGILPYV  1001

Query  543   IRQL  554
             IR L
Sbjct  1002  IRNL  1005



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   352 bits (904),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DT
Sbjct  693  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDT  752

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGA+YGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  753  IVLAGADYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  812

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ I++IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  813  LGLTGHERYTIDLPNKISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYV  872

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  873  IRNLIKQ  879



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  804  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  863

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  864  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  923

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  924  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  983

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  984  IRNLSKQ  990



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  808  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  867

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  868  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  927

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  928  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  987

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  988  IRNLSKQ  994



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   354 bits (909),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  805  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  864

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  865  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  924

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  925  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  984

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  985  IRNLSKQ  991



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   354 bits (908),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  T
Sbjct  799  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHAT  858

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  859  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  918

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP+N++EIRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  919  LGLTGHERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYV  978

Query  543  IRQLS  557
            IR L+
Sbjct  979  IRNLA  983



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   354 bits (909),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DT
Sbjct  810  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  870  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP  I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  930  LGLTGHERYTIDLPRKIDEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYV  989

Query  543  IRQLSKQ  563
            IR L +Q
Sbjct  990  IRNLIRQ  996



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   354 bits (909),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKLYVFDAAMRYK++G DT
Sbjct  821   SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLYVFDAAMRYKADGHDT  880

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK G+DADS
Sbjct  881   IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDADS  940

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHE Y+IDLPSNINEIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  941   LGLTGHELYTIDLPSNINEIRPGQDVTVVTDAGKSFTCTVRFDTEVELAYFNHGGILPYV  1000

Query  543   IRQL  554
             IR L
Sbjct  1001  IRSL  1004



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   352 bits (902),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  772  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ I++IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  832  LGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   351 bits (901),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGP+TVH+PTGEKL+VFDAA RYK  G DT
Sbjct  697  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPQTVHVPTGEKLFVFDAAQRYKDAGHDT  756

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  757  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  816

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP++I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  817  LGLTGHERYTIDLPNSISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYV  876

Query  543  IRQLSKQ  563
            IR L +Q
Sbjct  877  IRNLIEQ  883



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKLYVF+AAMRYK+ G DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLYVFEAAMRYKAAGHDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  869  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI  IRPGQDV+V T+NGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  929  LGLTGHERYTIDLPSNITHIRPGQDVSVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYV  988

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  989  IRNLIKQ  995



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTG+KLYVFDAAMRY + G+DT
Sbjct  793  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGDKLYVFDAAMRYMTSGQDT  852

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLC+K+GEDAD+
Sbjct  853  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCYKSGEDADT  912

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS I+EIRPGQDV V TDNGK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  913  LGLTGHERYTIDLPSKISEIRPGQDVKVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYV  972

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  973  IRNLIKQ  979



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   353 bits (905),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DT
Sbjct  787  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDT  846

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGA+YGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  847  IVLAGADYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  906

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ I++IRPGQDVTV TDNGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  907  LGLTGHERYTIDLPNKISDIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNNGGILPYV  966

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  967  IRNLIKQ  973



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP  I+EI PGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  832  LGLTGHERYTIDLPEKISEIHPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYV  891

Query  543  IRQLSKQ  563
            IRQL +Q
Sbjct  892  IRQLIQQ  898



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL+VFDAA RYK++G DT
Sbjct  808  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLFVFDAATRYKADGHDT  867

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  868  IVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  927

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS+I+EI+PGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGIL YV
Sbjct  928  LGLTGHERYTIDLPSSISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILQYV  987

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  988  IRNLSKQ  994



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DT
Sbjct  805  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDT  864

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  865  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  924

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  925  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  984

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  985  IRNLSKQ  991



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/184 (90%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEK+ VFDAAMRYKSEG+DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKISVFDAAMRYKSEGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSI+LPSN++EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILPYV
Sbjct  832  LGLTGHERYSINLPSNVSEIRPGQDVTVVTDSGKSFTCTVRFDTEVELAYFDHGGILPYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   353 bits (906),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  809  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  869  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+F+CTVRFDTEVELAYFNHGGILPYV
Sbjct  929  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFSCTVRFDTEVELAYFNHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  989  IRNLSKQ  995



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   353 bits (906),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYVFDAAMRYK++G DT
Sbjct  823   SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKADGHDT  882

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I+LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  883   IVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  942

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+IDLPS I+EIRPGQDVTV TDNGK+FTCTVRFDTEVEL YFNHGGILPY 
Sbjct  943   LGLTGHERYNIDLPSKISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELEYFNHGGILPYA  1002

Query  543   IRQLSKQ  563
             IR L  Q
Sbjct  1003  IRNLINQ  1009



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DT
Sbjct  799  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDT  858

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  859  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  918

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ I++IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  919  LGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYV  978

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  979  IRNLIKQ  985



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  T
Sbjct  712  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+V
Sbjct  832  LGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/187 (90%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL VFDAAM+YKS G+ T
Sbjct  809  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQST  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  869  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YV
Sbjct  929  LGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYV  988

Query  543  IRQLSKQ  563
            IRQL+KQ
Sbjct  989  IRQLTKQ  995



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKLYVFDAAMRYK+ G+DT
Sbjct  806  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKAAGQDT  865

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  866  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  925

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPS ++EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  926  LGLTGQERYTIDLPSKVSEIRPGQDVTVVTDTGKSFTCTVRFDTEVELAYFNHGGILPYV  985

Query  543  IRQLSKQ  563
            IR L K 
Sbjct  986  IRNLMKH  992



>ref|XP_008785076.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=437

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDAAMRYKSEG DT
Sbjct  249  SYGSRRGNDEVMARGTFANIRLVNKLLKGEPGPKTIHIPSGEKLSVFDAAMRYKSEGHDT  308

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  309  VILAGAEYGSGSSRDWAAKGPMLLGVKAVVAKSFERIHRSNLVGMGIIPLCFKPGEDAET  368

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP+++++I+PGQDVTV TDNGK F CTVRFDTEVELAY+NHGGILP+V
Sbjct  369  LGLTGHERYTINLPNSVSDIKPGQDVTVVTDNGKQFACTVRFDTEVELAYYNHGGILPFV  428

Query  543  IRQL  554
            IR L
Sbjct  429  IRNL  432



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   352 bits (903),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  805  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  864

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSS DWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  865  IILAGAEYGSGSSSDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  924

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  925  LGLTGHERYTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  984

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  985  IRNLSKQ  991



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   352 bits (903),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKLYVFDAAMRYK  G DT
Sbjct  806  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLYVFDAAMRYKDAGHDT  865

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  866  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  925

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ I++IRPGQDVTV T+NGK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  926  LGLTGHERYTIDLPNKISDIRPGQDVTVTTNNGKSFTCTVRFDTEVELAYFNNGGILPYV  985

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  986  IRNLIKQ  992



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   352 bits (903),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DT
Sbjct  803  SYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDT  862

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDA++
Sbjct  863  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAET  922

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP  I+EI PGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  923  LGLTGHERYTIDLPEKISEIHPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYV  982

Query  543  IRQLSKQ  563
            IRQL +Q
Sbjct  983  IRQLIQQ  989



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   350 bits (897),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIP+GEKL VFDAAM+YKS G+ T
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGQST  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYV  891

Query  543  IRQLSKQ  563
            IRQL+K 
Sbjct  892  IRQLTKH  898



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   352 bits (902),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNK L+GEVGPKTVHIPTGEKL V+DAAMRYK+ G DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLSVYDAAMRYKNAGHDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAG+DAD+
Sbjct  869  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EIRPGQDVTV TDNGK+FTCTVRFDT VEL YFNHGGILPY 
Sbjct  929  LGLTGHERYTIDLPSNISEIRPGQDVTVTTDNGKSFTCTVRFDTAVELEYFNHGGILPYA  988

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  989  IRNLMKQ  995



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   352 bits (902),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 180/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DT
Sbjct  805  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDT  864

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  865  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  924

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EI+PGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  925  LGLTGHERYTIHLPTDISEIKPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  984

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  985  IRNLSKQ  991



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   351 bits (901),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKT+H+PTGEKLYV+DAAMRYK+ G+DT
Sbjct  807  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTIHVPTGEKLYVYDAAMRYKAAGQDT  866

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPML+GVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  867  IVLAGAEYGSGSSRDWAAKGPMLVGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADS  926

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP+ I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYF+HGGILP+V
Sbjct  927  LGLTGHERYSIDLPNKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFDHGGILPFV  986

Query  543  IRQLSKQ  563
            IR L+K+
Sbjct  987  IRNLNKE  993



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   347 bits (889),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +T
Sbjct  609  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHET  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  669  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGL GHERY+I+LP+ ++EIRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGILPYV
Sbjct  729  LGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYV  788

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  789  IRNLIKQ  795



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   351 bits (901),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  T
Sbjct  810  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  870  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+V
Sbjct  930  LGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFV  989

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  990  IRNLIKQ  996



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   342 bits (876),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  21   GNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGA  200
            GNDE+MARGTFANIR+VNK L+GEVGPKT+H+PTGEKL VFDAAMRYKSEG  TIILAGA
Sbjct  435  GNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPTGEKLSVFDAAMRYKSEGHATIILAGA  494

Query  201  EYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADSLGLTGH  380
            EYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADSLGLTGH
Sbjct  495  EYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGH  554

Query  381  ERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQLS  557
            ERYSIDLP+N++EIRPGQDVTV TDNGK+FTC VRFDTEVELAYFNHGGILPYVIR L+
Sbjct  555  ERYSIDLPTNLSEIRPGQDVTVTTDNGKSFTCIVRFDTEVELAYFNHGGILPYVIRNLA  613



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   351 bits (900),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 166/184 (90%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL+GEVGPKT+HIPTGEKL VFDAAM+YKS G+DT
Sbjct  799  SYGSRRGNDEIMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLSVFDAAMKYKSAGQDT  858

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDA++
Sbjct  859  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAET  918

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGILPYV
Sbjct  919  HGLTGHERYTIDLPKNISEIRPGQDVTVRTDTGKSFTCIVRFDTEVELAYFNHGGILPYV  978

Query  543  IRQL  554
            IRQL
Sbjct  979  IRQL  982



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   351 bits (901),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  T
Sbjct  814  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGT  873

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  874  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  933

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+V
Sbjct  934  LGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFV  993

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  994  IRNLIKQ  1000



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   349 bits (895),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYV+DAAMRYKS G+DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYKSAGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  772  IVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ I++IRPGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGHERYTIDLPTKISDIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L+KQ
Sbjct  892  IRNLTKQ  898



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   350 bits (898),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G+DT
Sbjct  793  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKTSGQDT  852

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLC+K GEDAD+
Sbjct  853  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCYKPGEDADT  912

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER++IDLPS I+EI+PGQDV V TD+GK+FTC  RFDTEVELAYFNHGGILPYV
Sbjct  913  LGLTGHERFTIDLPSKISEIKPGQDVKVTTDSGKSFTCIARFDTEVELAYFNHGGILPYV  972

