BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS129G09

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342406.1|  PREDICTED: TMV resistance protein N-like           148   9e-40   
emb|CBI17021.3|  unnamed protein product                                138   4e-37   Vitis vinifera
ref|XP_006342678.1|  PREDICTED: uncharacterized protein LOC102595828    146   7e-37   
ref|XP_006342676.1|  PREDICTED: TMV resistance protein N-like           136   2e-36   
ref|XP_009613117.1|  PREDICTED: TMV resistance protein N-like iso...    142   2e-36   
ref|XP_006367322.1|  PREDICTED: TMV resistance protein N-like           138   1e-35   
ref|XP_006441742.1|  hypothetical protein CICLE_v10024129mg             135   4e-35   
ref|XP_004253017.1|  PREDICTED: TMV resistance protein N-like           133   7e-35   Solanum lycopersicum
ref|XP_006342684.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-...    137   1e-34   Solanum tuberosum [potatoes]
ref|XP_006342679.1|  PREDICTED: TMV resistance protein N-like           141   1e-34   
ref|XP_010650243.1|  PREDICTED: TMV resistance protein N-like           133   2e-34   
gb|KDO38417.1|  hypothetical protein CISIN_1g036738mg                   135   3e-34   Citrus sinensis [apfelsine]
ref|XP_007221062.1|  hypothetical protein PRUPE_ppa016235mg             132   3e-34   
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    138   4e-34   
gb|AAL07542.1|  resistance gene analog NBS7                             132   6e-34   Helianthus annuus
ref|XP_008228037.1|  PREDICTED: TMV resistance protein N-like           135   7e-34   
ref|XP_006367018.1|  PREDICTED: TMV resistance protein N-like           129   9e-34   
ref|XP_006367324.1|  PREDICTED: TMV resistance protein N-like           138   1e-33   
ref|XP_008343157.1|  PREDICTED: TMV resistance protein N-like           129   1e-33   
ref|XP_008236760.1|  PREDICTED: TMV resistance protein N-like           129   1e-33   Prunus mume [ume]
ref|XP_009599523.1|  PREDICTED: TMV resistance protein N-like           138   2e-33   
ref|XP_010323796.1|  PREDICTED: TMV resistance protein N-like           128   2e-33   
ref|XP_011462237.1|  PREDICTED: TMV resistance protein N-like           129   2e-33   Fragaria vesca subsp. vesca
ref|XP_010646756.1|  PREDICTED: TMV resistance protein N-like           135   2e-33   
pdb|3OZI|A  Chain A, Crystal Structure Of The Tir Domain From The...    129   3e-33   Linum usitatissimum
ref|XP_010665295.1|  PREDICTED: toll/interleukin-1 receptor-like ...    127   3e-33   
emb|CCW28746.1|  TIR NB-ARC LRR protein                                 136   4e-33   Arachis duranensis
ref|XP_010650207.1|  PREDICTED: TMV resistance protein N-like           137   4e-33   Vitis vinifera
ref|XP_006371051.1|  hypothetical protein POPTR_0019s02990g             129   4e-33   
ref|XP_010665222.1|  PREDICTED: toll/interleukin-1 receptor-like ...    131   5e-33   Vitis vinifera
ref|XP_006492482.1|  PREDICTED: TMV resistance protein N-like           127   5e-33   
ref|XP_010650203.1|  PREDICTED: TMV resistance protein N-like           134   5e-33   
emb|CAN82451.1|  hypothetical protein VITISV_003325                     127   7e-33   Vitis vinifera
ref|XP_011015316.1|  PREDICTED: TMV resistance protein N-like           127   8e-33   Populus euphratica
ref|XP_009628590.1|  PREDICTED: TMV resistance protein N-like iso...    136   1e-32   
ref|XP_009628589.1|  PREDICTED: TMV resistance protein N-like iso...    136   1e-32   Nicotiana tomentosiformis
ref|XP_006342412.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-...    131   1e-32   Solanum tuberosum [potatoes]
ref|XP_007216844.1|  hypothetical protein PRUPE_ppa022061mg             126   1e-32   
gb|AAN73010.1|  NBS-LRR resistance protein RAS5-1                       132   1e-32   Helianthus annuus
ref|XP_006442760.1|  hypothetical protein CICLE_v10023793mg             126   1e-32   
ref|XP_002316582.2|  hypothetical protein POPTR_0011s01660g             126   1e-32   
gb|AEL30358.1|  TIR disease resistance protein                          126   1e-32   Arachis hypogaea [goober]
ref|XP_008233348.1|  PREDICTED: TMV resistance protein N-like           132   1e-32   
ref|XP_004246918.2|  PREDICTED: TMV resistance protein N-like           135   1e-32   
gb|KEH23209.1|  disease resistance protein (TIR-NBS-LRR class), p...    135   1e-32   Medicago truncatula
gb|AAL07537.1|  resistance gene analog NBS2                             128   2e-32   Helianthus annuus
ref|XP_004253023.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-...    130   2e-32   Solanum lycopersicum
ref|XP_010650202.1|  PREDICTED: TMV resistance protein N-like           135   2e-32   
ref|XP_008222878.1|  PREDICTED: TMV resistance protein N-like           132   2e-32   
gb|KDO39318.1|  hypothetical protein CISIN_1g031151mg                   125   2e-32   Citrus sinensis [apfelsine]
ref|XP_010650303.1|  PREDICTED: toll/interleukin-1 receptor-like ...    125   2e-32   
ref|XP_008236673.1|  PREDICTED: TMV resistance protein N-like           127   3e-32   Prunus mume [ume]
ref|XP_008231758.1|  PREDICTED: TMV resistance protein N-like           134   3e-32   Prunus mume [ume]
ref|XP_008227883.1|  PREDICTED: TMV resistance protein N-like           134   3e-32   
emb|CAC95120.1|  TIR/NBS/LRR protein                                    127   3e-32   Populus deltoides
ref|XP_006478373.1|  PREDICTED: TMV resistance protein N-like           134   3e-32   
ref|XP_008227885.1|  PREDICTED: TMV resistance protein N-like           134   3e-32   
ref|XP_009613120.1|  PREDICTED: TMV resistance protein N-like iso...    134   3e-32   Nicotiana tomentosiformis
ref|XP_007219199.1|  hypothetical protein PRUPE_ppa016991mg             128   4e-32   
gb|KDP43340.1|  hypothetical protein JCGZ_25445                         134   4e-32   Jatropha curcas
gb|AEE43928.1|  TIR-NBS-LRR resistance protein muRdr1D                  134   4e-32   Rosa multiflora [Japanese rose]
ref|XP_007200952.1|  hypothetical protein PRUPE_ppa000577mg             134   4e-32   
ref|XP_004237202.1|  PREDICTED: TMV resistance protein N-like           134   4e-32   Solanum lycopersicum
ref|XP_008236754.1|  PREDICTED: TMV resistance protein N-like           128   4e-32   
ref|XP_006495109.1|  PREDICTED: TMV resistance protein N-like           127   5e-32   
ref|XP_010650374.1|  PREDICTED: TMV resistance protein N-like           132   5e-32   
gb|AEL30372.1|  TIR-NBS-LRR type disease resistance protein             134   5e-32   Arachis hypogaea [goober]
gb|AGF69190.1|  TMV resistance protein N-like protein 4                 133   5e-32   Vitis labrusca [Concord grape]
emb|CDP14589.1|  unnamed protein product                                130   5e-32   Coffea canephora [robusta coffee]
gb|AAL07541.1|  resistance gene analog NBS6                             128   5e-32   Helianthus annuus
ref|XP_008227564.1|  PREDICTED: TMV resistance protein N-like           127   5e-32   
ref|XP_008228036.1|  PREDICTED: TMV resistance protein N-like           133   5e-32   
ref|XP_008368587.1|  PREDICTED: TMV resistance protein N-like           134   6e-32   
ref|XP_007221574.1|  hypothetical protein PRUPE_ppa025931mg             134   6e-32   
emb|CAN70507.1|  hypothetical protein VITISV_024109                     134   7e-32   Vitis vinifera
emb|CAN71926.1|  hypothetical protein VITISV_006195                     124   7e-32   Vitis vinifera
ref|XP_006356453.1|  PREDICTED: TMV resistance protein N-like           133   8e-32   Solanum tuberosum [potatoes]
ref|XP_002325743.2|  hypothetical protein POPTR_0019s00880g             124   8e-32   
ref|XP_006371043.1|  hypothetical protein POPTR_0019s029202g            127   9e-32   
ref|XP_010657879.1|  PREDICTED: TMV resistance protein N-like           124   1e-31   
gb|AAL07536.1|  resistance gene analog NBS1                             128   1e-31   Helianthus annuus
gb|AAL07544.1|  resistance gene analog NBS9                             127   1e-31   Helianthus annuus
gb|AAL07535.1|  resistance gene analog PU3                              132   1e-31   Helianthus annuus
ref|XP_008236761.1|  PREDICTED: TMV resistance protein N-like           129   1e-31   
ref|XP_006360469.1|  PREDICTED: TMV resistance protein N-like           133   1e-31   Solanum tuberosum [potatoes]
gb|AAG43546.1|AF211528_1  Avr9/Cf-9 rapidly elicited protein 4          130   1e-31   Nicotiana tabacum [American tobacco]
ref|XP_007214356.1|  hypothetical protein PRUPE_ppb025535mg             125   1e-31   
ref|XP_006441740.1|  hypothetical protein CICLE_v100235051mg            124   1e-31   
ref|XP_002316581.2|  hypothetical protein POPTR_0011s01845g             125   1e-31   
ref|XP_008236755.1|  PREDICTED: TMV resistance protein N-like           132   1e-31   
emb|CAN78476.1|  hypothetical protein VITISV_009816                     132   1e-31   Vitis vinifera
gb|ABB82025.1|  TIR-NBS disease resistance-like protein                 131   1e-31   Populus trichocarpa [western balsam poplar]
gb|KDO37360.1|  hypothetical protein CISIN_1g039252mg                   122   1e-31   Citrus sinensis [apfelsine]
ref|XP_009803027.1|  PREDICTED: TMV resistance protein N-like iso...    132   2e-31   Nicotiana sylvestris
ref|XP_009803028.1|  PREDICTED: TMV resistance protein N-like iso...    132   2e-31   Nicotiana sylvestris
ref|XP_002325607.2|  hypothetical protein POPTR_0019s12840g             124   2e-31   
ref|XP_006367016.1|  PREDICTED: TMV resistance protein N-like           129   2e-31   
ref|XP_009373229.1|  PREDICTED: TMV resistance protein N-like iso...    132   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_009803029.1|  PREDICTED: TMV resistance protein N-like iso...    132   2e-31   Nicotiana sylvestris
ref|XP_010648148.1|  PREDICTED: TMV resistance protein N-like           132   2e-31   Vitis vinifera
gb|AAL07539.1|  resistance gene analog NBS4                             126   2e-31   Helianthus annuus
gb|KDO43806.1|  hypothetical protein CISIN_1g0018052mg                  129   2e-31   Citrus sinensis [apfelsine]
gb|KDO49601.1|  hypothetical protein CISIN_1g0377522mg                  123   2e-31   Citrus sinensis [apfelsine]
ref|XP_008232097.1|  PREDICTED: TMV resistance protein N-like           131   2e-31   
ref|XP_007200803.1|  hypothetical protein PRUPE_ppa025229mg             131   2e-31   
ref|XP_009373216.1|  PREDICTED: TMV resistance protein N-like iso...    132   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_006370852.1|  hypothetical protein POPTR_0019s00910g             122   2e-31   
emb|CDP07826.1|  unnamed protein product                                132   3e-31   Coffea canephora [robusta coffee]
ref|XP_004292155.1|  PREDICTED: TMV resistance protein N-like iso...    132   3e-31   Fragaria vesca subsp. vesca
gb|ADL36719.1|  HD domain class transcription factor                    123   3e-31   Malus domestica [apple tree]
ref|XP_011457915.1|  PREDICTED: TMV resistance protein N-like iso...    132   3e-31   Fragaria vesca subsp. vesca
ref|XP_009353817.1|  PREDICTED: TMV resistance protein N-like           124   3e-31   
ref|XP_010650380.1|  PREDICTED: TMV resistance protein N-like           131   3e-31   Vitis vinifera
ref|XP_006442158.1|  hypothetical protein CICLE_v10018611mg             131   3e-31   Citrus clementina [clementine]
ref|XP_008342527.1|  PREDICTED: TMV resistance protein N-like iso...    131   3e-31   
ref|XP_010650378.1|  PREDICTED: toll/interleukin-1 receptor-like ...    122   4e-31   
gb|AAF61210.1|  unknown                                                 122   4e-31   Glycine max [soybeans]
ref|XP_011015315.1|  PREDICTED: TMV resistance protein N-like           131   4e-31   Populus euphratica
ref|XP_006371542.1|  hypothetical protein POPTR_0019s13000g             123   4e-31   Populus trichocarpa [western balsam poplar]
emb|CDP20523.1|  unnamed protein product                                131   4e-31   Coffea canephora [robusta coffee]
ref|XP_008342525.1|  PREDICTED: TMV resistance protein N-like iso...    131   4e-31   
gb|KDO38309.1|  hypothetical protein CISIN_1g0397312mg                  122   4e-31   Citrus sinensis [apfelsine]
gb|AAL07540.1|  resistance gene analog NBS5                             125   4e-31   Helianthus annuus
ref|XP_008244454.1|  PREDICTED: TMV resistance protein N-like           124   5e-31   
ref|XP_009794563.1|  PREDICTED: TMV resistance protein N-like           122   5e-31   Nicotiana sylvestris
gb|KDO40658.1|  hypothetical protein CISIN_1g009845mg                   128   5e-31   Citrus sinensis [apfelsine]
ref|XP_007203308.1|  hypothetical protein PRUPE_ppa025905mg             128   5e-31   
emb|CAN74711.1|  hypothetical protein VITISV_009242                     131   5e-31   Vitis vinifera
ref|XP_006370864.1|  hypothetical protein POPTR_0019s01170g             130   5e-31   
ref|XP_006495365.1|  PREDICTED: TMV resistance protein N-like           122   5e-31   
ref|XP_009374162.1|  PREDICTED: TMV resistance protein N-like           130   5e-31   
ref|XP_008236613.1|  PREDICTED: TMV resistance protein N-like           129   6e-31   Prunus mume [ume]
ref|XP_010050815.1|  PREDICTED: TMV resistance protein N-like           122   6e-31   
ref|XP_009361379.1|  PREDICTED: TMV resistance protein N-like           129   6e-31   Pyrus x bretschneideri [bai li]
ref|XP_008351316.1|  PREDICTED: TMV resistance protein N-like           130   6e-31   
ref|XP_010645853.1|  PREDICTED: TMV resistance protein N-like           130   6e-31   
gb|KDO36672.1|  hypothetical protein CISIN_1g035646mg                   128   7e-31   Citrus sinensis [apfelsine]
ref|XP_008236730.1|  PREDICTED: TMV resistance protein N-like iso...    130   7e-31   
ref|XP_006371398.1|  hypothetical protein POPTR_0019s098402g            121   7e-31   
emb|CAN64588.1|  hypothetical protein VITISV_008452                     124   7e-31   Vitis vinifera
ref|XP_004295629.1|  PREDICTED: TMV resistance protein N-like           126   8e-31   Fragaria vesca subsp. vesca
ref|XP_010665272.1|  PREDICTED: TMV resistance protein N-like           130   8e-31   
ref|XP_010026669.1|  PREDICTED: TMV resistance protein N-like           128   8e-31   
ref|XP_010042728.1|  PREDICTED: TMV resistance protein N-like           121   9e-31   
ref|XP_008351874.1|  PREDICTED: putative disease resistance prote...    122   9e-31   Malus domestica [apple tree]
ref|XP_007201560.1|  hypothetical protein PRUPE_ppa017937mg             129   9e-31   
gb|KDO37805.1|  hypothetical protein CISIN_1g044964mg                   121   9e-31   Citrus sinensis [apfelsine]
ref|XP_008349077.1|  PREDICTED: TMV resistance protein N-like           121   1e-30   
gb|KDO36130.1|  hypothetical protein CISIN_1g045860mg                   121   1e-30   Citrus sinensis [apfelsine]
ref|XP_006364843.1|  PREDICTED: TMV resistance protein N-like           130   1e-30   Solanum tuberosum [potatoes]
ref|XP_007221584.1|  hypothetical protein PRUPE_ppa025848mg             129   1e-30   
gb|AFP55552.1|  TIR-NBS-LRR                                             130   1e-30   Rosa rugosa [Japanese rose]
emb|CAC95127.1|  part I of G08 TIR/NBS/LRR protein                      123   1e-30   Populus deltoides
ref|XP_002325276.2|  hypothetical protein POPTR_0019s01160g             129   1e-30   
ref|XP_010665467.1|  PREDICTED: TMV resistance protein N-like           130   1e-30   
ref|XP_006478372.1|  PREDICTED: TMV resistance protein N-like           130   1e-30   
ref|XP_008339367.1|  PREDICTED: toll/interleukin-1 receptor-like ...    124   1e-30   
ref|XP_004233763.1|  PREDICTED: TMV resistance protein N-like           129   1e-30   Solanum lycopersicum