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  973  IRNLIKQ  979



>gb|ADP03320.1| aconitate hydratase [Pinus pinaster]
Length=371

 Score =   333 bits (854),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DT
Sbjct  183  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDT  242

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNLVGMGI+PLCFK+GEDA+S
Sbjct  243  IVLAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAES  302

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV
Sbjct  303  LGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYV  362

Query  543  IRQL  554
            +RQL
Sbjct  363  MRQL  366



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   350 bits (899),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/187 (89%), Positives = 177/187 (95%), Gaps = 1/187 (1%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDEIMARGTFANIRLVNKL S + GPKT+HIPTGEKLYVFDAAMRYK++G DT
Sbjct  824   SYGSRRGNDEIMARGTFANIRLVNKLCSKD-GPKTIHIPTGEKLYVFDAAMRYKADGHDT  882

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  883   IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  942

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+IDLPS I+EIRPGQDVTV TD GK+FTCT RFDTEVELAYFNHGGILPYV
Sbjct  943   LGLTGHERYTIDLPSKIDEIRPGQDVTVTTDTGKSFTCTARFDTEVELAYFNHGGILPYV  1002

Query  543   IRQLSKQ  563
             +RQL+KQ
Sbjct  1003  VRQLTKQ  1009



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   350 bits (898),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAM+YKS G DT
Sbjct  802  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYKSSGVDT  861

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  862  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  921

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER++I LP++I+EIRPGQDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  922  LGLTGHERFTIHLPTDISEIRPGQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  981

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  982  IRNLSKQ  988



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAM+YKS G+DT
Sbjct  808  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMKYKSAGEDT  867

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  868  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  927

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EIRPGQDV+V TDNGK+F CTVRFDTEVELAYFNHGGILPYV
Sbjct  928  LGLTGHERYTIHLPTDISEIRPGQDVSVTTDNGKSFNCTVRFDTEVELAYFNHGGILPYV  987

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  988  IRNLSKQ  994



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+G+KL VFDAAM+YK+EG DT
Sbjct  499  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGDKLSVFDAAMKYKNEGHDT  558

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  559  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADT  618

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYV
Sbjct  619  LGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYV  678

Query  543  IRQLSKQ  563
            IR++++Q
Sbjct  679  IRKIAEQ  685



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   349 bits (896),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNK L+GEVGPKTVHIPTGEKL V+DAAMRYK+ G DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRLVNKFLNGEVGPKTVHIPTGEKLSVYDAAMRYKNAGLDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAG+DAD+
Sbjct  869  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGQDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EIRPGQDVTV TDNGK+FTCT RFDT VEL YFNHGGILPY 
Sbjct  929  LGLTGHERYTIDLPSNISEIRPGQDVTVTTDNGKSFTCTARFDTAVELEYFNHGGILPYA  988

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  989  IRSLMKQ  995



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   349 bits (895),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKL++GEVGPKTVHIP+GEKL VFDAAMRYKS G+DT
Sbjct  809  SYGSRRGNDEIMARGTFANIRIVNKLMNGEVGPKTVHIPSGEKLSVFDAAMRYKSSGEDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  869  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP++I+EI P QDVTV TDNGK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  929  LGLTGHERYTIHLPTDISEISPCQDVTVTTDNGKSFTCTVRFDTEVELAYFNHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  989  IRNLSKQ  995



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   347 bits (890),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +T
Sbjct  712  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHET  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  772  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGL GHERY+I+LP+ ++EIRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGILPYV
Sbjct  832  LGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   347 bits (889),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKL++GEV PKTVHIP+GEKL VFDAAM+YKS G+ T
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKLVNGEVAPKTVHIPSGEKLSVFDAAMKYKSAGQST  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCVVRFDTEVELAYFNHGGILQYV  891

Query  543  IRQLSKQ  563
            IRQL+K 
Sbjct  892  IRQLTKH  898



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   348 bits (893),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVHIPTGEKLYVFDAA RY + G DT
Sbjct  810  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLYVFDAASRYMAAGHDT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK G+DAD+
Sbjct  870  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDADT  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGL+GHERY+IDLPSNI+EI+PGQDVTV TDNGK+FTCT RFDTEVEL YFNHGGILPYV
Sbjct  930  LGLSGHERYTIDLPSNISEIKPGQDVTVTTDNGKSFTCTARFDTEVELEYFNHGGILPYV  989

Query  543  IRQLSK  560
            IR L K
Sbjct  990  IRNLMK  995



>ref|XP_006828850.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 177/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRY ++G+DT
Sbjct  789  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYNTQGQDT  848

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  849  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADT  908

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS ++EIRPGQDVTV TD+GK+FTCT RFDTEVELAYF+HGGILPYV
Sbjct  909  LGLTGHERYTIDLPSTVSEIRPGQDVTVVTDSGKSFTCTARFDTEVELAYFDHGGILPYV  968

Query  543  IRQL  554
            IR L
Sbjct  969  IRNL  972



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   348 bits (893),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVH+P+GEKL VFDAAM+YKS G+ T
Sbjct  811  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHVPSGEKLSVFDAAMKYKSAGQST  870

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDAD+
Sbjct  871  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADT  930

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLP NI+EIRPGQDVTV+TD GK+FTC VRFDTEVELAYFNHGGIL YV
Sbjct  931  LGLTGQERYTIDLPENISEIRPGQDVTVQTDTGKSFTCIVRFDTEVELAYFNHGGILQYV  990

Query  543  IRQLSKQ  563
            IRQL+++
Sbjct  991  IRQLTQR  997



>gb|ADP03120.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03121.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03122.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03125.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03127.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03128.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03129.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03130.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03131.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03135.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03137.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03138.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03140.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03145.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03147.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03148.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03150.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DT
Sbjct  183  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDT  242

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNL GMGI+PLCFK+GEDA+S
Sbjct  243  IVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAES  302

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+ID+P++I++++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV
Sbjct  303  LGLTGHERYTIDIPNDISQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYV  362

Query  543  IRQL  554
            +RQL
Sbjct  363  MRQL  366



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   346 bits (887),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS ++EIRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>gb|ADP03151.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DT
Sbjct  183  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDT  242

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNL GMGI+PLCFK+GEDA+S
Sbjct  243  IVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAES  302

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV
Sbjct  303  LGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYV  362

Query  543  IRQL  554
            +RQL
Sbjct  363  MRQL  366



>gb|ADP03134.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03139.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DT
Sbjct  183  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDT  242

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNL GMGI+PLCFK+GEDA+S
Sbjct  243  IVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAES  302

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV
Sbjct  303  LGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYV  362

Query  543  IRQL  554
            +RQL
Sbjct  363  MRQL  366



>gb|ADP03123.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03124.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03126.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03132.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03133.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03136.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03141.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03142.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03146.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03149.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03152.1| aconitate hydratase, partial [Pinus sylvestris]
 gb|ADP03153.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   330 bits (847),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DT
Sbjct  183  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDT  242

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNL GMGI+PLCFK+GEDA+S
Sbjct  243  IVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAES  302

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV
Sbjct  303  LGLTGHERYTIDIPNDITQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYV  362

Query  543  IRQL  554
            +RQL
Sbjct  363  MRQL  366



>gb|KDO71349.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=565

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  377  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  436

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  437  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  496

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  497  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  556

Query  543  IRQL  554
            IR L
Sbjct  557  IRNL  560



>gb|ABK25210.1| unknown [Picea sitchensis]
Length=565

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAA+RYKS G+DT
Sbjct  377  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAIRYKSAGQDT  436

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNLVGMGI+PLCFK+GEDA+S
Sbjct  437  IVLAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAES  496

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNHGGILPYV
Sbjct  497  LGLTGHERYSIDLPNDIAQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHGGILPYV  556

Query  543  IRQL  554
            IRQL
Sbjct  557  IRQL  560



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKTVH+PTGEKL VFDAAM+YKS G  T
Sbjct  810  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTVHVPTGEKLSVFDAAMKYKSAGHGT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLL +KAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  870  IILAGAEYGSGSSRDWAAKGPMLLVIKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+SIDLPS I+EIRPGQDVTV TD+GK+FTCTVRFDTEVELAYF+HGGILP+V
Sbjct  930  LGLTGHERFSIDLPSKISEIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFDHGGILPFV  989

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  990  IRNLIKQ  996



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VF+AA +YKS G+DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRLVNKLLDGEVGPKTVHVPTGEKLSVFEAAEKYKSAGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDADS
Sbjct  772  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP +I++IRPGQDVTV TD+GK+FTCTVRFDTEVELAYFN+GGILPYV
Sbjct  832  LGLTGHERYTIDLPDDISKIRPGQDVTVTTDSGKSFTCTVRFDTEVELAYFNNGGILPYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G +T
Sbjct  816   SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHET  875

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  876   IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  935

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGL GHERY+I+LP+ ++EIRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGILPYV
Sbjct  936   LGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYV  995

Query  543   IRQLSKQ  563
             IR L KQ
Sbjct  996   IRNLIKQ  1002



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DT
Sbjct  499  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDT  558

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLC+KAGEDAD+
Sbjct  559  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADT  618

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYV
Sbjct  619  LGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYV  678

Query  543  IRQLSKQ  563
             R++++Q
Sbjct  679  ARKIAEQ  685



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+P+GEKL VFDAA +YKSEG DT
Sbjct  609  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPSGEKLSVFDAANKYKSEGHDT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  669  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS++NEIRPGQD+TV TDNGKTF+CT+RFDTEVELAYFNHGGIL Y 
Sbjct  729  LGLTGHERYTIDLPSSVNEIRPGQDITVVTDNGKTFSCTLRFDTEVELAYFNHGGILQYA  788

Query  543  IRQL  554
            IR L
Sbjct  789  IRNL  792



>gb|ADP03144.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL V+DAAMRYKS G DT
Sbjct  183  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVYDAAMRYKSAGHDT  242

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNL GMGI+PLCFK+GEDA+S
Sbjct  243  IVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAES  302

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+ID+P++I +++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV
Sbjct  303  LGLTGHERYTIDIPNDITKLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYV  362

Query  543  IRQL  554
            +RQL
Sbjct  363  MRQL  366



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   347 bits (890),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKT+ +PTGEKLYV+DAAMRYK+ G+DT
Sbjct  807  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTILVPTGEKLYVYDAAMRYKAAGQDT  866

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  867  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADS  926

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP+ I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYF+HGGILP+V
Sbjct  927  LGLTGHERYSIDLPNKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFDHGGILPFV  986

Query  543  IRQLSKQ  563
            IR L+++
Sbjct  987  IRNLNRE  993



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 178/189 (94%), Gaps = 2/189 (1%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAAIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS ++EIRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYV  891