ref|XP_006495323.1|  PREDICTED: putative disease resistance prote...    125   1e-30   
ref|XP_009790280.1|  PREDICTED: TMV resistance protein N-like           129   1e-30   Nicotiana sylvestris
ref|XP_006370866.1|  hypothetical protein POPTR_0019s01210g             126   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_007220726.1|  hypothetical protein PRUPE_ppa023276mg             129   2e-30   
ref|XP_009791999.1|  PREDICTED: TMV resistance protein N-like           125   2e-30   Nicotiana sylvestris
ref|XP_006342413.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A6-...    125   2e-30   
emb|CAN61899.1|  hypothetical protein VITISV_029813                     121   2e-30   Vitis vinifera
ref|XP_009345565.1|  PREDICTED: TMV resistance protein N-like           129   2e-30   Pyrus x bretschneideri [bai li]
dbj|BAD12595.1|  truncated N protein                                    127   2e-30   Nicotiana tabacum [American tobacco]
gb|KDO42763.1|  hypothetical protein CISIN_1g002220mg                   129   2e-30   Citrus sinensis [apfelsine]
ref|XP_010650377.1|  PREDICTED: uncharacterized protein LOC104879391    127   2e-30   
ref|XP_008359477.1|  PREDICTED: TMV resistance protein N-like           121   2e-30   Malus domestica [apple tree]
gb|AES66953.2|  disease resistance protein (TIR-NBS-LRR class), p...    128   2e-30   Medicago truncatula
emb|CAN68265.1|  hypothetical protein VITISV_020931                     129   2e-30   Vitis vinifera
emb|CAA08797.1|  NL25                                                   126   2e-30   Solanum tuberosum [potatoes]
ref|XP_006441589.1|  hypothetical protein CICLE_v10018553mg             129   2e-30   
ref|XP_006478214.1|  PREDICTED: TMV resistance protein N-like           129   2e-30   Citrus sinensis [apfelsine]
ref|XP_010665287.1|  PREDICTED: TMV resistance protein N-like           129   2e-30   
gb|AAA91021.1|  L6tr                                                    128   2e-30   Linum usitatissimum
ref|XP_009630491.1|  PREDICTED: uncharacterized protein LOC104120435    129   2e-30   
gb|AFP55548.1|  TIR-NBS-LRR                                             129   2e-30   Rosa rugosa [Japanese rose]
ref|XP_003596702.1|  TIR-NBS-LRR type disease resistance protein        128   2e-30   
ref|XP_006371227.1|  hypothetical protein POPTR_0019s06300g             128   2e-30   
ref|XP_002310389.2|  hypothetical protein POPTR_0007s00600g             129   2e-30   
ref|XP_010665437.1|  PREDICTED: TMV resistance protein N-like           120   2e-30   
ref|XP_007134526.1|  hypothetical protein PHAVU_010G054800g             120   3e-30   Phaseolus vulgaris [French bean]
ref|XP_004489474.1|  PREDICTED: TMV resistance protein N-like iso...    129   3e-30   
ref|XP_003622506.1|  TMV resistance protein N                           129   3e-30   
ref|XP_004489473.1|  PREDICTED: TMV resistance protein N-like iso...    129   3e-30   
gb|KEH15762.1|  disease resistance protein (TIR-NBS-LRR class)          120   3e-30   Medicago truncatula
ref|XP_004228809.1|  PREDICTED: TMV resistance protein N-like           129   3e-30   Solanum lycopersicum
gb|KHN01586.1|  TMV resistance protein N                                124   3e-30   Glycine soja [wild soybean]
ref|XP_008232158.1|  PREDICTED: TMV resistance protein N-like           127   3e-30   
ref|XP_007219308.1|  hypothetical protein PRUPE_ppa018964mg             128   3e-30   
ref|XP_004492775.1|  PREDICTED: TMV resistance protein N-like iso...    128   3e-30   Cicer arietinum [garbanzo]
ref|XP_011002560.1|  PREDICTED: TMV resistance protein N-like           120   3e-30   Populus euphratica
ref|XP_010644041.1|  PREDICTED: uncharacterized protein LOC104877471    129   3e-30   
ref|XP_011044953.1|  PREDICTED: TMV resistance protein N-like           125   3e-30   Populus euphratica
ref|XP_007199998.1|  hypothetical protein PRUPE_ppa024831mg             128   3e-30   
gb|ABF81471.1|  TIR-NBS type disease resistance protein                 129   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002316578.2|  hypothetical protein POPTR_0011s01930g             124   4e-30   
ref|XP_007226709.1|  hypothetical protein PRUPE_ppa020033mg             128   4e-30   
ref|XP_010645836.1|  PREDICTED: toll/interleukin-1 receptor-like ...    120   4e-30   Vitis vinifera
ref|XP_010070519.1|  PREDICTED: TMV resistance protein N-like           122   4e-30   
ref|XP_007134525.1|  hypothetical protein PHAVU_010G054800g             121   4e-30   Phaseolus vulgaris [French bean]
gb|AEE43929.1|  TIR-NBS-LRR resistance protein muRdr1E                  128   4e-30   Rosa multiflora [Japanese rose]
ref|XP_011012496.1|  PREDICTED: TMV resistance protein N-like iso...    128   4e-30   Populus euphratica
gb|AEE43927.1|  TIR-NBS-LRR resistance protein muRdr1C                  128   4e-30   Rosa multiflora [Japanese rose]
ref|XP_011011343.1|  PREDICTED: TMV resistance protein N-like           120   4e-30   Populus euphratica
gb|AFP55569.1|  TIR-NBS-LRR                                             128   4e-30   Rosa rugosa [Japanese rose]
ref|XP_011012495.1|  PREDICTED: TMV resistance protein N-like iso...    128   4e-30   Populus euphratica
ref|XP_004492774.1|  PREDICTED: TMV resistance protein N-like iso...    128   4e-30   Cicer arietinum [garbanzo]
ref|XP_007199645.1|  hypothetical protein PRUPE_ppa022914mg             127   4e-30   
ref|XP_002325612.2|  hypothetical protein POPTR_0019s127002g            120   5e-30   
ref|XP_008382746.1|  PREDICTED: TMV resistance protein N-like           120   5e-30   
ref|XP_007204862.1|  hypothetical protein PRUPE_ppa021004mg             119   5e-30   
ref|XP_006353757.1|  PREDICTED: TMV resistance protein N-like           128   5e-30   Solanum tuberosum [potatoes]
ref|XP_006602339.1|  PREDICTED: TMV resistance protein N-like           119   5e-30   
ref|XP_010646047.1|  PREDICTED: TMV resistance protein N-like           120   6e-30   
gb|AAY43787.1|  disease resistance protein                              124   6e-30   (Populus tomentosa x Populus bolleana) x Populus tomentosa var. truncata
ref|XP_006377202.1|  hypothetical protein POPTR_0011s01910g             124   6e-30   
ref|XP_006380260.1|  hypothetical protein POPTR_0007s00620g             124   6e-30   
ref|XP_007199304.1|  hypothetical protein PRUPE_ppa023180mg             127   6e-30   
ref|XP_006367169.1|  PREDICTED: TMV resistance protein N-like iso...    119   6e-30   
ref|XP_002263928.2|  PREDICTED: toll/interleukin-1 receptor-like ...    121   6e-30   Vitis vinifera
ref|XP_006380156.1|  hypothetical protein POPTR_0008s22420g             119   6e-30   
dbj|BAD12594.1|  N protein                                              127   6e-30   Nicotiana tabacum [American tobacco]
ref|XP_006441871.1|  hypothetical protein CICLE_v10024379mg             127   7e-30   
ref|XP_010103475.1|  TMV resistance protein N                           119   7e-30   Morus notabilis
ref|XP_010644028.1|  PREDICTED: uncharacterized protein LOC100261885    128   7e-30   Vitis vinifera
gb|AAW28561.2|  TMV resistance protein N, putative                      126   7e-30   Solanum demissum
ref|XP_006421209.1|  hypothetical protein CICLE_v100041742mg            119   7e-30   
ref|XP_008342629.1|  PREDICTED: TMV resistance protein N-like           125   7e-30   
gb|AAD25968.1|AF093641_2  flax rust resistance protein                  127   7e-30   Linum usitatissimum
sp|Q40392.1|TMVRN_NICGU  RecName: Full=TMV resistance protein N         127   7e-30   Nicotiana glutinosa
ref|XP_006371055.1|  hypothetical protein POPTR_0019s03015g             124   7e-30   
gb|KEH25115.1|  disease resistance protein (TIR-NBS-LRR class)          127   7e-30   Medicago truncatula
gb|AAA91022.1|  L6                                                      127   7e-30   Linum usitatissimum
ref|XP_009779694.1|  PREDICTED: TMV resistance protein N-like           127   7e-30   Nicotiana sylvestris
gb|KDP27330.1|  hypothetical protein JCGZ_20262                         120   8e-30   Jatropha curcas
ref|XP_007214070.1|  hypothetical protein PRUPE_ppa017636mg             118   8e-30   
ref|XP_008240874.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    127   8e-30   
ref|XP_006377180.1|  hypothetical protein POPTR_0011s016702g            118   8e-30   
ref|XP_010041655.1|  PREDICTED: TMV resistance protein N-like           119   8e-30   Eucalyptus grandis [rose gum]
gb|KDO39545.1|  hypothetical protein CISIN_1g0463142mg                  124   8e-30   Citrus sinensis [apfelsine]
gb|KDO40701.1|  hypothetical protein CISIN_1g0007801mg                  124   9e-30   Citrus sinensis [apfelsine]
ref|XP_010056818.1|  PREDICTED: TMV resistance protein N-like           119   9e-30   
ref|XP_008231763.1|  PREDICTED: TMV resistance protein N-like           125   9e-30   
ref|XP_010665198.1|  PREDICTED: TMV resistance protein N-like iso...    126   9e-30   Vitis vinifera
gb|ABO20868.1|  toll/interleukin 1 receptor domain containing pro...    118   9e-30   (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_010050310.1|  PREDICTED: TMV resistance protein N-like           125   9e-30   
ref|XP_010256441.1|  PREDICTED: TMV resistance protein N-like iso...    127   9e-30   
gb|AEL30370.1|  TIR disease resistance protein                          119   9e-30   Arachis hypogaea [goober]
ref|XP_008375678.1|  PREDICTED: TMV resistance protein N-like           125   9e-30   
ref|XP_010256443.1|  PREDICTED: TMV resistance protein N-like iso...    127   1e-29   
gb|AEL30362.1|  TIR disease resistance protein                          119   1e-29   Arachis hypogaea [goober]
ref|XP_011047737.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    127   1e-29   Populus euphratica
gb|KDO40203.1|  hypothetical protein CISIN_1g047667mg                   119   1e-29   Citrus sinensis [apfelsine]
ref|XP_011470169.1|  PREDICTED: TMV resistance protein N-like           127   1e-29   Fragaria vesca subsp. vesca
ref|XP_010644030.1|  PREDICTED: uncharacterized protein LOC100253289    127   1e-29   
ref|XP_011012882.1|  PREDICTED: TMV resistance protein N-like           127   1e-29   Populus euphratica
ref|XP_006441888.1|  hypothetical protein CICLE_v10023769mg             118   1e-29   Citrus clementina [clementine]
ref|XP_006495387.1|  PREDICTED: TMV resistance protein N-like           120   1e-29   
gb|ABF81459.1|  TIR-NBS type disease resistance protein                 127   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011005281.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    127   1e-29   Populus euphratica
emb|CDP04904.1|  unnamed protein product                                127   1e-29   Coffea canephora [robusta coffee]
emb|CAC95124.1|  TIR/NBS/LRR protein                                    127   1e-29   Populus deltoides
gb|ABD33308.1|  TIR                                                     118   1e-29   Medicago truncatula
ref|XP_006441390.1|  hypothetical protein CICLE_v10023914mg             119   1e-29   
ref|XP_009586757.1|  PREDICTED: TMV resistance protein N-like           127   1e-29   
ref|XP_006441884.1|  hypothetical protein CICLE_v10024486mg             118   1e-29   
ref|XP_010645859.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    127   1e-29   Vitis vinifera
ref|XP_010644011.1|  PREDICTED: TMV resistance protein N-like iso...    127   1e-29   
gb|ABH07384.1|  CMR1                                                    127   1e-29   Phaseolus vulgaris [French bean]
ref|XP_002325273.2|  hypothetical protein POPTR_0019s01200g             126   1e-29   
ref|XP_006389335.1|  hypothetical protein POPTR_0030s00570g             126   1e-29   
ref|XP_009361380.1|  PREDICTED: TMV resistance protein N-like           123   1e-29   
ref|XP_006442149.1|  hypothetical protein CICLE_v10018528mg             127   1e-29   
ref|XP_003624057.1|  TMV resistance protein N                           126   1e-29   Medicago truncatula
ref|XP_007135105.1|  hypothetical protein PHAVU_010G101200g             126   1e-29   Phaseolus vulgaris [French bean]
ref|XP_010026450.1|  PREDICTED: TMV resistance protein N-like           118   2e-29   
ref|XP_006442148.1|  hypothetical protein CICLE_v10018528mg             127   2e-29   
ref|XP_006388458.1|  hypothetical protein POPTR_0182s00230g             118   2e-29   
emb|CBI23894.3|  unnamed protein product                                120   2e-29   
ref|XP_011004905.1|  PREDICTED: TMV resistance protein N-like           126   2e-29   
gb|KDO36805.1|  hypothetical protein CISIN_1g031401mg                   118   2e-29   
gb|KEH25091.1|  disease resistance protein (TIR-NBS-LRR class)          126   2e-29   
gb|KDP45571.1|  hypothetical protein JCGZ_17178                         126   2e-29   
ref|XP_006371049.1|  hypothetical protein POPTR_0019s02970g             126   2e-29   
ref|XP_006371054.1|  hypothetical protein POPTR_0019s03010g             126   2e-29   
ref|XP_011470189.1|  PREDICTED: TMV resistance protein N-like iso...    125   2e-29   
gb|AES71667.2|  disease resistance protein (TIR-NBS-LRR class), p...    127   2e-29   
ref|XP_007202964.1|  hypothetical protein PRUPE_ppa018323mg             118   2e-29   
gb|AEE43925.1|  TIR-NBS-LRR resistance protein muRdr1A                  126   2e-29   
gb|KJB46020.1|  hypothetical protein B456_007G343700                    117   2e-29   
ref|XP_003601416.1|  TIR-NBS-LRR-TIR type disease resistance protein    126   2e-29   
ref|XP_011044910.1|  PREDICTED: TMV resistance protein N-like           125   2e-29   
gb|KDO41019.1|  hypothetical protein CISIN_1g043195mg                   118   2e-29   
ref|XP_010046824.1|  PREDICTED: TMV resistance protein N-like iso...    122   2e-29   
ref|XP_008236647.1|  PREDICTED: TMV resistance protein N-like           120   2e-29   
gb|AAD25974.1|AF093647_1  flax rust resistance protein                  125   2e-29   
ref|XP_007221565.1|  hypothetical protein PRUPE_ppa015313mg             126   2e-29   
gb|KEH25090.1|  disease resistance protein (TIR-NBS-LRR class)          126   2e-29   
gb|KCW59429.1|  hypothetical protein EUGRSUZ_H02155                     118   2e-29   
gb|AFP55577.1|  TIR-NBS-LRR                                             126   2e-29   
ref|XP_011012884.1|  PREDICTED: TMV resistance protein N-like           125   2e-29   
ref|XP_007201564.1|  hypothetical protein PRUPE_ppa018131mg             126   2e-29   
ref|XP_010046825.1|  PREDICTED: TMV resistance protein N-like iso...    122   2e-29   
ref|XP_006367971.1|  PREDICTED: TMV resistance protein N-like           122   2e-29   
ref|XP_010057031.1|  PREDICTED: TMV resistance protein N-like           117   2e-29   
ref|XP_007142262.1|  hypothetical protein PHAVU_008G265900g             122   2e-29   
ref|XP_007227381.1|  hypothetical protein PRUPE_ppb015618mg             126   2e-29   
ref|XP_008351651.1|  PREDICTED: TMV resistance protein N-like           117   2e-29   
ref|XP_011002590.1|  PREDICTED: TMV resistance protein N-like           124   3e-29   
ref|XP_006441908.1|  hypothetical protein CICLE_v10023272mg             122   3e-29   
ref|XP_006478374.1|  PREDICTED: TMV resistance protein N-like           126   3e-29   
gb|KEH23206.1|  disease resistance protein (TIR-NBS-LRR class)          125   3e-29   
ref|XP_008237268.1|  PREDICTED: TMV resistance protein N-like           125   3e-29   
gb|KDP45570.1|  hypothetical protein JCGZ_17177                         125   3e-29   
gb|KCW74266.1|  hypothetical protein EUGRSUZ_E02914                     123   3e-29   
ref|XP_006361823.1|  PREDICTED: TMV resistance protein N-like           119   3e-29   
gb|KDO40814.1|  hypothetical protein CISIN_1g0008741mg                  123   3e-29   