Query  543  IRQL--SKQ  563
            IR L  SKQ
Sbjct  892  IRNLIGSKQ  900



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   347 bits (889),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR++NKLL+GEVGPKT+HIP+GEKL VFDAAM+YKS G+DT
Sbjct  810  SYGSRRGNDEIMARGTFANIRILNKLLNGEVGPKTIHIPSGEKLTVFDAAMKYKSAGQDT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFK+GEDAD+
Sbjct  870  IILAGDEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKSGEDADT  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS++++IRPGQD+TVKTD GK FTCTVRFDTEVELAYFNHGGIL YV
Sbjct  930  LGLTGHERYTIDLPSSVSDIRPGQDITVKTDTGKQFTCTVRFDTEVELAYFNHGGILQYV  989

Query  543  IRQLSKQ  563
            IRQL+ +
Sbjct  990  IRQLAAK  996



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   346 bits (888),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAMRYK+ G+ T
Sbjct  791  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMRYKAAGEAT  850

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  851  IILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADT  910

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+I LP++I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  911  LGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYV  970

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  971  IRNLSKQ  977



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   347 bits (890),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVH+PTGEKLYVFDAAM+YK  G  T
Sbjct  829   SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHVPTGEKLYVFDAAMKYKEAGHQT  888

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I+LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMG++PLCFKAGEDAD+
Sbjct  889   IVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGVIPLCFKAGEDADT  948

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+IDLPS ++EIRPGQD+TV TD GK+FTCT+RFDTEVELAYF+HGGILPYV
Sbjct  949   LGLTGHERYTIDLPSKVSEIRPGQDITVTTDTGKSFTCTLRFDTEVELAYFDHGGILPYV  1008

Query  543   IRQLSK  560
             IRQL K
Sbjct  1009  IRQLMK  1014



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   344 bits (883),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKTVHIP+GEKL VFDAAMRYKSEG DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKFLGGEVGPKTVHIPSGEKLSVFDAAMRYKSEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS++ EIRPGQDVTV TDNGK+FTCT+RFDTEVELAYF+HGGILP+V
Sbjct  832  FGLTGHERYNIDLPSSVAEIRPGQDVTVTTDNGKSFTCTLRFDTEVELAYFDHGGILPFV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   344 bits (883),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAAMRYK+ G DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAMRYKAAGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+ LCFK GEDAD+
Sbjct  772  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIILLCFKPGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGL GHERY+I+LP+ ++EIRPGQD+TV TD GK+FTCTVRFDTEVELAYF+HGGILPYV
Sbjct  832  LGLAGHERYTINLPNKVSEIRPGQDITVTTDTGKSFTCTVRFDTEVELAYFDHGGILPYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   346 bits (887),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAM+YK+ G+ T
Sbjct  795  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYKAAGEAT  854

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNLVGMGI+PLCFK+GEDADS
Sbjct  855  IILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADS  914

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+I LP++I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  915  LGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYV  974

Query  543  IRQLSKQ  563
            IR LSKQ
Sbjct  975  IRNLSKQ  981



>ref|XP_008344247.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=779

 Score =   341 bits (875),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DT
Sbjct  593  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDT  652

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  653  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADS  712

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+I+LPS ++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  713  LGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  772

Query  543  IRQLSK  560
            IR L K
Sbjct  773  IRNLIK  778



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   344 bits (882),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPS+++EIRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFICTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSK  560
            IR L K
Sbjct  892  IRNLIK  897



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   341 bits (875),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DT
Sbjct  609  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  669  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADS  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+I+LPS ++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  729  LGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  788

Query  543  IRQLSK  560
            IR L K
Sbjct  789  IRNLIK  794



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   344 bits (883),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 178/189 (94%), Gaps = 2/189 (1%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRYK+ G+DT
Sbjct  741  SYGSRRGNDEIMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVYDAAMRYKTAGQDT  800

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKA IAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  801  IILAGAEYGSGSSRDWAAKGPMLLGVKAAIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  860

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS ++EIRPGQDVTV TD+G++FTCTVRFDTEVELAYFNHGGIL YV
Sbjct  861  LGLTGHERYTIDLPSCVSEIRPGQDVTVATDSGRSFTCTVRFDTEVELAYFNHGGILQYV  920

Query  543  IRQL--SKQ  563
            IR L  SKQ
Sbjct  921  IRNLIGSKQ  929



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   346 bits (887),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYVFDAAMRYK+ G+DT
Sbjct  811  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKTAGQDT  870

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG EYGSGSSRDWAAKGPMLLGV+AVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  871  IVLAGTEYGSGSSRDWAAKGPMLLGVQAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  930

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS I+EIRPGQDVTV TD GK+FTCTVRFDTEVEL YFN+GGILPYV
Sbjct  931  LGLTGHERYTIDLPSKISEIRPGQDVTVVTDTGKSFTCTVRFDTEVELEYFNNGGILPYV  990

Query  543  IRQLSKQ  563
            IR L K 
Sbjct  991  IRNLMKH  997



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   345 bits (886),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+H+PTGEKL VFDAAM+YK+  + T
Sbjct  801  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHVPTGEKLSVFDAAMKYKTANQGT  860

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  861  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  920

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSNI+EIRPGQD+TV T+ GK+F CT RFDTEVELAYFNHGGILPYV
Sbjct  921  LGLTGHERYTIDLPSNIDEIRPGQDITVTTNTGKSFICTARFDTEVELAYFNHGGILPYV  980

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  981  IRNLIKQ  987



>gb|KGN48958.1| Aconitase [Cucumis sativus]
Length=881

 Score =   343 bits (880),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DT
Sbjct  693  SYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDT  752

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDADS
Sbjct  753  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADS  812

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER++IDLPSN+ EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YV
Sbjct  813  LGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYV  872

Query  543  IRQL  554
            IR L
Sbjct  873  IRNL  876



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   341 bits (875),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DT
Sbjct  609  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  669  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDADS  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+I+LPS ++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  729  LGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  788

Query  543  IRQLSK  560
            IR L K
Sbjct  789  IRNLIK  794



>ref|XP_004158846.1| PREDICTED: aconitate hydratase-like [Cucumis sativus]
Length=178

 Score =   321 bits (823),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = +3

Query  36   MARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSG  215
            MARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DTIILAGAEYGSG
Sbjct  1    MARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDTIILAGAEYGSG  60

Query  216  SSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSI  395
            SSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDADSLGLTGHER++I
Sbjct  61   SSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERFTI  120

Query  396  DLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  554
            DLPSN+ EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  121  DLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  173



>gb|ADP03143.1| aconitate hydratase, partial [Pinus sylvestris]
Length=371

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT++IPTGEKL V+DAAMRYKS G DT
Sbjct  183  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIYIPTGEKLSVYDAAMRYKSAGHDT  242

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG+EYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNL GMGI+PLCFK+GEDA+S
Sbjct  243  IVLAGSEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIIPLCFKSGEDAES  302

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+ID+P++I++++PGQD+TV TD GK+FTC  RFDT+VEL YFNH GILPYV
Sbjct  303  LGLTGHERYTIDIPNDISQLKPGQDITVTTDTGKSFTCVARFDTQVELEYFNHAGILPYV  362

Query  543  IRQL  554
            +RQL
Sbjct  363  MRQL  366



>ref|XP_004134842.1| PREDICTED: aconitate hydratase 1-like [Cucumis sativus]
Length=900

 Score =   343 bits (880),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDADS
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER++IDLPSN+ EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   345 bits (886),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYV+DAAMRYKS G+DT
Sbjct  824   SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVYDAAMRYKSSGQDT  883

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I+LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDA++
Sbjct  884   IVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGILPLCFKAGEDAET  943

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+IDLP   ++I+PGQD+TV TDNGK+FTCT+RFDTEVEL YF+HGGIL YV
Sbjct  944   LGLTGHERYTIDLPEKTSDIKPGQDITVTTDNGKSFTCTLRFDTEVELTYFDHGGILQYV  1003

Query  543   IRQLSKQ  563
             IR LSKQ
Sbjct  1004  IRNLSKQ  1010



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPSGEKLSVFDAAMRYKSEGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER++IDLPSN+ EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGHERFTIDLPSNVGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+I+LPS ++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGEERYTINLPSTVSEIRPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSK  560
            IR L K
Sbjct  892  IRNLIK  897



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+H+P+GEKL VFDAA +YKSEG DT
Sbjct  713  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHVPSGEKLSVFDAANKYKSEGHDT  772

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  773  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  832

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS++NEIRPGQD+TV TDNGKTF+CT+RFDTEVELAYFNHGGIL Y 
Sbjct  833  LGLTGHERYTIDLPSSVNEIRPGQDITVVTDNGKTFSCTLRFDTEVELAYFNHGGILQYA  892

Query  543  IRQL  554
            IR L
Sbjct  893  IRNL  896



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFD AMRYKSEG DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDVAMRYKSEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPS+++EIRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSK  560
            IR L K
Sbjct  892  IRNLIK  897



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   342 bits (878),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFD AMRYKSEG DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDVAMRYKSEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADS  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPS+++EIRPGQD+TV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGEERYTIDLPSSVSEIRPGQDITVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSK  560
            IR L K
Sbjct  892  IRNLIK  897



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   343 bits (881),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKTVHIPTGEKL VFDAAM+YK+ G+ T
Sbjct  794  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTVHIPTGEKLSVFDAAMKYKAAGEAT  853

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNLVGMGI+PLCFK+GEDA+S
Sbjct  854  IILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDAES  913

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+I LP++I+EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGILPYV
Sbjct  914  LGLTGKERYTIHLPTDISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELAYFNHGGILPYV  973

Query  543  IRQLSKQ  563
            IR LS+Q
Sbjct  974  IRNLSRQ  980



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   344 bits (882),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL GEVGPKTVHIPTG+KLYVF+ AMRYK++G DT
Sbjct  815  SYGSRRGNDEIMARGTFANIRLVNKLLKGEVGPKTVHIPTGDKLYVFEVAMRYKADGHDT  874

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  875  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  934

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS+I +IRPGQD+TV  DNGK+FTCT+RFDTEVELAYFNHGGILP+V
Sbjct  935  LGLTGHERYTIDLPSSITDIRPGQDITVVVDNGKSFTCTLRFDTEVELAYFNHGGILPFV  994

Query  543  IRQL  554
            IR L
Sbjct  995  IRNL  998



>gb|EMS48231.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=860

 Score =   341 bits (874),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGP+T+H+P+GEKL VFDAAM+YK+EG DT
Sbjct  673  SYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPQTIHVPSGEKLAVFDAAMKYKNEGHDT  732

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGIVPLCFKAGEDAD+
Sbjct  733  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIVPLCFKAGEDADT  792

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+++NEI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+ HGGILPYV
Sbjct  793  LGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYTHGGILPYV  852

Query  543  IRQLSKQ  563
            IR+++ +
Sbjct  853  IRKIAAE  859



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   337 bits (864),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  514  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  573

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  574  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  633

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  634  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  693