gb|KEH23205.1|  disease resistance protein (TIR-NBS-LRR class)          126   3e-29   
gb|KEH23207.1|  disease resistance protein (TIR-NBS-LRR class)          126   3e-29   
ref|XP_002325285.2|  hypothetical protein POPTR_0019s00890g             125   3e-29   
ref|XP_006380263.1|  hypothetical protein POPTR_0007s00680g             122   3e-29   
gb|KEH23208.1|  disease resistance protein (TIR-NBS-LRR class)          125   3e-29   
gb|KEH23202.1|  disease resistance protein (TIR-NBS-LRR class), p...    125   3e-29   
gb|KDO37029.1|  hypothetical protein CISIN_1g008685mg                   123   3e-29   
ref|XP_006494061.1|  PREDICTED: TMV resistance protein N-like           122   3e-29   
ref|XP_006440746.1|  hypothetical protein CICLE_v10023985mg             125   3e-29   
ref|XP_006389148.1|  hypothetical protein POPTR_0043s00285g             117   3e-29   
ref|XP_010047163.1|  PREDICTED: TMV resistance protein N-like           125   3e-29   
ref|XP_008219411.1|  PREDICTED: TMV resistance protein N-like           125   3e-29   
ref|XP_006352448.1|  PREDICTED: TMV resistance protein N-like           125   3e-29   
ref|XP_009759653.1|  PREDICTED: TMV resistance protein N-like           125   3e-29   
gb|AAD25972.1|AF093645_1  flax rust resistance protein                  125   3e-29   
dbj|BAF95888.1|  N-like protein                                         125   3e-29   
ref|XP_010039985.1|  PREDICTED: TMV resistance protein N-like           121   3e-29   
gb|ABB82024.1|  TIR-NBS disease resistance-like protein                 125   3e-29   
ref|XP_006382275.1|  hypothetical protein POPTR_0005s00590g             118   3e-29   
ref|XP_010103728.1|  TMV resistance protein N                           118   3e-29   
ref|XP_011011693.1|  PREDICTED: TMV resistance protein N-like           125   3e-29   
gb|AAD25966.1|AF093639_1  flax rust resistance protein                  125   4e-29   
ref|XP_009369822.1|  PREDICTED: TMV resistance protein N-like           125   4e-29   
gb|AAD25976.1|AF093649_1  flax rust resistance protein                  125   4e-29   
ref|XP_002523474.1|  TMV resistance protein N, putative                 125   4e-29   
ref|XP_011461512.1|  PREDICTED: TMV resistance protein N-like           118   4e-29   
ref|XP_008245069.1|  PREDICTED: TMV resistance protein N-like           125   4e-29   
emb|CAN79900.1|  hypothetical protein VITISV_007865                     125   4e-29   
ref|XP_006478473.1|  PREDICTED: TMV resistance protein N-like           125   4e-29   
ref|XP_008351652.1|  PREDICTED: TMV resistance protein N-like           118   4e-29   
ref|XP_008375756.1|  PREDICTED: TMV resistance protein N-like           116   4e-29   
ref|XP_006441912.1|  hypothetical protein CICLE_v10023609mg             117   4e-29   
emb|CAD36199.1|  NLS-TIR-NBS disease resistance protein                 122   4e-29   
ref|XP_007219591.1|  hypothetical protein PRUPE_ppa023503mg             124   5e-29   
gb|KEH19831.1|  disease resistance protein (TIR-NBS-LRR class)          120   5e-29   
gb|AFP55572.1|  TIR-NBS-LRR                                             125   5e-29   
ref|XP_010665188.1|  PREDICTED: TMV resistance protein N-like iso...    125   5e-29   
ref|XP_007199954.1|  hypothetical protein PRUPE_ppa1027179mg            125   5e-29   
gb|AAD25969.1|AF093642_1  flax rust resistance protein                  125   5e-29   
emb|CAN63551.1|  hypothetical protein VITISV_032106                     125   5e-29   
emb|CAA08798.1|  NL27                                                   124   5e-29   
ref|XP_006441719.1|  hypothetical protein CICLE_v10018572mg             125   5e-29   
gb|KCW74562.1|  hypothetical protein EUGRSUZ_E03277                     116   5e-29   
ref|XP_010104209.1|  TMV resistance protein N                           125   5e-29   
ref|XP_002520182.1|  leucine-rich repeat containing protein, puta...    125   5e-29   
ref|XP_010650309.1|  PREDICTED: TMV resistance protein N-like iso...    125   5e-29   
gb|KCW59442.1|  hypothetical protein EUGRSUZ_H02176                     117   5e-29   
ref|XP_006359080.1|  PREDICTED: TMV resistance protein N-like           125   5e-29   
ref|XP_006466125.1|  PREDICTED: TMV resistance protein N-like           117   5e-29   
gb|KDO45460.1|  hypothetical protein CISIN_1g001889mg                   125   6e-29   
gb|KDO48212.1|  hypothetical protein CISIN_1g045657mg                   118   6e-29   
ref|XP_006441723.1|  hypothetical protein CICLE_v10024485mg             124   6e-29   
ref|XP_008245035.1|  PREDICTED: TMV resistance protein N-like           125   6e-29   
ref|XP_006371378.1|  hypothetical protein POPTR_0019s09620g             125   6e-29   
ref|XP_008237474.1|  PREDICTED: TMV resistance protein N-like iso...    125   6e-29   
gb|AEE43933.1|  TIR-NBS-LRR resistance protein muRdr1I                  123   6e-29   
ref|XP_008237473.1|  PREDICTED: TMV resistance protein N-like iso...    125   6e-29   
ref|XP_010645852.1|  PREDICTED: TMV resistance protein N-like           125   6e-29   
ref|XP_010665294.1|  PREDICTED: TMV resistance protein N-like           123   6e-29   
gb|AFP55568.1|  TIR-NBS-LRR                                             125   7e-29   
ref|XP_003596687.1|  Disease-resistance protein                         125   7e-29   
ref|XP_007226605.1|  hypothetical protein PRUPE_ppa023385mg             124   7e-29   
ref|XP_007219398.1|  hypothetical protein PRUPE_ppa020421mg             124   7e-29   
emb|CAN68293.1|  hypothetical protein VITISV_015601                     125   7e-29   
ref|XP_010424142.1|  PREDICTED: toll/interleukin-1 receptor-like ...    116   7e-29   
gb|KDO65742.1|  hypothetical protein CISIN_1g037332mg                   124   7e-29   
ref|XP_009794566.1|  PREDICTED: TMV resistance protein N-like iso...    124   7e-29   
ref|XP_010650307.1|  PREDICTED: TMV resistance protein N-like iso...    124   7e-29   
gb|KDO36469.1|  hypothetical protein CISIN_1g044631mg                   115   7e-29   
ref|XP_011013099.1|  PREDICTED: TMV resistance protein N-like iso...    124   7e-29   
gb|KCW59343.1|  hypothetical protein EUGRSUZ_H020322                    118   7e-29   
ref|XP_007227135.1|  hypothetical protein PRUPE_ppa026101mg             124   7e-29   
ref|XP_004510758.1|  PREDICTED: TMV resistance protein N-like           124   7e-29   
ref|XP_008339368.1|  PREDICTED: TMV resistance protein N-like           120   7e-29   
ref|XP_009794564.1|  PREDICTED: TMV resistance protein N-like iso...    124   7e-29   
ref|XP_010042882.1|  PREDICTED: TMV resistance protein N-like           117   7e-29   
gb|KEH38848.1|  disease resistance protein (TIR-NBS-LRR class), p...    124   7e-29   
ref|XP_010026474.1|  PREDICTED: TMV resistance protein N-like           117   7e-29   
ref|XP_008237445.1|  PREDICTED: TMV resistance protein N-like           124   8e-29   
ref|XP_002524855.1|  ATP binding protein, putative                      123   8e-29   
ref|XP_011004891.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    124   8e-29   
ref|XP_004289543.1|  PREDICTED: TMV resistance protein N-like           121   8e-29   
ref|XP_007218901.1|  hypothetical protein PRUPE_ppa000489mg             124   8e-29   
ref|XP_008352863.1|  PREDICTED: TMV resistance protein N-like           120   8e-29   
ref|XP_008227722.1|  PREDICTED: TMV resistance protein N-like           124   8e-29   
ref|XP_006355113.1|  PREDICTED: TMV resistance protein N-like iso...    124   8e-29   
ref|XP_011014417.1|  PREDICTED: TMV resistance protein N-like           124   8e-29   
ref|XP_009367206.1|  PREDICTED: TMV resistance protein N-like           124   8e-29   
ref|XP_007219240.1|  hypothetical protein PRUPE_ppa017503mg             124   8e-29   
ref|XP_010050315.1|  PREDICTED: TMV resistance protein N-like           117   8e-29   
ref|XP_010026496.1|  PREDICTED: TMV resistance protein N-like           118   8e-29   
ref|XP_006371047.1|  hypothetical protein POPTR_0019s02950g             123   8e-29   
gb|KDO37719.1|  hypothetical protein CISIN_1g040920mg                   116   8e-29   
ref|XP_007133979.1|  hypothetical protein PHAVU_010G008700g             124   9e-29   
ref|XP_011013098.1|  PREDICTED: TMV resistance protein N-like iso...    124   9e-29   
ref|XP_008349526.1|  PREDICTED: TMV resistance protein N-like           121   9e-29   
ref|XP_006355114.1|  PREDICTED: TMV resistance protein N-like iso...    124   9e-29   
gb|KEH30741.1|  disease resistance protein (TIR-NBS-LRR class), p...    124   9e-29   
ref|XP_006477663.1|  PREDICTED: putative disease resistance prote...    124   9e-29   
ref|XP_010109975.1|  TMV resistance protein N                           124   9e-29   
ref|XP_010646175.1|  PREDICTED: TMV resistance protein N-like           122   9e-29   
gb|ABF81468.1|  TIR-NBS-LRR type disease resistance protein             124   1e-28   
ref|XP_006359571.1|  PREDICTED: TMV resistance protein N-like           124   1e-28   
gb|AES66930.2|  disease resistance protein (TIR-NBS-LRR class), p...    124   1e-28   
gb|AES66938.2|  disease resistance protein (TIR-NBS-LRR class), p...    124   1e-28   
gb|KDO42946.1|  hypothetical protein CISIN_1g043319mg                   116   1e-28   
ref|NP_001241468.1|  TMV resistance protein N-like                      122   1e-28   
ref|XP_008342046.1|  PREDICTED: TMV resistance protein N-like           121   1e-28   
ref|XP_003596679.1|  TIR-NBS-LRR type disease resistance protein        124   1e-28   
ref|XP_006495239.1|  PREDICTED: TMV resistance protein N-like           121   1e-28   
gb|AAP44390.1|  nematode resistance protein                             124   1e-28   
gb|KCW59424.1|  hypothetical protein EUGRSUZ_H02148                     117   1e-28   
gb|KCW73676.1|  hypothetical protein EUGRSUZ_E02272                     124   1e-28   
ref|XP_011457355.1|  PREDICTED: TMV resistance protein N-like           124   1e-28   
ref|XP_010056739.1|  PREDICTED: TMV resistance protein N-like           124   1e-28   
gb|AAD25975.1|AF093648_2  flax rust resistance protein                  124   1e-28   
gb|AFP55538.1|  TIR-NBS-LRR                                             124   1e-28   
ref|XP_009367284.1|  PREDICTED: TMV resistance protein N-like           123   1e-28   
ref|XP_008234763.1|  PREDICTED: TMV resistance protein N-like           121   1e-28   
gb|KHG30618.1|  TMV resistance N                                        124   1e-28   
gb|AIE39587.1|  TIR-NBS-LRR disease resistance protein                  115   1e-28   
ref|XP_011470190.1|  PREDICTED: TMV resistance protein N-like iso...    123   1e-28   
ref|XP_003613524.1|  TIR-NBS disease resistance-like protein            119   1e-28   
gb|KDO45099.1|  hypothetical protein CISIN_1g036133mg                   116   1e-28   
ref|XP_010056815.1|  PREDICTED: TMV resistance protein N-like           124   1e-28   
ref|XP_008343950.1|  PREDICTED: TMV resistance protein N-like           116   1e-28   
emb|CAN65187.1|  hypothetical protein VITISV_026856                     115   1e-28   
ref|XP_009622249.1|  PREDICTED: TMV resistance protein N-like           124   1e-28   
ref|XP_008245201.1|  PREDICTED: TMV resistance protein N-like           124   1e-28   
ref|XP_002264704.2|  PREDICTED: TMV resistance protein N                124   1e-28   
ref|NP_001237821.1|  candidate disease-resistance protein               122   1e-28   
gb|KJB46064.1|  hypothetical protein B456_007G346900                    124   1e-28   
ref|XP_010059228.1|  PREDICTED: toll/interleukin-1 receptor-like ...    117   1e-28   
ref|XP_006492793.1|  PREDICTED: putative disease resistance prote...    124   1e-28   
ref|XP_010046178.1|  PREDICTED: TMV resistance protein N-like           123   1e-28   
ref|XP_011001265.1|  PREDICTED: TMV resistance protein N-like iso...    124   1e-28   
ref|XP_011001262.1|  PREDICTED: TMV resistance protein N-like iso...    124   1e-28   
emb|CAN62576.1|  hypothetical protein VITISV_038321                     124   2e-28   
ref|XP_006385250.1|  hypothetical protein POPTR_0003s02110g             124   2e-28   
gb|KHN09231.1|  TMV resistance protein N                                116   2e-28   
ref|XP_008219354.1|  PREDICTED: TMV resistance protein N-like           124   2e-28   
ref|XP_011001263.1|  PREDICTED: TMV resistance protein N-like iso...    124   2e-28   
gb|AAT37497.1|  N-like protein                                          123   2e-28   
ref|XP_010665341.1|  PREDICTED: TMV resistance protein N-like           124   2e-28   
ref|XP_011462221.1|  PREDICTED: TMV resistance protein N-like iso...    124   2e-28   
ref|XP_011001264.1|  PREDICTED: TMV resistance protein N-like iso...    123   2e-28   
ref|XP_007219576.1|  hypothetical protein PRUPE_ppa023253mg             115   2e-28   
gb|KDO42542.1|  hypothetical protein CISIN_1g042466mg                   116   2e-28   
ref|XP_010646831.1|  PREDICTED: TMV resistance protein N-like           116   2e-28   
ref|XP_011013492.1|  PREDICTED: TMV resistance protein N-like iso...    123   2e-28   
ref|XP_011462215.1|  PREDICTED: TMV resistance protein N-like iso...    124   2e-28   
ref|XP_011013491.1|  PREDICTED: TMV resistance protein N-like iso...    123   2e-28   
gb|KEH25109.1|  disease resistance protein (TIR-NBS-LRR class)          123   2e-28   
gb|KDP34368.1|  hypothetical protein JCGZ_11251                         123   2e-28   
ref|XP_006442210.1|  hypothetical protein CICLE_v10024233mg             124   2e-28   
ref|XP_011028425.1|  PREDICTED: TMV resistance protein N-like iso...    116   2e-28   
ref|XP_011457567.1|  PREDICTED: TMV resistance protein N-like           117   2e-28   
ref|XP_007210472.1|  hypothetical protein PRUPE_ppa024249mg             123   2e-28   
ref|XP_010058913.1|  PREDICTED: TMV resistance protein N-like           115   2e-28   
ref|XP_007226787.1|  hypothetical protein PRUPE_ppa017983mg             123   2e-28   
gb|ABB82029.1|  TIR-NBS disease resistance-like protein                 123   2e-28   
gb|AAP44392.1|  nematode resistance-like protein                        123   2e-28   
ref|XP_010057476.1|  PREDICTED: toll/interleukin-1 receptor-like ...    116   2e-28   
ref|XP_008227563.1|  PREDICTED: TMV resistance protein N-like           123   2e-28   
ref|XP_006371041.1|  hypothetical protein POPTR_0019s02900g             123   2e-28   
gb|KEH25086.1|  disease resistance protein (TIR-NBS-LRR class)          123   2e-28   
ref|XP_006358561.1|  PREDICTED: TMV resistance protein N-like           116   2e-28   
ref|XP_011002553.1|  PREDICTED: TMV resistance protein N-like           123   2e-28   
emb|CAD56833.1|  putative resistance gene analogue protein              122   2e-28   
ref|XP_011013790.1|  PREDICTED: TMV resistance protein N-like           116   2e-28   
ref|XP_010026217.1|  PREDICTED: TMV resistance protein N-like           123   2e-28   
ref|XP_006367168.1|  PREDICTED: TMV resistance protein N-like           115   2e-28   
emb|CAD36200.1|  TIR-NBS disease resistance protein                     121   2e-28   
gb|KCW59235.1|  hypothetical protein EUGRSUZ_H01903                     115   2e-28   
ref|XP_008238088.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    123   2e-28   
ref|XP_011013490.1|  PREDICTED: TMV resistance protein N-like iso...    123   2e-28   
ref|XP_002518715.1|  leucine-rich repeat-containing protein, puta...    123   2e-28   
ref|XP_010039689.1|  PREDICTED: probable WRKY transcription facto...    120   2e-28   
ref|XP_011457584.1|  PREDICTED: TMV resistance protein N-like           115   2e-28   
ref|XP_006371520.1|  hypothetical protein POPTR_0019s12730g             120   2e-28   



>ref|XP_006342406.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=282

 Score =   148 bits (374),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 2/129 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DTC  F+ +LY +LE++GIRTFKDD+RLE G  IS  LLKAIQESKF I IFS
Sbjct  15   FLSFRGEDTCRNFVSHLYNALEQRGIRTFKDDERLETGKSISDELLKAIQESKFAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCLEELA I++ ++ L EQ+V+P+   V  SDV +Q   F DSF +  EK  K
Sbjct  75   KSYASSRWCLEELAHIIKCKKEL-EQIVIPVFYDVSQSDVCHQHPPFADSFLQHEEKC-K  132

Query  581  DDEEKVRRW  607
            DD EKV+RW
Sbjct  133  DDMEKVQRW  141



>emb|CBI17021.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L  KGIRTF+DD +L++G+ I+P LLK I+ES+  I +FS
Sbjct  20   FLSFRGEDTRYKFTDHLYAALVNKGIRTFRDD-KLKRGEEIAPLLLKVIEESRLSIVVFS  78

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IME ++ ++ Q++VPI  +V+PSD++ QKGSFE SF    E+ G+
Sbjct  79   ENYASSRWCLDELVKIMECRQKIR-QILVPIFYHVDPSDLRTQKGSFEKSFASH-ERHGR  136

Query  581  DDEEKVRRWK  610
            D +EK++RW+
Sbjct  137  DSKEKIQRWR  146



>ref|XP_006342678.1| PREDICTED: uncharacterized protein LOC102595828 [Solanum tuberosum]
Length=766

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 95/130 (73%), Gaps = 6/130 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+ +LY SLE +GIRTFKDD+RLE G  IS  LLKAIQESKF I IFS
Sbjct  15   FLSFRGEDTRRNFVSHLYNSLELRGIRTFKDDERLETGKSISDDLLKAIQESKFSIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+ELA I++ ++ L EQ+V+P+   V PSDV++Q   F+DSF +      K
Sbjct  75   KSYASSRWCLKELAHIIKCKKEL-EQIVIPVFYDVSPSDVRHQNPPFDDSFSQ-----HK  128

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  129  DDMEKVQRWR  138



>ref|XP_006342676.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=160

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +LY +L +  I  FKDD+RLE G+ IS  L KAI+ESKF I IFS
Sbjct  15   FLSFRGEDTRKTFVSHLYNALIQGRIDVFKDDERLETGNSISDELPKAIEESKFAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+ELA I++ ++ LK Q+V+PI   V+PSDV++Q  +F +SF +  EK  K
Sbjct  75   ESYASSKWCLDELAHIIKCRKELK-QIVIPIFYNVDPSDVRHQTQTFAESFSQHEEKY-K  132

Query  581  DDEEKVRRWKE  613
            DD EK++RW++
Sbjct  133  DDMEKIQRWRD  143



>ref|XP_009613117.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613118.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=426

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F+ +LY +LE++GI  FKDDDRLE G  IS  LLKAI+ES+F + IFS
Sbjct  15   FLSFRGEDTRKNFVSHLYNALEQRGIHAFKDDDRLETGKSISYELLKAIEESRFAVVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWC EELA I++ Q  L EQ V+PI   V PSDV++Q   F +SF +  EK  K
Sbjct  75   KSYASSKWCSEELAHIIKCQSEL-EQTVIPIFYDVSPSDVRHQNPPFAESFSQHEEKY-K  132