Query  543  IRQL  554
            IR L
Sbjct  694  IRNL  697



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   341 bits (875),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 163/189 (86%), Positives = 176/189 (93%), Gaps = 2/189 (1%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIPTGEKL V+D AMRYK+ G+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTIHIPTGEKLSVYDVAMRYKAAGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAG EYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  772  IILAGVEYGSGSSRDWAAKGPVLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ ++EIRPGQDVTV TD GK+FTCTVRFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGHERYTIDLPNTVSEIRPGQDVTVATDCGKSFTCTVRFDTEVELAYFNHGGILQYV  891

Query  543  IRQL--SKQ  563
            IR L  SKQ
Sbjct  892  IRNLIGSKQ  900



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   343 bits (881),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYV+DAAMRYKS G DT
Sbjct  825   SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYKSAGHDT  884

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I+LAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  885   IVLAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  944

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTG ERY+IDLP+  ++IRPGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  945   LGLTGQERYTIDLPTKKSDIRPGQDITVTTDNGKSFTCTLRFDTEVELAYFDHGGILQYV  1004

Query  543   IRQLSKQ  563
             IR LSKQ
Sbjct  1005  IRNLSKQ  1011



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   342 bits (878),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL+VFDAAMRYK  G++T
Sbjct  804  SYGSRRGNDEVMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLHVFDAAMRYKEAGENT  863

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHR NLVGMGI+PLCFK GEDAD+
Sbjct  864  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRGNLVGMGIIPLCFKPGEDADT  923

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP  I+EIRPGQ+V VKTD GK+F C VRFDTEVELAYF+HGGILPYV
Sbjct  924  LGLTGHERYTIDLPDKISEIRPGQEVGVKTDTGKSFACRVRFDTEVELAYFDHGGILPYV  983

Query  543  IRQLSKQ  563
            IR LSK+
Sbjct  984  IRNLSKE  990



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTLHIPSGEKLSVFDAAMRYKSEGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK G+DA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS+++EI+PGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y 
Sbjct  832  LGLTGHERYTIDLPSSVSEIKPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYA  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>gb|EMS45933.1| Putative aconitate hydratase, cytoplasmic [Triticum urartu]
Length=858

 Score =   340 bits (871),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA +YKSEG DT
Sbjct  670  SYGSRRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAATKYKSEGHDT  729

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  730  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADS  789

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP++++EIRPGQDVT+ TDN K+FTC +RFDTEVELAY+NHGGILPYV
Sbjct  790  LGLTGHERYTINLPTDVSEIRPGQDVTISTDNDKSFTCILRFDTEVELAYYNHGGILPYV  849

Query  543  IRQLS  557
            IR ++
Sbjct  850  IRNMA  854



>gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   340 bits (873),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFD AM+YKSEG DT
Sbjct  712  SYGSRRGNDEVMARGTFANIRIVNKLLGGEVGPKTIHIPSGEKLSVFDVAMKYKSEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYSIDLP++++EIRPGQDV V TDNGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGHERYSIDLPNSVSEIRPGQDVKVLTDNGKSFTCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+HIP+GEKL VFDAAMRYKSEG+DT
Sbjct  730  SYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTLHIPSGEKLSVFDAAMRYKSEGQDT  789

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK G+DA++
Sbjct  790  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGQDAET  849

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS+++EI+PGQD+TV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y 
Sbjct  850  LGLTGHERYTIDLPSSVSEIKPGQDITVVTDNGKSFTCTMRFDTEVELAYFDHGGILQYA  909

Query  543  IRQL  554
            IR L
Sbjct  910  IRNL  913



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+G+KL VFDAAM+YK+EG DT
Sbjct  803  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGDKLSVFDAAMKYKNEGHDT  862

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  863  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADT  922

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYV
Sbjct  923  LGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYV  982

Query  543  IRQLSKQ  563
            IR++++Q
Sbjct  983  IRKIAEQ  989



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIR++NKLL+GEVGPKT+HIP+GEKLYV+DAAMRYKS G  T
Sbjct  831   SYGSRRGNDEVMARGTFANIRIINKLLNGEVGPKTIHIPSGEKLYVYDAAMRYKSAGHGT  890

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GED ++
Sbjct  891   IVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDTET  950

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+IDLP +I++IRPGQD+TV TDNG++FTC +RFDTEVELAYF+HGGILPYV
Sbjct  951   LGLTGHERYTIDLPHSISDIRPGQDITVTTDNGRSFTCILRFDTEVELAYFDHGGILPYV  1010

Query  543   IRQLSKQ  563
             IR LSKQ
Sbjct  1011  IRNLSKQ  1017



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   342 bits (876),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DT
Sbjct  805  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDT  864

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  865  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADT  924

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY++HGGILPYV
Sbjct  925  LGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDHGGILPYV  984

Query  543  IRQLSKQ  563
             R++++Q
Sbjct  985  TRKIAEQ  991



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+M+RGTFANIR+VNKLL+GEVGPKTVHIPTGEKLYVFDAA RYK+ G  T
Sbjct  793  SYGSRRGNDEVMSRGTFANIRIVNKLLNGEVGPKTVHIPTGEKLYVFDAAERYKASGHAT  852

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  853  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKSGEDADT  912

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLP+ I+EI+PGQDVTV TD GK+FTCT RFDTEVEL YFNHGGILPYV
Sbjct  913  LGLTGHERYTIDLPNKISEIKPGQDVTVTTDTGKSFTCTARFDTEVELEYFNHGGILPYV  972

Query  543  IRQLSKQ  563
            IR L K+
Sbjct  973  IRNLIKK  979



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   343 bits (879),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGND++MARGTFANIR++NKLL+GEV PKT+HIPTGEKLYV+DAAMRYKS G DT
Sbjct  878   SYGSRRGNDQVMARGTFANIRIINKLLNGEVSPKTIHIPTGEKLYVYDAAMRYKSAGHDT  937

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             I++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  938   IVIAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAEA  997

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+IDLP  I++IRPGQD+TV TD+GK+FTCT+RFDTEVELAYF+HGGILPYV
Sbjct  998   LGLTGHERYTIDLPQRISDIRPGQDLTVTTDSGKSFTCTLRFDTEVELAYFDHGGILPYV  1057

Query  543   IRQLSK  560
             IR LSK
Sbjct  1058  IRNLSK  1063



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   337 bits (864),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  609  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  669  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  729  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  788

Query  543  IRQL  554
            IR L
Sbjct  789  IRNL  792



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   339 bits (870),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG  T
Sbjct  716  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHAT  775

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  776  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADT  835

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPS++ EI+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  836  LGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  895

Query  543  IRQLSK  560
            IR L K
Sbjct  896  IRNLIK  901



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   339 bits (870),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRYKSEG  T
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHAT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPS++ EI+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSK  560
            IR L K
Sbjct  892  IRNLIK  897



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   341 bits (874),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAA+RYKSEG DT
Sbjct  804  SYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAALRYKSEGHDT  863

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  864  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  923

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LPS++++I+PGQDVTV TDNGK+FTC VRFDTEVELAY+NHGGILP+V
Sbjct  924  LGLTGHERYTINLPSSVSDIKPGQDVTVVTDNGKSFTCIVRFDTEVELAYYNHGGILPFV  983

Query  543  IRQL  554
            IR L
Sbjct  984  IRNL  987



>gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   341 bits (875),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYVFDAAMRYK  G+DT
Sbjct  813  SYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVFDAAMRYKEAGQDT  872

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  873  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFETIHRSNLVGMGIIPLCFKPGEDADT  932

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG+ERY+IDLP  I+EIRPGQDVTV TDNG +FTC  RFDT+VELAYF+HGGIL YV
Sbjct  933  LGLTGNERYTIDLPDKISEIRPGQDVTVTTDNGNSFTCIARFDTQVELAYFDHGGILQYV  992

Query  543  IRQLSKQ  563
            IR L K+
Sbjct  993  IRNLIKE  999



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   341 bits (874),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDAAMRYKSE  DT
Sbjct  807  SYGSRRGNDEVMARGTFANIRLVNKLLKGEAGPKTIHIPSGEKLSVFDAAMRYKSEEHDT  866

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  867  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  926

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP N+++I+PGQDVTV TDNGK+FTCTVRFDTEVELAY+NHGGILP+V
Sbjct  927  LGLTGHERYTINLPDNVSDIKPGQDVTVVTDNGKSFTCTVRFDTEVELAYYNHGGILPFV  986

Query  543  IRQL  554
            IR L
Sbjct  987  IRNL  990



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   340 bits (873),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAAM+YK+EG DT
Sbjct  800  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLAVFDAAMKYKNEGHDT  859

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  860  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADT  919

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+N++EI+PGQDVTV TD GK+FTCT+RFDTEVELAY++HGGILPYV
Sbjct  920  LGLTGHERYTIHLPTNVSEIKPGQDVTVTTDTGKSFTCTLRFDTEVELAYYDHGGILPYV  979

Query  543  IRQLSKQ  563
             R++++Q
Sbjct  980  TRKIAEQ  986



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   339 bits (870),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA +YKSEG DT
Sbjct  749  SYGSRRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAATKYKSEGHDT  808

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFKAGEDADS
Sbjct  809  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDADS  868

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP++++EIRPGQDVT+ TDN K+FTC +RFDTEVELAY+NHGGILPYV
Sbjct  869  LGLTGHERYTINLPTDVSEIRPGQDVTITTDNDKSFTCILRFDTEVELAYYNHGGILPYV  928

Query  543  IRQLS  557
            IR ++
Sbjct  929  IRNMA  933



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   336 bits (862),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DT
Sbjct  609  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFKAGEDA++
Sbjct  669  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDAET  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  729  LGLTGQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYV  788

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  789  IRNLIKQ  795



>gb|KHG24816.1| Aconitate hydratase 1 -like protein [Gossypium arboreum]
Length=813

 Score =   337 bits (863),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 176/189 (93%), Gaps = 2/189 (1%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKL V+DAAMRY + G+DT
Sbjct  625  SYGSRRGNDEVMARGTFANIRLVNKLLEGEVGPKTIHIPTGEKLSVYDAAMRYNTAGQDT  684

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPM+LG+KAVIAKSFE IHRSNLVGMGI+PLCFK G+DAD+
Sbjct  685  IILAGAEYGSGSSRDWAAKGPMMLGIKAVIAKSFEQIHRSNLVGMGIIPLCFKPGDDADT  744

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP++++EIRPGQDVTV TD  K+F+CTVRFDTEVELAYFNHGGIL YV
Sbjct  745  LGLTGHERYTINLPNSVSEIRPGQDVTVATDTSKSFSCTVRFDTEVELAYFNHGGILQYV  804

Query  543  IRQL--SKQ  563
            IR L  SKQ
Sbjct  805  IRNLVGSKQ  813



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+H+P+GEKL VFDAA RYKSEG DT
Sbjct  799  SYGSRRGNDEIMARGTFANIRIVNKFLGGEVGPKTIHVPSGEKLSVFDAATRYKSEGHDT  858