Query  581  DDEEKVRRWKE  613
            DD EKV+RW++
Sbjct  133  DDMEKVQRWRD  143



>ref|XP_006367322.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=320

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 93/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF+ +LY +LE +GI TFKDD+RLE G  IS  LLKAI+E++F + IFS
Sbjct  53   FLSFRGEDTRRTFVSHLYKALELRGIHTFKDDERLEAGQSISAELLKAIEEARFAVVIFS  112

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCLEELA I++ ++ L EQ+V+P+     PSDV++Q   F DSF +   K  K
Sbjct  113  KSYASSRWCLEELAHIIKCKKEL-EQIVIPVFYDASPSDVRHQNPPFADSFSQHEVKY-K  170

Query  581  DDEEKVRRWK  610
            D  EKV+RW+
Sbjct  171  DAMEKVQRWR  180



>ref|XP_006441742.1| hypothetical protein CICLE_v10024129mg [Citrus clementina]
 gb|ESR54982.1| hypothetical protein CICLE_v10024129mg [Citrus clementina]
Length=238

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT ++FI +LY +L  KGI  FKDD  LEKG+ ISP LLKAI+ S+  I +FS
Sbjct  17   FLSFRGADTRKSFISHLYAALNGKGIYVFKDDKELEKGESISPRLLKAIEASRIAIIVFS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  I++ +    ++MV PI   VEP+ V+NQ G+F+++F + VE + K
Sbjct  77   KNYASSTWCLDELVHILDCKNKNAQRMVYPIFYDVEPTVVRNQTGNFQEAFAKHVE-VFK  135

Query  581  DDEEKVRRWKE  613
               EKV++W+E
Sbjct  136  KSIEKVQKWRE  146



>ref|XP_004253017.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=195

 Score =   133 bits (334),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF+ +LY +LE++GI  FKDD+RLE G  IS  LLKAI++++F + +FS
Sbjct  15   FLSFRGEDTRRTFVSHLYNALEQRGIHAFKDDERLEAGQSISAELLKAIEDARFAVVVFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDS-FKELVEKIG  577
            K YA S+ CLEELA I++ +  L EQ+V+P+   V PS+V++Q   F DS F+  VE   
Sbjct  75   KSYASSRRCLEELAHIIKCKMEL-EQVVIPVFYDVSPSNVRHQNSPFADSFFQHEVEY--  131

Query  578  KDDEEKVRRWK  610
            KDD EKV+RW+
Sbjct  132  KDDMEKVQRWR  142



>ref|XP_006342684.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-like [Solanum tuberosum]
Length=380

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF+ +LY +L +  I  FKDD+RL+ G  IS  L KAI+ESKF I IFS
Sbjct  15   FLSFRGEDTRRTFVSHLYNALIQGRIDVFKDDERLQTGKSISDELPKAIEESKFAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+ELA IM+ Q+ LK Q+V+PI   V+PSDV++Q  +F +SF +  EK  K
Sbjct  75   ESYASSKWCLDELAHIMKCQKELK-QIVIPIFYNVDPSDVRHQTQTFAESFSQHEEKY-K  132

Query  581  DDEEKVRRWKE  613
            DD EK++RW+E
Sbjct  133  DDIEKIQRWRE  143



>ref|XP_006342679.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=1028

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+ +LY SLE +GIRTFKDD+RLE G  IS  LLKAIQESKF I IFS
Sbjct  15   FLSFRGEDTRRNFVSHLYNSLELRGIRTFKDDERLETGKSISDELLKAIQESKFAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+ELA I++ ++ L EQ+V+P+   V  SDV +Q   F DSF +  EK  K
Sbjct  75   KSYASSRWCLKELAHIIKCKKEL-EQIVIPVFYDVSQSDVCHQHPPFADSFLQHEEKC-K  132

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  133  DDMEKVQRWR  142



>ref|XP_010650243.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=225

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L   GI+TF+DD+ LEKG  I+  LL+AI+ES+F I +FS
Sbjct  23   FLSFRGGDTRRNFTDHLYTTLTASGIQTFRDDEELEKGGDIASDLLRAIEESRFFIIVFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+ER+   KE +V+PI  +V+PSDV+NQ+GSF D+         +
Sbjct  83   KNYAYSRWCLNELVKIIERKSQ-KESVVLPIFYHVDPSDVRNQRGSFGDALAYHERDANQ  141

Query  581  DDEEKVRRW  607
            + +E ++++
Sbjct  142  EKKEMIQKY  150



>gb|KDO38417.1| hypothetical protein CISIN_1g036738mg, partial [Citrus sinensis]
Length=364

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + FI +LY +L  KGI  FKDD+ LEKG+ ISP LLKAI+ S+  I +FS
Sbjct  17   FLSFRGADTRKNFISHLYAALNGKGIYVFKDDEELEKGESISPRLLKAIEASRIAIIVFS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  I++ +    ++MV PI   VEP+ V+NQ G+F+++F + VE + K
Sbjct  77   KNYASSTWCLDELVHILDCKNKNAQRMVYPIFYDVEPTVVRNQTGNFQEAFAKHVE-VFK  135

Query  581  DDEEKVRRWKE  613
               EKV++W+E
Sbjct  136  KSIEKVQKWRE  146



>ref|XP_007221062.1| hypothetical protein PRUPE_ppa016235mg [Prunus persica]
 gb|EMJ22261.1| hypothetical protein PRUPE_ppa016235mg [Prunus persica]
Length=237

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLS+RG DT +TFID+LY +L+R+GI TF DD+ L +G+ ISP+LL AI+ESK  + +FS
Sbjct  36   FLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDE-LPRGEEISPALLNAIEESKISVIVFS  94

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E +++ K+Q+V+PI   V+PSDV+NQ+ SF D+  +   K  K
Sbjct  95   ENYASSSWCLDELVKILEYKKS-KQQLVMPIFYKVDPSDVRNQRSSFGDALVDHEHKF-K  152

Query  581  DDEEKVRRWK  610
            DD EKV  W+
Sbjct  153  DDMEKVLEWR  162



>ref|XP_006342554.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Solanum tuberosum]
Length=706

 Score =   138 bits (348),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 7/132 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+ +LY +LE++GI  FKDD+RLE G  I   L+KAI+ES+F I IFS
Sbjct  15   FLSFRGIDTRRNFVSHLYNALEQRGIDVFKDDERLETGKSIPNELMKAIEESRFAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCLEELA I++ +  L +Q+V+PI   V PSDV +Q   F +SF +      K
Sbjct  75   ESYASSRWCLEELAHIIKCRNEL-DQIVIPIFYDVSPSDVSHQNSPFAESFSKY-----K  128

Query  581  DDE-EKVRRWKE  613
            DDE EKV+RW+E
Sbjct  129  DDELEKVQRWRE  140



>gb|AAL07542.1| resistance gene analog NBS7 [Helianthus annuus]
Length=259

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 96/131 (73%), Gaps = 5/131 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT ++F+D+LY +LE++GI T+KDD+ L +G+ I P+LLKAIQES+  + +FS
Sbjct  25   FLSFRGDDTRKSFVDHLYTALEQRGIYTYKDDETLPRGESIGPALLKAIQESRVAVIVFS  84

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+ELA IME  +  + Q+V+PI  +V+PSDV+ QKG + ++F     K  +
Sbjct  85   KNYADSSWCLDELAHIMECMDT-RGQIVMPIFYHVDPSDVRKQKGKYGEAFT----KHER  139

Query  581  DDEEKVRRWKE  613
            +++ KV  W++
Sbjct  140  ENKLKVESWRK  150



>ref|XP_008228037.1| PREDICTED: TMV resistance protein N-like, partial [Prunus mume]
Length=490

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +LE  GI TF+DDD +E+G  IS  L KAIQES+  I +FS
Sbjct  20   FLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL TIM+R+E   E MV+PI   V+PS V+NQ G FE++F    ++  K
Sbjct  80   KDYASSRWCLDELVTIMDRRET-NEHMVMPIFYDVDPSHVRNQTGIFEEAFARHQQRFNK  138

Query  581  DDEEKVRRWKE  613
             + +KV +WK+
Sbjct  139  -EMDKVEKWKK  148



>ref|XP_006367018.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=156

 Score =   129 bits (324),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 89/130 (68%), Gaps = 6/130 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF+ +L+ +LE+ GI  FKDD+RLE G  IS  LLKAI+ESK  I IFS
Sbjct  15   FLSFRGEDTRRTFVSHLHKALEQSGICIFKDDERLETGKSISNELLKAIEESKIAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K Y  S+WCLEELA I++ +  L E +V+P+   V PSDV++Q   F DSF +      K
Sbjct  75   KSYESSRWCLEELAHIIKCKNEL-ELIVIPVFYDVTPSDVRHQNTPFADSFLQY-----K  128

Query  581  DDEEKVRRWK  610
            DD +KV+RW+
Sbjct  129  DDMDKVQRWR  138



>ref|XP_006367324.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=871

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 95/132 (72%), Gaps = 6/132 (5%)
 Frame = +2

Query  218  FFLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIF  397
             FLSFRG DT  TF+ +LY +LE++GI TFKDD+ LE G  IS  LLKAI++++F + IF
Sbjct  19   IFLSFRGEDTRRTFVSHLYKALEQRGIHTFKDDEWLEAGKSISAELLKAIEDARFAVVIF  78

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            SK YA S+WCLEELA I++ ++ L EQ+V+P+   V PSDV++Q   F DSF +      
Sbjct  79   SKSYASSRWCLEELAHIIKCKKEL-EQIVIPVFYDVSPSDVRHQNPPFADSFSQ-----H  132

Query  578  KDDEEKVRRWKE  613
            KDD EKV+RW++
Sbjct  133  KDDMEKVQRWRD  144



>ref|XP_008343157.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=165

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 88/130 (68%), Gaps = 0/130 (0%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +LE+ GI TF+DDD +E+G+ I   L KAIQES+  I +FS
Sbjct  19   FLSFRGPDTRKGFTDHLYIALEQAGIHTFRDDDEIERGENIELELDKAIQESQVSIIVFS  78

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+ER+   +   V+P+   V+PSDV+ Q GSF ++F    E+   
Sbjct  79   KXYASSRWCLNELXKIVERRNTDRRHXVLPVFYDVDPSDVRKQSGSFAEAFARHEERFST  138

Query  581  DDEEKVRRWK  610
            ++ +KV +W+
Sbjct  139  EEMDKVEQWR  148



>ref|XP_008236760.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=171

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ SL+RKGI TF D+D LE+G  ISP LLKAIQ S   + IFS
Sbjct  27   FLSFRGEDTRYNFTDHLHSSLDRKGINTFIDNDELERGTDISPVLLKAIQGSMISLIIFS  86

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA I++ +E LK+Q+V PI   V+PS V++Q+GSF ++     E   K
Sbjct  87   ENYASSTWCLDELAHIIQCRE-LKQQLVFPIFYKVDPSHVRHQRGSFGEAIANH-ECNFK  144

Query  581  DDEEKVRRWK  610
            +D  KV RWK
Sbjct  145  NDMNKVLRWK  154



>ref|XP_009599523.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599524.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599525.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599526.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1398

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F+ +LY +L+++GI  FKDD+RLE G  IS  LLKAI++S+F + IFS
Sbjct  15   FLSFRGEDTRKNFVSHLYNALKQRGIDVFKDDERLETGKPISDELLKAIEDSRFAVVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCLEELA I++ Q  L EQ V+PI   V PSDV++Q   F +SF +  EK  K
Sbjct  75   KSYASSRWCLEELAHIIKCQNEL-EQTVIPIFYDVSPSDVRHQNPPFAESFSQHEEKY-K  132

Query  581  DDEEKVRRWKE  613
            DD EKV+RW++
Sbjct  133  DDMEKVQRWRD  143



>ref|XP_010323796.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=160

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSF G DT  TF+ +LY +LE++GI  FKDD+RLE G  I   LLKAI++++F + IFS
Sbjct  15   FLSFGGEDTRRTFVSHLYNALEQRGIHAFKDDERLEAGQSIFAELLKAIEDARFAVVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCLEEL  I++ +  L EQ V+P+   V P+DV++Q     DSF +   K  K
Sbjct  75   KSYASSRWCLEELVHIIKCKNEL-EQAVIPVFYDVSPADVRHQNSPSVDSFFQHEVKY-K  132

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  133  DDMEKVQRWR  142



>ref|XP_011462237.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+ +L+ +L RKGIRTF DDD L +G  IS  L KAI+ESK  I +FS
Sbjct  26   FLSFRGDDTRNNFVAHLHSNLIRKGIRTFLDDDGLRRGVEISSELHKAIEESKVSIVVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCLEEL  I+E +E+ K+QMV P+   V+PSDV+NQ GSF  +  +  E   K
Sbjct  86   ETYASSKWCLEELVKILECKES-KKQMVYPVFYKVDPSDVRNQNGSFGKALADH-ECTFK  143

Query  581  DDEEKVRRWKE  613
            D  EKV RW+E
Sbjct  144  DRLEKVVRWRE  154



>ref|XP_010646756.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=519

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FL+FRG DT   F D+LY  L R GIRTF+DD+ LE+G  I PSLLKAI++S   + +FS
Sbjct  25   FLNFRGEDTRFNFTDHLYKKLRRTGIRTFRDDEGLERGGEIQPSLLKAIEDSSISVVVFS  84

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  IM+  E  K Q+V+P+  +V+PSDV+ Q+GSF ++F       G+
Sbjct  85   KNYAHSKWCLDELDKIMQSME--KGQLVLPVFYHVDPSDVRKQRGSFGEAFA----GYGE  138

Query  581  DDEEKVRRWK  610
              EE+V+RWK
Sbjct  139  VAEERVQRWK  148



>pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease 
Resistance Protein L6
 pdb|3OZI|B Chain B, Crystal Structure Of The Tir Domain From The Flax Disease 
Resistance Protein L6
Length=204

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT E F D+LY SL R  I TF+DDD L KG  I P+LL+AI +SK  + I S
Sbjct  39   FLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIIS  98

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
             GYA SKWCL ELA I+ RQE    ++++PI   V+PSDV++Q G ++ +F++   K   
Sbjct  99   SGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKF--  156

Query  581  DDEEKVRRWKE  613
             D + ++ WK+
Sbjct  157  -DGQTIQNWKD  166



>ref|XP_010665295.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=136

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L  +GI TF+DD+ LE+G  I PSLLKAI+ESK  I +FS
Sbjct  16   FLSFRGEDTRFNFTDHLYSALTSRGIHTFRDDEGLERGGEIQPSLLKAIEESKVSIVVFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSF  553
            K YA S+WCL+EL  IME +   K Q+VVP+  +V+PSDV+ Q GSF  +F
Sbjct  76   KNYAHSQWCLDELYKIMESRRE-KGQIVVPVFYHVDPSDVRKQTGSFGKAF  125



>emb|CCW28746.1| TIR NB-ARC LRR protein, partial [Arachis duranensis]
Length=903

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY SL+RKGI  F+DD  LE+G+ IS  LL+AI+ES F + + S
Sbjct  24   FLSFRGQDTRKGFTDHLYASLQRKGITNFRDDMNLERGEVISHELLRAIEESMFAVVVLS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL+EL  I+E + NL  Q +VP+   V+P DV++QKG+FED+F++  E+ G 
Sbjct  84   PNYASSPWCLDELQKIVECKNNLGLQ-IVPVFYGVDPCDVRHQKGTFEDAFRKQEERFG-  141

Query  581  DDEEKVRRWKE  613
             D EKV+RW++
Sbjct  142  GDSEKVKRWRD  152



>ref|XP_010650207.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010650208.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1602

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L   GI+TF+DD+ LEKG  I+  LL+AI+ES+F I IFS
Sbjct  23   FLSFRGGDTRKNFTDHLYTTLTASGIQTFRDDEELEKGGDIASDLLRAIEESRFFIIIFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+ER+   KE MV+PI  +V+PSDV+NQ+GSF D+         +
Sbjct  83   KNYAYSRWCLNELVKIIERKSQ-KESMVLPIFYHVDPSDVRNQRGSFGDALAYHERDANQ  141

Query  581  DDEEKVRRWK  610
            + +E +++W+
Sbjct  142  EKKEMIQKWR  151



>ref|XP_006371051.1| hypothetical protein POPTR_0019s02990g, partial [Populus trichocarpa]
 gb|ERP48848.1| hypothetical protein POPTR_0019s02990g, partial [Populus trichocarpa]
Length=212

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L++ GI TF+DDD L +G+ IS  LLKAI+ESK  I +FS
Sbjct  18   FLSFRGEDTRKTFTDHLYAALDQAGIHTFRDDDELPRGEEISEHLLKAIRESKISIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +     Q+V+PI   ++PSDV+ Q GSF ++F +  E+   
Sbjct  78   KGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEERF--  135

Query  581  DDEEKVRRWK  610
             +E+ V+ W+
Sbjct  136  -EEKLVKEWR  144



>ref|XP_010665222.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=318

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFR  DT   F D+LY +L  + IRTF+DD +L++G+ I+P LLK I+ES+  I +FS
Sbjct  23   FLSFRAEDTRYKFTDHLYAALRNRSIRTFRDD-KLKRGEEIAPELLKVIEESRLSIVVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IME ++ ++ Q+VVPI  +V+PSD++ QKGSF  +F    E+ G+
Sbjct  82   ENYASSRWCLDELVKIMECRQKIR-QIVVPIFYHVDPSDLRKQKGSFGKAFASY-ERHGR  139

Query  581  DDEEKVRRWK  610
            D +EK++RW+
Sbjct  140  DSKEKIQRWR  149



>ref|XP_006492482.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=164

 Score =   127 bits (319),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT ++FI +LY +L  KGI  FKDD  LE+G  ISP LLKAI++S+  I +FS
Sbjct  17   FLSFRGADTRKSFISHLYAALNGKGIYVFKDDKELERGASISPGLLKAIEDSRISIIVFS  76

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S WCL+EL  I++ + +N  +QM+ PI   VEP+ V+ Q GSF ++F +  E+  
Sbjct  77   QNYASSTWCLDELVKIVQCKNKNDHQQMIFPIFYDVEPTVVRKQTGSFREAFSKH-EEAY  135

Query  578  KDDEEKVRRWKE  613
            +++ EKV+ W++
Sbjct  136  RENLEKVKNWRD  147



>ref|XP_010650203.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 gb|AGF69191.1| TMV resistance protein N-like protein 5 [Vitis labrusca]
Length=587

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L   GI +FKDD+ LEKG  I+  LL+AI+ES+  I IFS
Sbjct  22   FLSFRGGDTRKNFTDHLYTTLTAYGIHSFKDDEELEKGGDIASDLLRAIEESRIFIIIFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+ER+   KE +V+PI  +V+PSDV+NQKGSF D+         +
Sbjct  82   KNYAYSRWCLNELVKIIERKSQ-KESLVLPIFYHVDPSDVRNQKGSFGDALACHERDANQ  140

Query  581  DDEEKVRRWK  610
            + +E V++W+
Sbjct  141  EKKEMVQKWR  150



>emb|CAN82451.1| hypothetical protein VITISV_003325 [Vitis vinifera]
Length=162

 Score =   127 bits (318),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FL+FRG+DT   F D+LY  L +  +RTF+DD+ LE+GD I+P LLKAI++S+  I +FS
Sbjct  16   FLNFRGADTRYHFTDHLYSELRKNDVRTFRDDEELERGDVIAPGLLKAIEQSRISIVVFS  75

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S+WCL+EL  I+E R E  +EQ+V+P+  +V+PS V+ Q GS+ ++F +  +   
Sbjct  76   ENYAQSRWCLDELVKIIECRTE--REQIVLPVFYHVDPSHVRKQMGSYGEAFADHEKDAD  133

Query  578  KDDEEKVRRWK  610
                EK+++W+
Sbjct  134  LKKREKIQKWR  144



>ref|XP_011015316.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=173

 Score =   127 bits (319),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L + GI TF+DD+ L +G+ ISP LLKAI+ S+  I +FS
Sbjct  26   FLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLLKAIEGSRISIVVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  I+E ++ + +Q+V+PI    EPSDV+ Q GS+  +F E  E+  K
Sbjct  86   KHYASSRWCLDELVKILECRQKI-DQVVLPIFYDTEPSDVRKQTGSYAKAFDEHEERF-K  143

Query  581  DDEEKVRRWK  610
            ++ EKV +W+
Sbjct  144  EETEKVNKWR  153



>ref|XP_009628590.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1337

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +LY +L+ KG+ TFKDD RLE+G  ISP L+KAI++S+F I +FS
Sbjct  16   FLSFRGKDTRKTFVGHLYYALKHKGVHTFKDDVRLERGKSISPELVKAIEQSRFAIVVFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  IM+ ++ L  Q V+PI   V+PSDV  Q G+F +SF    E   +
Sbjct  76   KNYASSTWCLDELVKIMKCKKELG-QTVIPIFYDVDPSDVSKQSGTFAESFARHEENF-R  133

Query  581  DDEEKVRRWKE  613
            DD EKV+ W++
Sbjct  134  DDLEKVQSWRD  144



>ref|XP_009628589.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1364

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +LY +L+ KG+ TFKDD RLE+G  ISP L+KAI++S+F I +FS
Sbjct  16   FLSFRGKDTRKTFVGHLYYALKHKGVHTFKDDVRLERGKSISPELVKAIEQSRFAIVVFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  IM+ ++ L  Q V+PI   V+PSDV  Q G+F +SF    E   +
Sbjct  76   KNYASSTWCLDELVKIMKCKKELG-QTVIPIFYDVDPSDVSKQSGTFAESFARHEENF-R  133

Query  581  DDEEKVRRWKE  613
            DD EKV+ W++
Sbjct  134  DDLEKVQSWRD  144



>ref|XP_006342412.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-like [Solanum tuberosum]
Length=378

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D   TF+ +L+ +L + GI  FKDD+RLE G  IS  L KAI+ESKF I IFS
Sbjct  15   FLSFRGVDIRRTFVSHLHNALIQGGINVFKDDERLETGKLISDELPKAIEESKFAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+ELA I++ ++ L +Q+V+PI   V+PSDV++Q  +F +SF +  EK  K
Sbjct  75   ESYASSKWCLDELAHIIKCRKEL-DQIVIPIFYNVDPSDVRHQTQTFAESFTKHEEKY-K  132

Query  581  DDEEKVRRWKE  613
            DD EK++RW++
Sbjct  133  DDMEKIQRWRD  143



>ref|XP_007216844.1| hypothetical protein PRUPE_ppa022061mg, partial [Prunus persica]
 gb|EMJ18043.1| hypothetical protein PRUPE_ppa022061mg, partial [Prunus persica]
Length=163

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +LE  GI TFKDD  L+KG  ISP L  AI+ESKF + + S
Sbjct  21   FLSFRGDDTWKRFTDHLYTALESHGIITFKDDPELQKGKPISPELFSAIEESKFALILLS  80

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E  E    + V+PI   V+PSDV+ Q GSF  +F +  E   K
Sbjct  81   ENYASSTWCLDELLQILEFME--ARETVLPIFYNVDPSDVRKQTGSFTQAFIKHEENF-K  137

Query  581  DDEEKVRRWK  610
            DD++KV+RW+
Sbjct  138  DDKKKVQRWR  147



>gb|AAN73010.1| NBS-LRR resistance protein RAS5-1 [Helianthus annuus]
Length=448

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 94/131 (72%), Gaps = 5/131 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +F+D+LY +L ++GI+ +KDD+ L +G+ I P+LLKAIQES+  + +FS
Sbjct  87   FLSFRGEDTRNSFVDHLYAALAQQGIQAYKDDETLPRGERIGPALLKAIQESRIAVVVFS  146

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA IME  +  + Q+V+PI  +V+PSDV+ QKG +  +F+    K  +
Sbjct  147  QNYADSSWCLDELAHIMECMDT-RGQIVIPIFYFVDPSDVRKQKGKYGKAFR----KRKR  201

Query  581  DDEEKVRRWKE  613
            ++ +KV  W++
Sbjct  202  ENRQKVESWRK  212



>ref|XP_006442760.1| hypothetical protein CICLE_v10023793mg, partial [Citrus clementina]
 gb|ESR56000.1| hypothetical protein CICLE_v10023793mg, partial [Citrus clementina]
Length=163

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +L+ +L RK I+ F D++   +GD IS +LL AI+ SK  + IFS
Sbjct  20   FLSFRGEDTRDNFTSHLFAALRRKRIKIFIDEEA-NRGDEISLALLNAIEGSKISVVIFS  78

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  I+E  +NL  QMVVP+  +V PSDV+NQ GSF D+F +L EK  K
Sbjct  79   KNYASSKWCLDELVKILE-SKNLSGQMVVPVFYHVHPSDVRNQTGSFGDAFVKL-EKQFK  136

Query  581  DDEEKVRRW  607
            +  EKV +W
Sbjct  137  ELPEKVHKW  145



>ref|XP_002316582.2| hypothetical protein POPTR_0011s01660g, partial [Populus trichocarpa]
 gb|EEE97194.2| hypothetical protein POPTR_0011s01660g, partial [Populus trichocarpa]
Length=152

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +2

Query  218  FFLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIF  397
             FLSFRG DT + F D+LY +L   G  TF+DDD + +G  I   L KAIQ+SK  I +F
Sbjct  8    LFLSFRGEDTRKNFTDHLYKALVDAGFHTFRDDDEIRRGKNIQLELQKAIQQSKIAIIVF  67

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            SK YA S+WCL+EL  IMER  N  + +V P+  +V+PS+V+NQ GSF  +F E  EK  
Sbjct  68   SKNYAWSRWCLDELVKIMERNRN-ADCIVFPVFYHVDPSEVRNQNGSFAAAFVEH-EKHY  125

Query  578  KDDEEKVRRWK  610
            K++ E+V  W+
Sbjct  126  KEEMERVNGWR  136



>gb|AEL30358.1| TIR disease resistance protein [Arachis hypogaea]
Length=166

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 87/131 (66%), Gaps = 4/131 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY +L RKGI T+KDD  L KG  IS  LLKAI+ES F + +FS
Sbjct  24   FLSFRGEDTRTGFTGHLYAALNRKGITTYKDDQNLRKGHVISKELLKAIEESMFAVIVFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL+EL  IME    + +Q +VP+   VEP DV++Q G+F ++FK+  +   +
Sbjct  84   PDYASSSWCLDELQKIMECNNKVGQQ-IVPVFYDVEPCDVRHQIGTFHEAFKKHEQ---R  139

Query  581  DDEEKVRRWKE  613
             + EK++RW++
Sbjct  140  HNREKIKRWRD  150



>ref|XP_008233348.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=540

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +LE  GI TF+DDD +E+G  I   L KAIQES+  I +FS
Sbjct  20   FLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANILAELQKAIQESRVSIIVFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL TIM+R+E   E MV+PI   V+PS V+NQ G FE++F    ++  K
Sbjct  80   KDYASSRWCLDELVTIMDRRET-NEHMVMPIFYDVDPSHVRNQTGIFEEAFARHQQRFNK  138

Query  581  DDEEKVRRWKE  613
             + +KV +W++
Sbjct  139  -EMDKVEKWRK  148