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLC+K GEDADS
Sbjct  859  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCYKTGEDADS  918

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER++I+LP+++++IRPGQDVT+ TDNGK+F+CT+RFDTEVELAY+NHGGILPYV
Sbjct  919  LGLTGHERFTINLPTDVSKIRPGQDVTITTDNGKSFSCTLRFDTEVELAYYNHGGILPYV  978

Query  543  IRQLSKQ  563
            IR L+ Q
Sbjct  979  IRSLAGQ  985



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   338 bits (867),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HI TGEKL VFD AMRYKSEG+DT
Sbjct  711  SYGSRRGNDEVMARGTFANIRLVNKLLGGEVGPKTIHISTGEKLSVFDVAMRYKSEGRDT  770

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  771  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  830

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHE YSIDLPSN++EIRPGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL Y 
Sbjct  831  LGLTGHECYSIDLPSNVSEIRPGQDVTVVTDNGKSFACTLRFDTEVELAYFDHGGILQYA  890

Query  543  IRQL  554
            IR L
Sbjct  891  IRNL  894



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HI TGEKL VFDAAMR KSEG+DT
Sbjct  711  SYGSRRGNDEVMARGTFANIRLVNKLLGGEVGPKTIHISTGEKLSVFDAAMRCKSEGRDT  770

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  771  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  830

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHE YSIDLPSN++EIRPGQDVTV TDNGK+FTCT+RFDTEVELAYF+HGGIL Y 
Sbjct  831  LGLTGHECYSIDLPSNVSEIRPGQDVTVVTDNGKSFTCTLRFDTEVELAYFDHGGILQYA  890

Query  543  IRQL  554
            IR L
Sbjct  891  IRNL  894



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   338 bits (866),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTGEKL VFDAAMRY+SEG  T
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGEKLSVFDAAMRYRSEGHAT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKTGEDADT  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPS++ EI+PGQDVTV TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGEERYTIDLPSSVGEIKPGQDVTVVTDNGKSFVCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSK  560
            IR L K
Sbjct  892  IRNLIK  897



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L GEVGPKT+HIPTGEKL VFDAA+RYKSEG DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRIVNKFLKGEVGPKTIHIPTGEKLSVFDAAVRYKSEGHDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  869  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LPS++++I+PGQDVTV TDNGK+FTC VRFDTEVELAY+NHGGILP+V
Sbjct  929  LGLTGHERYTINLPSSVSDIKPGQDVTVVTDNGKSFTCIVRFDTEVELAYYNHGGILPFV  988

Query  543  IRQL  554
            IR L
Sbjct  989  IRNL  992



>gb|KDO71344.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=881

 Score =   337 bits (864),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  693  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  752

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  753  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  812

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  813  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  872

Query  543  IRQL  554
            IR L
Sbjct  873  IRNL  876



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  832  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  710  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  769

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  770  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  829

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  830  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  889

Query  543  IRQL  554
            IR L
Sbjct  890  IRNL  893



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  832  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   337 bits (864),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  701  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  760

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  761  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  820

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  821  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  880

Query  543  IRQL  554
            IR L
Sbjct  881  IRNL  884



>gb|ACK56134.1| putative aconitase, partial [Dimocarpus longan]
Length=167

 Score =   315 bits (806),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = +3

Query  9    GSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTII  188
            GSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYKSEG +TII
Sbjct  1    GSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKSEGHNTII  60

Query  189  LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADSLG  368
            LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGIVPLCFK GEDA++L 
Sbjct  61   LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKPGEDAETLS  120

Query  369  LTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELA  509
            LTGHERY+IDLPS+++EIRPGQDV+V TDNGK+FTCTVRFDTEVELA
Sbjct  121  LTGHERYTIDLPSSVSEIRPGQDVSVVTDNGKSFTCTVRFDTEVELA  167



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLPS+++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  832  HGLTGHERYTIDLPSSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DT
Sbjct  812  SYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDT  871

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVI+KSFE IHRSNL GMGIVPLCFKAGEDAD+
Sbjct  872  IILAGAEYGSGSSRDWAAKGPMLQGVKAVISKSFERIHRSNLAGMGIVPLCFKAGEDADT  931

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+++NEI+PGQDVTV TDNGK+FTCT+RFDTEVE+AY+ HGGILPYV
Sbjct  932  LGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVEIAYYTHGGILPYV  991

Query  543  IRQLSKQ  563
            IR+++ +
Sbjct  992  IRKIAAE  998



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   339 bits (869),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIP+GEKL VFD AMRYK EG DT
Sbjct  789  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPSGEKLSVFDTAMRYKDEGHDT  848

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGIVPLCFK GEDAD+
Sbjct  849  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIVPLCFKPGEDADT  908

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LPSN+++I+PGQDVTV TD GK FTCTVRFDTEVELAY+ HGGILPYV
Sbjct  909  LGLTGHERYTINLPSNVSDIKPGQDVTVTTDTGKLFTCTVRFDTEVELAYYGHGGILPYV  968

Query  543  IRQL  554
            +R L
Sbjct  969  VRSL  972



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L GEVGPKT+H+PTGEKL VFDAA++YKSEG DT
Sbjct  796  SYGSRRGNDEVMARGTFANIRIVNKFLGGEVGPKTIHVPTGEKLSVFDAALKYKSEGHDT  855

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+P+CFKAGEDADS
Sbjct  856  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPMCFKAGEDADS  915

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP+++ +IRPGQDVT+ T++GK+FTC +RFDTEVELAY+NHGGILPYV
Sbjct  916  LGLTGHERYTINLPTDVGQIRPGQDVTITTEDGKSFTCILRFDTEVELAYYNHGGILPYV  975

Query  543  IRQLS  557
            IR ++
Sbjct  976  IRNMA  980



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+IDLP+N++EI+PGQD+TV T+NGK+FTCT+RFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGQELYTIDLPNNVSEIKPGQDITVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFKAGEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKAGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGQELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNKLL+GEVGPKT+HIPTGEKL VFDAAMRYK+EG DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKLLNGEVGPKTIHIPTGEKLSVFDAAMRYKNEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             GLTGHERY+IDLP++++EIRPGQDV V TD+GK+FTC +RFDTEVELAYF+HGGIL YV
Sbjct  832  HGLTGHERYTIDLPNSVSEIRPGQDVRVVTDSGKSFTCVIRFDTEVELAYFDHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   334 bits (856),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+ G+DT
Sbjct  609  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDA++
Sbjct  669  IILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAET  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  729  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYV  788

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  789  IRSLSTK  795



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   335 bits (860),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK+EG DT
Sbjct  721  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDT  780

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFK+GEDAD+
Sbjct  781  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADT  840

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGILPYV
Sbjct  841  LGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYV  900

Query  543  IRQLSKQ  563
            IR++++Q
Sbjct  901  IRKIAEQ  907



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 175/184 (95%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIPTG+KLYVF+AAMRYK++G DT
Sbjct  805  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPTGDKLYVFEAAMRYKADGYDT  864

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  865  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDAET  924

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG+E Y+IDLPS I++IRPGQD+TV TD+GK+FTCT+RFDTEVELAYFNHGGILP+V
Sbjct  925  LGLTGYESYTIDLPSCISDIRPGQDITVVTDSGKSFTCTLRFDTEVELAYFNHGGILPFV  984

Query  543  IRQL  554
            IR L
Sbjct  985  IRNL  988



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   333 bits (853),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYKSEG  T
Sbjct  609  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHAT  668

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDA++
Sbjct  669  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAET  728

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP++++EIRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y 
Sbjct  729  LGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYA  788

Query  543  IRQL  554
            IR L
Sbjct  789  IRNL  792



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   337 bits (864),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+ G+DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDA+S
Sbjct  869  IILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAES  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ ++EIRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  929  LGLTGHERYTVHLPTKVSEIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  989  IRSLSTK  995



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAA++Y++EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAALKYRNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGQELYTIELPNNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT
Sbjct  715  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDT  774

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  775  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  834

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YV
Sbjct  835  LGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYV  894

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  895  IRNLIKQ  901



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFNHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   337 bits (863),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+M+RGTFANIRLVNKLL+GEVG KTVH+PTGEKLYVFDAA RYK+ G DT
Sbjct  799  SYGSRRGNDEVMSRGTFANIRLVNKLLNGEVGAKTVHVPTGEKLYVFDAAERYKAAGHDT  858

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDAD+
Sbjct  859  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADT  918

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLP  I+EI+PGQDVTV TD GK+FTC  RFDTEVEL YFNHGGILPYV
Sbjct  919  LGLTGRERYTIDLPDKISEIKPGQDVTVTTDTGKSFTCKARFDTEVELEYFNHGGILPYV  978

Query  543  IRQLSK  560
            IR L+K
Sbjct  979  IRNLAK  984



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   336 bits (862),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNK L GEVGPKT+H+P+GEKL  FDAA RYKSEG DT
Sbjct  798  SYGSRRGNDEVMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLSAFDAATRYKSEGHDT  857

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG EYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDA++
Sbjct  858  IVLAGEEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAET  917

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LPSN+++I+PGQDVTV TD GK+FTCTVRFDTEVELAY+NHGGILPYV
Sbjct  918  LGLTGHERYTIHLPSNVSDIKPGQDVTVTTDTGKSFTCTVRFDTEVELAYYNHGGILPYV  977

Query  543  IRQLSK  560
            IR L K
Sbjct  978  IRSLIK  983



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGND++MARGTFANIR+VNKLL GEVGPKT+H PT EKL VFD AMRYKSEG DT
Sbjct  711  SYGSRRGNDDVMARGTFANIRIVNKLLGGEVGPKTIHFPTREKLSVFDVAMRYKSEGHDT  770

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFE IHRSNLVGMGI+PLCFK+GEDA++
Sbjct  771  VILAGAEYGSGSSRDWAAKGPMLLGVKAVMAKSFERIHRSNLVGMGIIPLCFKSGEDAET  830

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERYS+DLPSN++EIRPGQDVTV TDNGK FTCT+R+DTEVELAYF+HGGIL Y 
Sbjct  831  LGLTGHERYSLDLPSNVSEIRPGQDVTVVTDNGKQFTCTLRYDTEVELAYFDHGGILQYA  890

Query  543  IRQL  554
            IR L
Sbjct  891  IRNL  894



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   335 bits (858),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK+EG DT
Sbjct  720  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDT  779

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFK+GEDAD+
Sbjct  780  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADT  839

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+++ LP+N+++I+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGILPYV
Sbjct  840  LGLTGHERFTVHLPANVSDIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYV  899

Query  543  IRQLSKQ  563
            IR++++Q
Sbjct  900  IRKIAEQ  906



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   334 bits (857),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFDAA +YKSEG D 
Sbjct  713  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYKSEGHDM  772

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK G+DADS
Sbjct  773  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGDDADS  832