>ref|XP_004246918.2| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1079

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 5/130 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF+ +LY +LE+ GIR FKDD+RLE+G  I   LLKAI+ESK  I IFS
Sbjct  15   FLSFRGEDTRRTFVSHLYKALEQSGIRIFKDDERLERGKPIFDELLKAIEESKIAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCLEELA I++ +  L E +V+P+   V PSDV++Q   F DSF + +    K
Sbjct  75   KSYASSRWCLEELAHIIKCRNEL-ELIVIPVFYDVTPSDVRHQNPPFADSFLQYM----K  129

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  130  DDMEKVQRWR  139



>gb|KEH23209.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1129

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            F+SFRGSDT  +F+D+LY  L RKGI TFKDD +L+KG+ ISP LL+AIQ+S+  I +FS
Sbjct  46   FISFRGSDTRNSFVDHLYAHLNRKGIFTFKDDKQLQKGEAISPQLLQAIQQSRISIVVFS  105

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+E+A I E + NLK Q+V P+   V+PS V+ Q G +E++F    E   K
Sbjct  106  KDYASSTWCLDEMAAISESRINLK-QVVFPVFYDVDPSHVKKQNGVYENAFVLHTEAF-K  163

Query  581  DDEEKVRRWK  610
             +  KV RW+
Sbjct  164  HNSGKVARWR  173



>gb|AAL07537.1| resistance gene analog NBS2 [Helianthus annuus]
Length=226

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 89/131 (68%), Gaps = 5/131 (4%)
 Frame = +2

Query  218  FFLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIF  397
             FLSFRG DT   F+D+LY  L ++GI+T+KDD+ L +G+ I P+LLKAIQES   + +F
Sbjct  39   VFLSFRGEDTRRNFVDHLYKDLAQQGIQTYKDDETLPRGERIGPALLKAIQESHIAVVVF  98

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            S+ YA S WCL+ELA IME  +   EQ+V+P+  +V PSDV+NQKG +  +      K  
Sbjct  99   SQNYADSSWCLDELAHIMECMDP-SEQIVMPVFYHVNPSDVRNQKGKYGKALS----KHE  153

Query  578  KDDEEKVRRWK  610
            + +++KV  W+
Sbjct  154  RKNKQKVESWR  164



>ref|XP_004253023.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-like [Solanum lycopersicum]
Length=380

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  +TF+ +LY +L ++GI  FKDD+RLE G  IS  LLKAI+ESKF I IFS
Sbjct  15   FLSFRGVDIRKTFVSHLYNALVQRGINVFKDDERLETGKSISDELLKAIEESKFAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL ELA I++ ++ L +  ++PI   V PSDV +Q  SF +SF +  E+  K
Sbjct  75   ESYASSKWCLNELAHIIKCRKEL-DLTLIPIFFDVNPSDVSHQTQSFAESFSKHEEQY-K  132

Query  581  DDEEKVRRWKE  613
            DD EK+ RW++
Sbjct  133  DDMEKIHRWRD  143



>ref|XP_010650202.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1507

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L   GI+TF+DD+ LEKG  I+  LL+AI+ES+F I IFS
Sbjct  23   FLSFRGGDTRRNFTDHLYTTLTASGIQTFRDDEELEKGGDIASDLLRAIEESRFFIIIFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+ER+   KE +V+PI  +V+PSDV+NQ+GSF D+         +
Sbjct  83   KNYAYSRWCLNELVKIIERKSQ-KESVVLPIFYHVDPSDVRNQRGSFGDALAYHERDANQ  141

Query  581  DDEEKVRRWK  610
            + +E +++W+
Sbjct  142  EKKEMIQKWR  151



>ref|XP_008222878.1| PREDICTED: TMV resistance protein N-like, partial [Prunus mume]
Length=558

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY +L ++GI TF DDD L +G+ IS +LL AI++SK  + +FS
Sbjct  26   FLSFRGLDTRSNFTGHLYNALCQQGINTFMDDDELRRGEEISSTLLTAIEDSKIFVVVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCLEEL  I++ +++ ++Q+V+P+   V PSDV+N +GSF D+    VE   K
Sbjct  86   KNYASSKWCLEELVKILDCKKS-EQQLVIPVFYKVNPSDVRNHRGSFGDALAN-VECKYK  143

Query  581  DDEEKVRRWKE  613
            D+ EKV+RW+E
Sbjct  144  DNMEKVKRWRE  154



>gb|KDO39318.1| hypothetical protein CISIN_1g031151mg [Citrus sinensis]
Length=165

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +LY +L RK I+TF DD+ L +GD ISP+LL AIQ SK  + IFS
Sbjct  20   FLSFRGEDTRDNFTSHLYAALCRKKIKTFIDDEELRRGDEISPALLNAIQGSKISVVIFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL EL  I+E +     Q+VVP+   V+PSD++ Q GSF D+F +  EK  K
Sbjct  80   QDYASSKWCLNELVEILECKSK-NGQIVVPVFHRVDPSDIRKQNGSFRDAFVKH-EKQFK  137

Query  581  DDEEKVRRWK  610
               EKV++W+
Sbjct  138  RTPEKVQKWR  147



>ref|XP_010650303.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=169

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L R+GI TF+DD  LE+G+ I P LLKAI+ES+F + +FS
Sbjct  25   FLSFRGEDTRFNFTDHLYENLIRRGIHTFRDDS-LERGEEIEPELLKAIEESRFSLIVFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IM+ ++ +K Q VVPI  +V+PS V+NQ G F ++F    E   +
Sbjct  84   ENYAGSRWCLDELVKIMKCRKEMK-QTVVPIFYHVDPSHVRNQTGKFGEAFSNYKED-SE  141

Query  581  DDEEKVRRWK  610
            + +EKVR W+
Sbjct  142  EMKEKVRSWR  151



>ref|XP_008236673.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=220

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +LY +L +KGI+TF DDD L +G+ IS +LLKAI+ES   I +FS
Sbjct  51   FLSFRGEDTRKNFTGHLYSNLVQKGIKTFIDDD-LSRGEEISLALLKAIEESMVSIVVFS  109

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I+E +E+ K QMV P+   V+PSDV+NQ+GSF  +      K+ +
Sbjct  110  ENYAASKWCLDELVKILECKES-KNQMVFPVFYKVDPSDVRNQRGSFGQALAGHESKL-R  167

Query  581  DDEEKVRRWK  610
            D+ EKV RW+
Sbjct  168  DNMEKVLRWR  177



>ref|XP_008231758.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1130

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 95/131 (73%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT   F D+L  +L  KGI TF DDD L +G+ ISP+L+KAI+ES+  + +FS
Sbjct  52   FLSFRGADTRTNFTDHLCNALVGKGIHTFIDDDELPRGEEISPALVKAIEESRISVIVFS  111

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  I++ +++ K+Q+V+PI   V+PSDV+ Q  SF D+FK L+    K
Sbjct  112  ENYASSRWCLDELVKILQCKQS-KQQVVLPIFYKVDPSDVRKQTNSFGDAFKGLIRSEFK  170

Query  581  DDEEKVRRWKE  613
            DD+EKV  WKE
Sbjct  171  DDKEKVLIWKE  181



>ref|XP_008227883.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1139

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +LE  GI TF+DDD +E+G  IS  L KAIQES+  I +FS
Sbjct  22   FLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL TIM+R+E   E MV+PI   V+PS V+NQ G FE++F    ++  K
Sbjct  82   KDYASSRWCLDELVTIMDRRET-NEHMVMPIFYDVDPSHVRNQTGIFEEAFARHQQRFNK  140

Query  581  DDEEKVRRWKE  613
             + +KV +W++
Sbjct  141  -EMDKVEKWRK  150



>emb|CAC95120.1| TIR/NBS/LRR protein [Populus deltoides]
Length=216

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 89/130 (68%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF D+LY +L + GI TF+DDD L +G+ IS  L++AIQESK  I +FS
Sbjct  54   FLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISIVVFS  113

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +     Q+V+PI   ++PSDV+ Q GSF ++F +  E+   
Sbjct  114  KGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERF--  171

Query  581  DDEEKVRRWK  610
             +E+ V+ W+
Sbjct  172  -EEKLVKEWR  180



>ref|XP_006478373.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1239

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + FI +LY +L  KGI  FKDD+ LEKG+ ISP LLKAI+ S+  I +FS
Sbjct  17   FLSFRGADTRKNFISHLYAALNGKGIYVFKDDEELEKGESISPRLLKAIEASRIAIIVFS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  I++ +    ++MV PI   VEP+ V+NQ G+F+++F + VE + K
Sbjct  77   KNYASSTWCLDELVHILDCKNKNAQRMVYPIFYDVEPTVVRNQTGNFQEAFAKHVE-VFK  135

Query  581  DDEEKVRRWKE  613
               EKV++W+E
Sbjct  136  KSIEKVQKWRE  146



>ref|XP_008227885.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1193

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +LE  GI TF+DDD +E+G  IS  L KAIQES+  I +FS
Sbjct  22   FLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL TIM+R+E   E MV+PI   V+PS V+NQ G FE++F    ++  K
Sbjct  82   KDYASSRWCLDELVTIMDRRET-NEHMVMPIFYDVDPSHVRNQTGIFEEAFARHQQRFNK  140

Query  581  DDEEKVRRWKE  613
             + +KV +W++
Sbjct  141  -EMDKVEKWRK  150



>ref|XP_009613120.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613121.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613122.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613123.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613124.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1421

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F+ +LY +LE++GI  FKDD+RLE G  IS  LLKAI+ES+F + IFS
Sbjct  35   FLSFRGEDTRKNFVSHLYNALEQRGIHAFKDDERLETGKSISVELLKAIEESRFAVVIFS  94

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCLEELA I++ +  L +Q+V+PI   V PS V++Q   F  SF +  E+  K
Sbjct  95   KRYASSKWCLEELAHIIKCRNEL-DQIVLPIFYDVSPSVVRHQNPPFTKSFSK-HEETYK  152

Query  581  DDEEKVRRWKE  613
            DD+EKV+RW++
Sbjct  153  DDKEKVQRWRD  163



>ref|XP_007219199.1| hypothetical protein PRUPE_ppa016991mg, partial [Prunus persica]
 gb|EMJ20398.1| hypothetical protein PRUPE_ppa016991mg, partial [Prunus persica]
Length=288

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +LE  GI TF+DDD +E+G  I+  L KAI ESK  I +FS
Sbjct  25   FLSFRGEDTRKGFTDHLYRTLELAGIHTFRDDDEIERGADIAAELNKAINESKVSIIVFS  84

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IMER++   E +V+P+   V+PS V+NQ+GSF ++F    E+  K
Sbjct  85   QNYASSRWCLDELVKIMERRKYDDEHIVMPVFYNVDPSHVRNQRGSFAEAFSRHEERF-K  143

Query  581  DDEEKVRRWK  610
            ++  KV  W+
Sbjct  144  EEMNKVEEWR  153



>gb|KDP43340.1| hypothetical protein JCGZ_25445 [Jatropha curcas]
Length=1131

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 91/129 (71%), Gaps = 3/129 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRGSDT   F  +LY +L R  I TF DD RLE+G+ ISP+LLKAI+ESK  I IFS
Sbjct  18   FLSFRGSDTRINFTSHLYAALRRSHITTFVDDTRLERGEEISPNLLKAIEESKMSIVIFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+E  +++K +MV+PI  +V+P+DV+NQ G F D F ++ E+ G 
Sbjct  78   KYYASSRWCLTELVHIIECMKSIK-RMVLPIFYHVDPTDVRNQTGIFADGFLKVKERCG-  135

Query  581  DDEEKVRRW  607
             D E + RW
Sbjct  136  -DVEMIERW  143



>gb|AEE43928.1| TIR-NBS-LRR resistance protein muRdr1D [Rosa multiflora]
Length=1156

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F DYLY  LER+GIRTF+DD +LE+G  ISP LL AI++S+F I + S
Sbjct  22   FLSFRGEDTRKGFTDYLYHELERQGIRTFRDDPQLERGTAISPELLTAIEQSRFAIIVLS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL EL+ I+E  E  +   ++PI   V+PS V++Q+GSF ++F+E  EK G+
Sbjct  82   PNYASSTWCLLELSKILECME--ERGTILPIFYEVDPSHVRHQRGSFAEAFQEYEEKFGE  139

Query  581  DDEEKVRRWKE  613
            D+EE V  W++
Sbjct  140  DNEE-VEGWRD  149



>ref|XP_007200952.1| hypothetical protein PRUPE_ppa000577mg [Prunus persica]
 gb|EMJ02151.1| hypothetical protein PRUPE_ppa000577mg [Prunus persica]
Length=1089

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ +L RKGIRTF DD  L++G+ ISP+LL+AI+ESK  + IFS
Sbjct  14   FLSFRGEDTRFNFTDHLHSNLTRKGIRTFIDDG-LKRGEEISPALLRAIKESKSSVIIFS  72

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I+E +E+ +EQ+V PI   V PSDV+NQKGSF  +F +  E   K
Sbjct  73   ENYASSKWCLDELVKILESKES-REQIVWPIFYKVNPSDVRNQKGSFGQAFAD-YECEFK  130

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  131  DDMEKVQRWR  140



>ref|XP_004237202.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1251

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  +TF+D+LY +L++KGI TFKDDD+LEKGD ISP L +AI+ES+  + IFS
Sbjct  26   FLSFRGKDVRKTFVDHLYVALQQKGINTFKDDDKLEKGDSISPGLARAIEESRIALIIFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+E+  IME ++ +K+Q+V+PI   V+PS V+ QK SFE++F +       
Sbjct  86   KNYAESSWCLDEVVKIMECKK-VKKQIVIPIFYDVDPSTVRKQKSSFEEAFNKY------  138