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPSN+NEIRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGIL YV
Sbjct  833  LGLTGHERYTIDLPSNVNEIRPGQDVTVVTDAGKSFVSTLRFDTEVELAYFNHGGILQYV  892

Query  543  IRQL  554
            IR +
Sbjct  893  IRNM  896



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   334 bits (857),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFDAA +YK+EG D 
Sbjct  713  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYKNEGHDM  772

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDADS
Sbjct  773  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADS  832

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS++NEIRPGQDVTV TD GKTF  T+RFDTEVELAYFNHGGIL Y 
Sbjct  833  LGLTGHERYTIDLPSDVNEIRPGQDVTVVTDTGKTFVSTLRFDTEVELAYFNHGGILQYA  892

Query  543  IRQL  554
            IR L
Sbjct  893  IRNL  896



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   336 bits (861),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK+EG DT
Sbjct  800  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDT  859

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFK+GEDAD+
Sbjct  860  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADT  919

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGILPYV
Sbjct  920  LGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYV  979

Query  543  IRQLSKQ  563
            IR++++Q
Sbjct  980  IRKIAEQ  986



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   336 bits (861),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 177/187 (95%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAA +YK+EG DT
Sbjct  800  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVFDAATKYKNEGHDT  859

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFK+GEDAD+
Sbjct  860  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDADT  919

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER+++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+++GGILPYV
Sbjct  920  LGLTGHERFTVHLPANVSEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYDNGGILPYV  979

Query  543  IRQLSKQ  563
            IR++++Q
Sbjct  980  IRKIAEQ  986



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   336 bits (861),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GE GPKT+HIP+GEKL VFDA MRYKSEG DT
Sbjct  810  SYGSRRGNDEVMARGTFANIRLVNKLLKGEPGPKTIHIPSGEKLSVFDATMRYKSEGHDT  869

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAV+AKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  870  VILAGAEYGSGSSRDWAAKGPMLLGVKAVVAKSFERIHRSNLVGMGIIPLCFKPGEDAET  929

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP+++++I+PGQDVTV TDNGK F CTVRFDTEVELAY+NHGGILP+V
Sbjct  930  LGLTGHERYTINLPNSVSDIKPGQDVTVVTDNGKQFACTVRFDTEVELAYYNHGGILPFV  989

Query  543  IRQL  554
            IR L
Sbjct  990  IRNL  993



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   334 bits (856),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+YK+EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYKNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            L LTG E Y+I+LPSN++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YV
Sbjct  832  LRLTGEELYTIELPSNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   335 bits (860),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKL+ GEVGPKTVHIPTGEKL VFDAA RYK+ G+DT
Sbjct  813  SYGSRRGNDEVMARGTFANIRIVNKLVDGEVGPKTVHIPTGEKLSVFDAASRYKTAGQDT  872

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  873  VILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADT  932

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  933  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYV  992

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  993  IRSLSTK  999



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   335 bits (860),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK++G+DT
Sbjct  811  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTDGQDT  870

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDA++
Sbjct  871  IILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAET  930

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  931  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYV  990

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  991  IRSLSTK  997



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   335 bits (858),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+M RGTFANIR+VNKLL+GEVGPKT+HIPTGEKLYV+DAAMRYKSEG DT
Sbjct  794  SYGSRRGNDEVMTRGTFANIRIVNKLLNGEVGPKTIHIPTGEKLYVYDAAMRYKSEGHDT  853

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I++AGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMG++PL FK GEDA++
Sbjct  854  IVVAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGLIPLSFKHGEDAET  913

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHE Y+IDLP  I++IRPGQDV V TD+GK+F CT+RFDTEVEL YF HGGILPYV
Sbjct  914  LGLTGHECYTIDLPQKISDIRPGQDVAVTTDSGKSFICTLRFDTEVELTYFEHGGILPYV  973

Query  543  IRQLSKQ  563
            IR L+KQ
Sbjct  974  IRNLTKQ  980



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+ G+DT
Sbjct  812  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTAGQDT  871

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDA++
Sbjct  872  IILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAET  931

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  932  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYV  991

Query  543  IRQLS  557
            IR LS
Sbjct  992  IRSLS  996



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   333 bits (855),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+YK+EG+DT
Sbjct  736  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYKNEGRDT  795

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  796  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  855

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            L LTG E Y+I+LPSN++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYFNHGGIL YV
Sbjct  856  LRLTGEELYTIELPSNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFNHGGILQYV  915

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  916  IRNLIKQ  922



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYKSEG  T
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHAT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP++++EIRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y 
Sbjct  832  LGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYA  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL VFDAAM+YK+EG DT
Sbjct  807  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLAVFDAAMKYKNEGHDT  866

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  867  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADT  926

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER++I LP+N+++I+PGQDVTV TD GK+FTCT+RFDTEVELAY+ +GGILPYV
Sbjct  927  LGLTGHERFTIQLPTNVSDIKPGQDVTVTTDAGKSFTCTLRFDTEVELAYYTNGGILPYV  986

Query  543  IRQLSKQ  563
            IR+++ +
Sbjct  987  IRKIAAE  993



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+HIP+GEKL V+D AMRYKSEG  T
Sbjct  710  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHIPSGEKLSVYDVAMRYKSEGHAT  769

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDA++
Sbjct  770  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAET  829

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I+LP++++EIRPGQD+TV+TDNGK+F CT+RFDTEVELAYF+HGGIL Y 
Sbjct  830  LGLTGHERYTINLPNSVSEIRPGQDITVETDNGKSFVCTLRFDTEVELAYFDHGGILQYA  889

Query  543  IRQL  554
            IR L
Sbjct  890  IRNL  893



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFD A +YKSEG D 
Sbjct  713  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDVAEKYKSEGHDM  772

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  773  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADS  832

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPSN+NEIRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGIL YV
Sbjct  833  LGLTGQERYTIDLPSNVNEIRPGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYV  892

Query  543  IRQL  554
            IR L
Sbjct  893  IRNL  896



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVEL YFNHGGIL YV
Sbjct  832  LGLTGQELYTIELPNNVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELEYFNHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT
Sbjct  739  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDT  798

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  799  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  858

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+N++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  859  LGLTGEELYTIELPNNVSEIKPGQDVTVVTNNGKSFTCTLRFDTEVELAYFDHGGILQYV  918

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  919  IRNLIKQ  925



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   342 bits (876),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 176/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDEIMARGTFANIR+VNK L GEVGP+T+H+P+GEKL VFDAAM+YK+EG DT
Sbjct  1780  SYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPQTIHVPSGEKLAVFDAAMKYKNEGHDT  1839

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGIVPLCFKAGEDAD+
Sbjct  1840  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIVPLCFKAGEDADT  1899

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTGHERY+I LP+++NEI+PGQDVTV TDNGK+FTCT+RFDTEVELAY+ HGGILPYV
Sbjct  1900  LGLTGHERYTIQLPTDVNEIKPGQDVTVTTDNGKSFTCTLRFDTEVELAYYTHGGILPYV  1959

Query  543   IRQLSKQ  563
             IR+++ +
Sbjct  1960  IRKIAAE  1966



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   333 bits (855),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 177/203 (87%), Gaps = 17/203 (8%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAM---------  155
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+HIPTGEKL VFD AM         
Sbjct  772  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHIPTGEKLSVFDTAMVDCISIDCL  831

Query  156  --------RYKSEGKDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLV  311
                    RYKSEG DTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLV
Sbjct  832  KLYVWLLQRYKSEGHDTIILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLV  891

Query  312  GMGIVPLCFKAGEDADSLGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFD  491
            GMG++PLCFK GEDA++LGLTGHERY+IDLPS+++EI+PGQDVT+ TD+GK+FTCT+RFD
Sbjct  892  GMGVIPLCFKPGEDAETLGLTGHERYTIDLPSSVSEIKPGQDVTMVTDDGKSFTCTLRFD  951

Query  492  TEVELAYFNHGGILPYVIRQLSK  560
            TEVELAYF+HGGILPYVIR L K
Sbjct  952  TEVELAYFDHGGILPYVIRNLIK  974



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   333 bits (855),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA RY + G+DT
Sbjct  813  SYGSRRGNDEIMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASRYMNAGQDT  872

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGP+LLGVKAVI+KSFE IHRSNL GMGI+PLCFKAGEDA++
Sbjct  873  VILAGAEYGSGSSRDWAAKGPLLLGVKAVISKSFERIHRSNLAGMGIIPLCFKAGEDAET  932

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ ++EIRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  933  LGLTGHERYTVHLPTKVSEIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYV  992

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  993  IRSLSTK  999



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   332 bits (850),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFDAA +YKSEG D 
Sbjct  713  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDAAEKYKSEGHDM  772

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK G+DADS
Sbjct  773  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGDDADS  832

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPSN+NEIRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGIL YV
Sbjct  833  LGLTGQERYTIDLPSNVNEIRPGQDVTVVTDAGKSFVSTLRFDTEVELAYFNHGGILQYV  892

Query  543  IRQL  554
            IR +
Sbjct  893  IRNM  896



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   332 bits (850),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIPTGEKL VFDAAM+Y++EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPTGEKLSVFDAAMKYRNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+ ++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   333 bits (854),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY + G+DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  869  VILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  929  LGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  989  IRSLSAK  995



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   333 bits (853),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY + G+DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  869  VILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  929  LGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  989  IRSLSAK  995



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   331 bits (848),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK ++GEVGPKT+HIP+GEKL VFDAA +YK+EG D 
Sbjct  713  SYGSRRGNDEVMARGTFANIRIVNKFMNGEVGPKTIHIPSGEKLSVFDAATKYKTEGHDM  772

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP LLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  773  IILAGAEYGSGSSRDWAAKGPKLLGVKAVISKSFERIHRSNLVGMGIIPLCFKDGEDAET  832

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHER++IDLPSN+NEIRPGQD+ V TDNGKTF CT+RFDTEVELAYFNHGGIL Y 
Sbjct  833  LGLTGHERFTIDLPSNVNEIRPGQDIAVVTDNGKTFLCTLRFDTEVELAYFNHGGILQYA  892

Query  543  IRQL  554
            IR L
Sbjct  893  IRNL  896



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   331 bits (848),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT
Sbjct  719  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDT  778

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  779  IILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  838

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+N++EI+PGQDVTV T+NGK+FT T+RFDTEVELAYFNHGGIL YV
Sbjct  839  LGLTGEELYTIELPNNVSEIKPGQDVTVITNNGKSFTSTLRFDTEVELAYFNHGGILQYV  898

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  899  IRNLIKQ  905



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   331 bits (848),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNK L+GEVGPKT+HIP+GEKL VFD A +YKSEG D 
Sbjct  720  SYGSRRGNDEVMARGTFANIRIVNKFLNGEVGPKTIHIPSGEKLSVFDVAEKYKSEGHDM  779

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAK FE IHRSNLVGMGI+PLCFK GEDADS
Sbjct  780  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKGFERIHRSNLVGMGIIPLCFKPGEDADS  839

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPSN+NEIRPGQDVTV TD GK+F  T+RFDTEVELAYFNHGGIL YV
Sbjct  840  LGLTGQERYTIDLPSNVNEIRPGQDVTVVTDTGKSFVSTLRFDTEVELAYFNHGGILQYV  899

Query  543  IRQL  554
            IR L
Sbjct  900  IRNL  903



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   330 bits (847),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNKLL GEVGPKT+H+P+GE L VFD AM+Y S+G+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKLLGGEVGPKTIHVPSGETLSVFDVAMKYNSDGQDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGP LLGVKAVIAKSFE IHRSNLVGMGIVPLCFKAGEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKAGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHE+Y+I+LPSN+ EI+PGQDVTV T+NGK+F+CT+RFDTEVELAYFNHGGIL YV
Sbjct  832  LGLTGHEQYNIELPSNVGEIKPGQDVTVVTNNGKSFSCTLRFDTEVELAYFNHGGILQYV  891

Query  543  IRQL  554
            IR L
Sbjct  892  IRNL  895



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   330 bits (846),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H PTG+K+ VFDAAM+YKSEG DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHHPTGDKVSVFDAAMKYKSEGHDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP LLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDA++
Sbjct  772  IILAGAEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+IDLPS ++EI+PGQD+TV T NGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGEERYTIDLPSTVSEIKPGQDITVVTSNGKSFVCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSK  560
            IR L K
Sbjct  892  IRNLIK  897



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   330 bits (846),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+ ++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   330 bits (846),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKTVHIP+GEKL VFDAAM+Y++EG+DT
Sbjct  712  SYGSRRGNDEIMARGTFANIRIVNKHLKGEVGPKTVHIPSGEKLSVFDAAMKYRNEGRDT  771

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGPMLLGVKAVI+KSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  772  VILAGAEYGSGSSRDWAAKGPMLLGVKAVISKSFERIHRSNLVGMGIIPLCFKTGEDAET  831

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E Y+I+LP+ ++EI+PGQDVTV T+NGK+FTCT+RFDTEVELAYF+HGGIL YV
Sbjct  832  LGLTGQELYTIELPNKVSEIKPGQDVTVITNNGKSFTCTLRFDTEVELAYFDHGGILQYV  891

Query  543  IRQLSKQ  563
            IR L KQ
Sbjct  892  IRNLIKQ  898



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKTVH+PTGEKL VFDAA RY + G+DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTVHVPTGEKLSVFDAASRYMNAGQDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGP+LLGVKAVI+KSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  869  VILAGAEYGSGSSRDWAAKGPLLLGVKAVISKSFERIHRSNLAGMGIIPLCFKAGEDADT  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++I+PGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  929  LGLTGHERYTVHLPTKVSDIKPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  989  IRSLSAK  995



>emb|CAB36543.1| putative aconitase [Arabidopsis thaliana]
 emb|CAB79552.1| putative aconitase [Arabidopsis thaliana]
Length=907

 Score =   329 bits (844),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+  +DT
Sbjct  721  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDT  780

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDA++
Sbjct  781  IILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAET  840

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  841  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYV  900

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  901  IRSLSAK  907



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   331 bits (848),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKTVHIPTGEKL VFDAA +YK+  +DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPKTVHIPTGEKLSVFDAASKYKTAEQDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFK+GEDA++
Sbjct  869  IILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKSGEDAET  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  929  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  989  IRSLSAK  995



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   330 bits (845),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFA+IR+VNKL  GEVGPKTVHIPTGEKL VFDAA RYK+ G+DT
Sbjct  776  SYGSRRGNDEVMARGTFASIRIVNKLADGEVGPKTVHIPTGEKLTVFDAASRYKTAGQDT  835

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +ILAGAEYGSGSSRDWAAKGP+LLGVKAV AKSFE IHRSNL GMGI+PLCFKAGEDAD+
Sbjct  836  VILAGAEYGSGSSRDWAAKGPLLLGVKAVTAKSFERIHRSNLAGMGIIPLCFKAGEDADT  895

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  896  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDTGKSFVCTLRFDTEVELAYYDHGGILPYV  955

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  956  IRSLSTK  962



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   330 bits (845),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+  +DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSFE IHRSNL GMGI+PLCFKAGEDA++
Sbjct  869  IILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFERIHRSNLAGMGIIPLCFKAGEDAET  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  929  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  989  IRSLSAK  995



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   325 bits (832),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGP+T+HIPTG+KL VFDAA +YKSEG+DT
Sbjct  714  SYGSRRGNDEVMARGTFANIRLVNKLLRGEVGPETIHIPTGQKLSVFDAATKYKSEGQDT  773

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAG+EYGSGSSRDWAAKGP LLGVKAVIAKSFE IHRSNLVGMGIVPLCFK GEDA++
Sbjct  774  IILAGSEYGSGSSRDWAAKGPKLLGVKAVIAKSFERIHRSNLVGMGIVPLCFKVGEDAET  833

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG E+Y+++LP+ INEI+PGQDV V TD+GK+F CT+RFDTEVELAYFNHGGIL YV
Sbjct  834  LGLTGFEQYNVELPNEINEIKPGQDVKVITDDGKSFVCTLRFDTEVELAYFNHGGILQYV  893

Query  543  IRQL  554
            IR L
Sbjct  894  IRNL  897



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   327 bits (837),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGP TVHIPTGEKL VFDAA +YK+  +DT
Sbjct  809  SYGSRRGNDEVMARGTFANIRIVNKLLKGEVGPNTVHIPTGEKLSVFDAASKYKTAEQDT  868

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP+LLGVKAVIAKSF  IHRSNL GMGI+PLCFKAGEDA++
Sbjct  869  IILAGAEYGSGSSRDWAAKGPLLLGVKAVIAKSFGRIHRSNLAGMGIIPLCFKAGEDAET  928

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY++ LP+ +++IRPGQDVTV TD+GK+F CT+RFDTEVELAY++HGGILPYV
Sbjct  929  LGLTGHERYTVHLPTKVSDIRPGQDVTVTTDSGKSFVCTLRFDTEVELAYYDHGGILPYV  988

Query  543  IRQLSKQ  563
            IR LS +
Sbjct  989  IRSLSAK  995



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   325 bits (833),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 1/186 (1%)
 Frame = +3

Query  3     SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
             SYGSRRGNDE+MARGTFANIRL+NK L+ +  PKT+HIPTGE+LYV+DAAMRYKS G+DT
Sbjct  825   SYGSRRGNDEVMARGTFANIRLLNKFLNKQ-APKTIHIPTGEELYVYDAAMRYKSAGQDT  883

Query  183   IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
             IILAG EYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  884   IILAGTEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  943

Query  363   LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
             LGLTG+ERYSIDLP  ++++RPGQD+TV TD+GK+FTC VRFDT+VEL YF+HGGILPYV
Sbjct  944   LGLTGYERYSIDLPKKVSDVRPGQDITVTTDDGKSFTCVVRFDTQVELTYFDHGGILPYV  1003

Query  543   IRQLSK  560
             IR L+K
Sbjct  1004  IRNLAK  1009



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MA+G FA+IR+VNK+L GEVGPKT+HIPTG+KL V+DAA RYK+ G+DT
Sbjct  697  SYGSRRGNDEVMAKGAFADIRIVNKILKGEVGPKTIHIPTGDKLNVYDAATRYKATGQDT  756

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAG +YGSGSSRDWAAKG MLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD 
Sbjct  757  IILAGEDYGSGSSRDWAAKGSMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADF  816

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+IDLPS I EIRPGQDVT+ TD GK+FTCT  FDT+VEL YF+HGGILPYV
Sbjct  817  LGLTGHERYTIDLPSKIKEIRPGQDVTITTDTGKSFTCTAWFDTKVELEYFDHGGILPYV  876

Query  543  IRQLSK  560
            IR L+K
Sbjct  877  IRNLNK  882



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   323 bits (827),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VN+LL+GEVGPKT+H+PT +KL+VFDAAMRYK++G  T
Sbjct  789  SYGSRRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTSDKLFVFDAAMRYKADGHHT  848

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMG++PLCFK GEDADS
Sbjct  849  IVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADS  908

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+N++EI+PGQDV V TD GK+FTC +R DT VELAYF+HGGIL YV
Sbjct  909  LGLTGHERYTIRLPTNVSEIQPGQDVQVVTDTGKSFTCKLRIDTLVELAYFDHGGILHYV  968

Query  543  IRQLSKQ*ATQ  575
            +R L KQ   Q
Sbjct  969  LRNLVKQQQQQ  979



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   322 bits (826),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VN+LL+GEVGPKT+H+PT EKL+VFDAAMRYK++G  T
Sbjct  791  SYGSRRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTNEKLFVFDAAMRYKADGHHT  850

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMG++PLCFK GEDADS
Sbjct  851  IVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADS  910

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+N++EI+PGQDV V +D GK+FTC +R DT VELAYF+HGGIL YV
Sbjct  911  LGLTGHERYTIRLPTNVSEIQPGQDVQVLSDTGKSFTCKLRIDTMVELAYFDHGGILHYV  970

Query  543  IRQLSKQ  563
            +R L +Q
Sbjct  971  LRNLVRQ  977



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   322 bits (825),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VN+LL+GEVGPKT+H+PT EKL+VFDAAMRYK++G  T
Sbjct  793  SYGSRRGNDEVMARGTFANIRIVNRLLNGEVGPKTIHVPTNEKLFVFDAAMRYKADGHHT  852

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG EYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMG++PLCFK GEDADS
Sbjct  853  IVLAGEEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGVLPLCFKPGEDADS  912

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHERY+I LP+N++EI+PGQDV V +D GK+FTC +R DT VELAYF+HGGIL YV
Sbjct  913  LGLTGHERYTIRLPTNVSEIQPGQDVQVLSDTGKSFTCKLRIDTMVELAYFDHGGILHYV  972

Query  543  IRQLSKQ  563
            +R L +Q
Sbjct  973  LRNLVRQ  979



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+HIP+GEKL VFDAA +Y+ EG DT
Sbjct  720  SYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHIPSGEKLSVFDAAKKYQDEGHDT  779

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP L GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDA+S
Sbjct  780  IILAGAEYGSGSSRDWAAKGPYLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAES  839

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG+ER++ID+PS+I +I+PGQDV VKTD GK+FTCT+RFDT+VEL YF +GGIL YV
Sbjct  840  LGLTGYERFTIDIPSDIKDIKPGQDVVVKTDKGKSFTCTLRFDTQVELTYFENGGILHYV  899

Query  543  IRQL  554
            IRQL
Sbjct  900  IRQL  903



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   320 bits (820),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+HIP+GEKL VFDAA +Y+ EG DT
Sbjct  720  SYGSRRGNDEIMARGTFANIRIVNKFLKGEVGPKTIHIPSGEKLSVFDAAKKYQDEGHDT  779

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP L GVKAVIAKSFE IHRSNLVGMGI+PLCFK+GEDA+S
Sbjct  780  IILAGAEYGSGSSRDWAAKGPYLQGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDAES  839

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG+ER++ID+PS+I +I+PGQDV VKTD GK+FTCT+RFDT+VEL YF +GGIL YV
Sbjct  840  LGLTGYERFTIDIPSDIKDIKPGQDVLVKTDKGKSFTCTLRFDTQVELTYFENGGILHYV  899

Query  543  IRQL  554
            IRQL
Sbjct  900  IRQL  903



>ref|XP_007020811.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12336.1| Aconitase 3 [Theobroma cacao]
Length=951

 Score =   318 bits (816),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIR+VNKLL GEVGPKT+HIPTG+KL+V+DAAMRYK+ G+DT
Sbjct  783  SYGSRRGNDEVMARGTFANIRIVNKLLQGEVGPKTIHIPTGDKLHVYDAAMRYKTAGQDT  842

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFK GEDAD+
Sbjct  843  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKPGEDADT  902

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELA  509
            LGL+GHERYSIDLPS I+EIRPGQDVTV TD GK+FTCTVRFDTEVELA
Sbjct  903  LGLSGHERYSIDLPSKISEIRPGQDVTVTTDTGKSFTCTVRFDTEVELA  951



>ref|XP_006830449.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
 gb|ERM97865.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
Length=854

 Score =   313 bits (801),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+MARGTFANIRLVNKLL GEVGPKT+H+PTGE+LYVFDAAMRYK +G DT
Sbjct  690  SYGSRRGNDEVMARGTFANIRLVNKLLKGEVGPKTIHVPTGEELYVFDAAMRYKEDGHDT  749

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDAD+
Sbjct  750  IVLAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADT  809

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTE  497
            LGLTGHERY+I+LPSNI+EIRPGQD++V TD+GK+FTCT RFDTE
Sbjct  810  LGLTGHERYTINLPSNISEIRPGQDISVVTDSGKSFTCTARFDTE  854



>gb|ACR36825.1| unknown [Zea mays]
Length=565

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYG RRGN+E++ RG FAN+R+VNKLL+GE GP T+H+PTGEKLYV+DAAM+YKSEG D 
Sbjct  377  SYGGRRGNNEVVMRGAFANMRIVNKLLNGEAGPWTIHVPTGEKLYVYDAAMKYKSEGHDM  436

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            +I+AG+EYGSGSSRD AAKGPMLLGVK+VIAKSFE IHRSNLVGMGI+PLCF+AGEDADS
Sbjct  437  VIIAGSEYGSGSSRDSAAKGPMLLGVKSVIAKSFERIHRSNLVGMGIIPLCFQAGEDADS  496

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG ERY+I LP++  EI PGQDVTV T +G++FTCT+R DT++E+ YFNHGGILPY+
Sbjct  497  LGLTGRERYTIHLPTSTAEISPGQDVTVTTHDGRSFTCTLRLDTQLEVTYFNHGGILPYM  556

Query  543  IRQLSKQ  563
            +R L+ Q
Sbjct  557  VRNLAAQ  563



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score =   312 bits (800),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGN E+M RGTFAN+R+VNKLL GEVGP+T+HIP+GEK++VFDAAMRYK+EG+DT
Sbjct  713  SYGSRRGNYEVMVRGTFANVRIVNKLLEGEVGPRTIHIPSGEKMHVFDAAMRYKNEGQDT  772

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG+EYG GSSRD AAKGPML+GV+AVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  773  IVLAGSEYGVGSSRDGAAKGPMLVGVQAVIAKSFEQIHRSNLVGMGIIPLCFKPGEDAET  832

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGL GHERY+IDLP+ ++E++P QDV V TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  833  LGLNGHERYTIDLPNKVSELKPRQDVKVVTDNGKSFACTLRFDTEVELAYFDHGGILQYV  892

Query  543  IRQL  554
            IR L
Sbjct  893  IRTL  896



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score =   312 bits (800),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGN E+M RGTFAN+R+VNKLL GEVGP+T+HIP+GEK++VFDAAMRYK+EG+DT
Sbjct  740  SYGSRRGNYEVMVRGTFANVRIVNKLLEGEVGPRTIHIPSGEKMHVFDAAMRYKNEGQDT  799

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+LAG+EYG GSSRD AAKGPML+GV+AVIAKSFE IHRSNLVGMGI+PLCFK GEDA++
Sbjct  800  IVLAGSEYGVGSSRDGAAKGPMLVGVQAVIAKSFEQIHRSNLVGMGIIPLCFKPGEDAET  859

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGL GHERY+IDLP+ ++E++P QDV V TDNGK+F CT+RFDTEVELAYF+HGGIL YV
Sbjct  860  LGLNGHERYTIDLPNKVSELKPRQDVKVVTDNGKSFACTLRFDTEVELAYFDHGGILQYV  919

Query  543  IRQL  554
            IR L
Sbjct  920  IRTL  923



>tpg|DAA43248.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=664

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIRLVNK L GEVGPKT+H+P+GEKL VFDAAM+YK+EG DT
Sbjct  499  SYGSRRGNDEIMARGTFANIRLVNKFLKGEVGPKTIHVPSGEKLAVFDAAMKYKNEGHDT  558

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGPML GVKAVIAKSFE IHRSNL GMGI+PLC+KAGEDAD+
Sbjct  559  IILAGAEYGSGSSRDWAAKGPMLQGVKAVIAKSFERIHRSNLAGMGIIPLCYKAGEDADT  618

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEV  500
            LGLTGHERY++ LP+N++EI+PGQDVTV TDNGK+FTCT+RFDTEV
Sbjct  619  LGLTGHERYTVHLPTNVSEIKPGQDVTVTTDNGKSFTCTLRFDTEV  664



>ref|XP_001780674.1| predicted protein [Physcomitrella patens]
 gb|EDQ54560.1| predicted protein [Physcomitrella patens]
Length=867

 Score =   310 bits (793),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDEIMARGTFANIR+VNK L GEVGPKT+H+P+ E+L++FDAA +YK EG DT
Sbjct  681  SYGSRRGNDEIMARGTFANIRIVNKFLGGEVGPKTIHVPSKERLFIFDAAKKYKDEGHDT  740

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            IILAGAEYGSGSSRDWAAKGP L GVKAVI+KSFE IHRSNLVGMG++PLCFK G+DADS
Sbjct  741  IILAGAEYGSGSSRDWAAKGPYLQGVKAVISKSFERIHRSNLVGMGLIPLCFKQGQDADS  800

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTG+ERY+I++P+++ +I+PG DV V TD+GK+F CT+RFDT+VEL Y+ HGGIL YV
Sbjct  801  LGLTGYERYTIEMPTDMKQIKPGMDVNVTTDDGKSFKCTLRFDTQVELTYYMHGGILHYV  860

Query  543  IRQLSKQ  563
            +RQL+ +
Sbjct  861  LRQLAAK  867



>ref|XP_009361096.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase, cytoplasmic 
[Pyrus x bretschneideri]
Length=634

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+M RGTFANIR+VNK L GEVGPKT+HIPTGEKL+V+DAAM+YK+  + T
Sbjct  449  SYGSRRGNDEVMTRGTFANIRIVNKFLIGEVGPKTIHIPTGEKLHVYDAAMKYKAAEQST  508

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            I+ AGA+YGSGS+RDWAAKGPML GVKAVIAKSFE IHRSNLVGMGI+PL FK GEDAD+
Sbjct  509  IVSAGADYGSGSARDWAAKGPMLQGVKAVIAKSFERIHRSNLVGMGIIPLSFKPGEDADT  568

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGH+R +I+LP +I+EI+PGQDV V TDN K+FT T+ FDT+VELAYF+HGGILPYV
Sbjct  569  LGLTGHKRCTIELPRDISEIKPGQDVKVTTDNAKSFTRTLCFDTKVELAYFDHGGILPYV  628

Query  543  IRQLSK  560
            IR + K
Sbjct  629  IRNMIK  634



>sp|Q42669.1|ACOC_CUCMC RecName: Full=Aconitate hydratase; Short=Aconitase; AltName: 
Full=Citrate hydro-lyase, partial [Cucumis melo var. conomon]
 emb|CAA58047.1| aconitase [Cucumis melo]
Length=764

 Score =   305 bits (780),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +3

Query  51   FANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDTIILAGAEYGSGSSRDW  230
            FANIR+VNKLL GEVGPKT+HIP+ EKL VFDAAMRYKSEG+DTIILAGAEYG GSSRDW
Sbjct  592  FANIRIVNKLLKGEVGPKTIHIPSREKLSVFDAAMRYKSEGQDTIILAGAEYGIGSSRDW  651

Query  231  AAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADSLGLTGHERYSIDLPSN  410
            AAKGPMLLGVKAVIAKSFE IHRSNLVGMGI+PLCFKAGEDADSLGLTGHER++IDLPSN
Sbjct  652  AAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKAGEDADSLGLTGHERFTIDLPSN  711

Query  411  INEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYVIRQL  554
            + EIRPGQDV V TD GK+F+C +RFDTEVELAYF+HGGIL YVIR L
Sbjct  712  VGEIRPGQDVAVVTDTGKSFSCILRFDTEVELAYFDHGGILQYVIRNL  759



>ref|XP_002980554.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
 gb|EFJ18205.1| hypothetical protein SELMODRAFT_444572 [Selaginella moellendorffii]
Length=949

 Score =   307 bits (787),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    SYGSRRGNDEIMARGTFANIRLVNKLLSGEVGPKTVHIPTGEKLYVFDAAMRYKSEGKDT  182
            SYGSRRGNDE+M RGTFANIR+VNKLL GEVGPKTVH+P+GE  +VFD A +YK EGK+ 
Sbjct  762  SYGSRRGNDEVMVRGTFANIRIVNKLLKGEVGPKTVHLPSGECHWVFDVAQKYKDEGKEM  821

Query  183  IILAGAEYGSGSSRDWAAKGPMLLGVKAVIAKSFEMIHRSNLVGMGIVPLCFKAGEDADS  362
            ++LAGAEYGSGSSRDWAAKGP L GVKAVI+KSFE IHRSNLVGM I+PLC+K GEDA+S
Sbjct  822  VVLAGAEYGSGSSRDWAAKGPFLQGVKAVISKSFERIHRSNLVGMSIIPLCYKNGEDAES  881

Query  363  LGLTGHERYSIDLPSNINEIRPGQDVTVKTDNGKTFTCTVRFDTEVELAYFNHGGILPYV  542
            LGLTGHE ++I+LPS I EI+PGQDV VKT+ GK FTCT+RFDTEVE  YFNHGGIL YV
Sbjct  882  LGLTGHETFTIELPSTIEEIKPGQDVLVKTNTGKEFTCTLRFDTEVEKTYFNHGGILHYV  941

Query  543  IRQL  554
            +RQL
Sbjct  942  LRQL  945



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660