Query  581  DDEEKVRRWK  610
            +D  KV++W+
Sbjct  139  EDCIKVQKWR  148



>ref|XP_008236754.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=278

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ +L  KGIRTF DD  L++G+ ISP+LL+AI+ESK  I +FS
Sbjct  118  FLSFRGKDTRFNFTDHLHSNLTLKGIRTFIDDG-LKRGEEISPALLRAIEESKISIIVFS  176

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  I+E +E  +EQ+V P+   V+PSDV++Q+GSF  +  +  E   K
Sbjct  177  KNYASSKWCLDELDKILESKET-REQIVWPVFYKVDPSDVRHQRGSFGQALAD-YECEFK  234

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  235  DDMEKVQRWR  244



>ref|XP_006495109.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=255

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT ++FI +LY +L  KGI  FKDD  LE+G  ISP LLKAI++S+  I +FS
Sbjct  17   FLSFRGADTRKSFISHLYAALNGKGIYVFKDDKELERGASISPGLLKAIEDSRISIIVFS  76

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S WCL+EL  I++ + +N  +QM+ PI   VEP+ V+ Q GSF ++F +  E+  
Sbjct  77   QNYASSTWCLDELVKIVQCKNKNDHQQMIFPIFYDVEPTVVRKQTGSFREAFSKH-EEAF  135

Query  578  KDDEEKVRRWKE  613
            +++ EKV+ W++
Sbjct  136  RENLEKVKNWRD  147



>ref|XP_010650374.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=639

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L R+GI TF+DDD L++G+ I+P LLKAI+ES+F + +FS
Sbjct  23   FLSFRGEDTRFNFTDHLYANLIRRGIHTFRDDDSLKRGEEIAPELLKAIEESRFSLIVFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IME ++ +K Q VVPI  +V+PS V+NQ G F ++F    E   +
Sbjct  83   ENYAGSRWCLDELVKIMECKKEMK-QTVVPIFYHVDPSHVRNQTGRFGEAFSYYKEDT-E  140

Query  581  DDEEKVRRWK  610
            + +EKVR W+
Sbjct  141  EMKEKVRSWR  150



>gb|AEL30372.1| TIR-NBS-LRR type disease resistance protein [Arachis hypogaea]
Length=1061

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +   D+LY SL+R GI  F+DD  LE+G+ IS  LL+AI+ES F + + S
Sbjct  24   FLSFRGQDTRKGVTDHLYASLQRNGITAFRDDMNLERGEVISHELLRAIEESMFAVVVLS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL+EL  I+E + NL  Q +VP+   V+P DV++QKG+FED+F++  E+ G 
Sbjct  84   PNYASSAWCLDELQKIVECKNNLGLQ-IVPVFYGVDPCDVRHQKGTFEDAFRKQEERFG-  141

Query  581  DDEEKVRRWKE  613
             D EKV+RW+E
Sbjct  142  GDSEKVKRWRE  152



>gb|AGF69190.1| TMV resistance protein N-like protein 4 [Vitis labrusca]
Length=1049

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 91/130 (70%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L   GI+TF+DD+ LEKG  I+  LL+AI+ES+F I +FS
Sbjct  23   FLSFRGGDTRRNFTDHLYTTLTASGIQTFRDDEELEKGGDIASDLLRAIEESRFFIIVFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+ER+   KE +V+PI  +V+PSDV+NQ+GSF ++         +
Sbjct  83   KNYAYSRWCLNELVKIIERKSQ-KESVVLPIFYHVDPSDVRNQRGSFGEALAYHERDANQ  141

Query  581  DDEEKVRRWK  610
            + +E V++W+
Sbjct  142  EKKEMVQKWR  151



>emb|CDP14589.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 89/132 (67%), Gaps = 6/132 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+ YL+ +L  KGI T+KDD RLEKG  ISP LL+AIQES F + IFS
Sbjct  41   FLSFRGEDTRRNFVAYLFQALCNKGIYTYKDDQRLEKGKSISPELLQAIQESLFSVIIFS  100

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA   WCLEEL  IME  + +  Q V+PI   V+PSDV+ Q+ SF D+F     K  +
Sbjct  101  KGYASLTWCLEELVKIMECHQ-IIGQFVLPIFYDVDPSDVRKQRNSFADAFA----KHER  155

Query  581  DDE-EKVRRWKE  613
            D   EKV++WKE
Sbjct  156  DQSPEKVQKWKE  167



>gb|AAL07541.1| resistance gene analog NBS6 [Helianthus annuus]
Length=303

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 94/131 (72%), Gaps = 5/131 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  + F+D+LY  L ++GI+T+KDD+ L +G+ I P+LLKAIQES+  + +FS
Sbjct  48   FLSFRGEDVRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESRIALVVFS  107

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA IME  +  + Q+V+PI  +V+PSDV+ QKG +  +F+    K  +
Sbjct  108  ENYADSSWCLDELAHIMECMDT-RGQIVIPIFYFVDPSDVRKQKGKYGKAFR----KHKR  162

Query  581  DDEEKVRRWKE  613
            ++++KV  W++
Sbjct  163  ENKQKVESWRK  173



>ref|XP_008227564.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=245

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 92/129 (71%), Gaps = 2/129 (2%)
 Frame = +2

Query  224  LSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFSK  403
            LSFRG DT   F D+LY +L ++GI TF+DDD L +G+ IS +L  AI+ESK  + +FSK
Sbjct  27   LSFRGEDTRHNFTDHLYSALCQQGINTFRDDDELIRGEEISSALFTAIEESKISVVVFSK  86

Query  404  GYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGKD  583
             YA SKWCL+EL  I++ +++ K+Q+V+P+   V PSDV+NQ+GSF D+   +  K  K+
Sbjct  87   NYASSKWCLDELVKILDCKKS-KQQLVIPVFYKVNPSDVRNQRGSFGDALANMECKY-KE  144

Query  584  DEEKVRRWK  610
            + +KV +W+
Sbjct  145  NMQKVNKWR  153



>ref|XP_008228036.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=822

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +LE  GI TF+DDD +E+G  I   L KAIQES+  I +FS
Sbjct  22   FLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANILAELQKAIQESRVSIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL TIM+R+E   E MV+PI   V+PS V+NQ G FE++F    ++  K
Sbjct  82   KDYASSRWCLDELVTIMDRRET-NEHMVMPIFYDVDPSHVRNQTGIFEEAFARHQQRFNK  140

Query  581  DDEEKVRRWKE  613
             + +KV +WK+
Sbjct  141  -EMDKVEKWKK  150



>ref|XP_008368587.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1152

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +L+  GI TF+DDD +E+G+ I+  L  AIQES+  I +FS
Sbjct  85   FLSFRGADTRKGFTDHLYNALKLAGIHTFRDDDEIERGENIAQELQTAIQESQVSIIVFS  144

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL ELA IMER+      MV+P+  YVEPSDV+ Q GSF +SF    E+  K
Sbjct  145  KDYASSTWCLNELAIIMERKRT-DGHMVIPVFYYVEPSDVRKQTGSFAESFTRHQEQF-K  202

Query  581  DDEEKVRRWK  610
            D+ +KV  W+
Sbjct  203  DEIDKVEEWR  212



>ref|XP_007221574.1| hypothetical protein PRUPE_ppa025931mg [Prunus persica]
 gb|EMJ22773.1| hypothetical protein PRUPE_ppa025931mg [Prunus persica]
Length=1188

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +LE  GI TF+DDD +E+G  IS  L KAIQES+  I +FS
Sbjct  20   FLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSIIVFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL TIM+R+E   E MV+PI   V+PS V+NQ G FE +F    ++  K
Sbjct  80   KDYASSRWCLDELVTIMDRRET-NEHMVMPIFYDVDPSHVRNQTGIFEQAFARHQQRFNK  138

Query  581  DDEEKVRRWKE  613
             + +KV +W++
Sbjct  139  -EMDKVEKWRK  148



>emb|CAN70507.1| hypothetical protein VITISV_024109 [Vitis vinifera]
Length=1350

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F DYLY +L   GI+TF+DD  LEKG  I+  L + I+ESKF I IFS
Sbjct  23   FLSFRGGDTRRNFTDYLYDTLTAYGIQTFRDDKELEKGGDIASDLFRDIEESKFFIVIFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+ER+   KE MV+PI  +V+PSDV+NQ+GSF D          +
Sbjct  83   KNYAYSRWCLNELVKIIERKSQ-KESMVLPIFYHVDPSDVRNQRGSFGDGLAYHERDANQ  141

Query  581  DDEEKVRRWK  610
            + +E +++W+
Sbjct  142  EKKEMIQKWR  151



>emb|CAN71926.1| hypothetical protein VITISV_006195 [Vitis vinifera]
Length=173

 Score =   124 bits (312),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSF G DTC  F D+LY +L +KG+RTF+D++ L +G+ I+P LLKAI+ES+  + +  
Sbjct  26   FLSFMGEDTCHKFADHLYRALNQKGVRTFRDNEELGRGEDIAPELLKAIEESRICLIVLL  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+ELA IM+ ++ +  ++V PI  +VEP  V+ Q GS+E++F+   +   +
Sbjct  86   ENYARSKWCLDELAKIMDCRQKMA-KLVFPIFYHVEPFHVRGQTGSYEEAFEMHEKNADQ  144

Query  581  DDEEKVRRWKE  613
            +  +K++RW++
Sbjct  145  EGMQKIQRWRK  155



>ref|XP_006356453.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1324

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +LY +L++KGI TFKDD+RLE+G  ISP L+KAI+ES+F I +FS
Sbjct  14   FLSFRGEDTRKTFVGHLYYALKQKGIHTFKDDERLERGKSISPELVKAIEESRFAIVVFS  73

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  IME +++   Q V+PI   V+PS V  Q  SF  SF    E + K
Sbjct  74   KNYASSTWCLDELGKIMECKKDFG-QTVIPIFYDVDPSHVTKQSESFAKSFATHEENL-K  131

Query  581  DDEEKVRRWKE  613
            DD EKV  W++
Sbjct  132  DDVEKVLCWRD  142



>ref|XP_002325743.2| hypothetical protein POPTR_0019s00880g, partial [Populus trichocarpa]
 gb|EEF00125.2| hypothetical protein POPTR_0019s00880g, partial [Populus trichocarpa]
Length=163

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L + GI TF+DD+ L +G+ ISP L+KAI+ S+  I +FS
Sbjct  8    FLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLVKAIEGSRISIVVFS  67

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  I+E ++ + +Q+V+PI    EPSDV+ Q GS+  +F E  E   K
Sbjct  68   KQYASSRWCLDELVKIVECRQKI-DQVVLPIFYDTEPSDVRKQTGSYAKAFDEHEEHF-K  125

Query  581  DDEEKVRRWK  610
            ++ EKV +W+
Sbjct  126  EEMEKVNKWR  135



>ref|XP_006371043.1| hypothetical protein POPTR_0019s029202g, partial [Populus trichocarpa]
 gb|ERP48840.1| hypothetical protein POPTR_0019s029202g, partial [Populus trichocarpa]
Length=270

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GI TF+DDD L +G+ IS  LL+A+QESK  I +FS
Sbjct  18   FLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAVQESKISIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +   + Q+ +PI   ++PSDV+ Q GSF ++F +  E+   
Sbjct  78   KGYASSRWCLNELVAILKCKRKKRGQIALPIFYDIDPSDVRKQNGSFAEAFVKHEERF--  135

Query  581  DDEEKVRRWKE  613
             +E+ V+ W++
Sbjct  136  -EEKLVKEWRK  145



>ref|XP_010657879.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=153

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 90/130 (69%), Gaps = 6/130 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L R+GIRTF+DD +L +G+ I+P LLKAI+ES+  + +FS
Sbjct  13   FLSFRGEDTRYNFTDHLYSALGRRGIRTFRDD-KLRRGEVIAPELLKAIEESRSSVIVFS  71

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IME Q++L    V PI  +V+PS V+ Q+GSF ++F    E    
Sbjct  72   ENYARSRWCLDELVKIMECQKDLG-HAVFPIFYHVDPSHVRKQEGSFGEAFARYEENW--  128

Query  581  DDEEKVRRWK  610
              ++K+ RW+
Sbjct  129  --KDKIPRWR  136



>gb|AAL07536.1| resistance gene analog NBS1 [Helianthus annuus]
Length=339

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 94/131 (72%), Gaps = 5/131 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  + F+D+LY  L ++GI+T+KDD+ L +G+ I P+LLKAIQES+  + +FS
Sbjct  84   FLSFRGEDVRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESRIALVVFS  143

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA IME  +  + Q+V+PI  +V+PSDV+ QKG +  +F+    K  +
Sbjct  144  ENYADSSWCLDELAHIMECMDT-RGQIVIPIFYFVDPSDVRKQKGKYGKAFR----KHKR  198

Query  581  DDEEKVRRWKE  613
            ++++KV  W++
Sbjct  199  ENKQKVESWRK  209



>gb|AAL07544.1| resistance gene analog NBS9 [Helianthus annuus]
Length=304

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 91/130 (70%), Gaps = 5/130 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F+D+LY  L ++GI+T+KDD+ L +G+ I P+LLKAIQES F + +FS
Sbjct  49   FLSFRGEDTRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESHFAVVVFS  108

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA IME  +  + Q+V+PI  +V+PSDV+ Q G +  +F     K  +
Sbjct  109  ENYADSSWCLDELAHIMECVDT-RGQIVIPIFYHVDPSDVRKQNGKYGKAFT----KHER  163

Query  581  DDEEKVRRWK  610
             +++KV  W+
Sbjct  164  KNKQKVESWR  173



>gb|AAL07535.1| resistance gene analog PU3 [Helianthus annuus]
Length=770

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 95/131 (73%), Gaps = 5/131 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +F+D+LY +L ++GI+T+KDD  L +G+ I P+LLKAIQES+  + +FS
Sbjct  86   FLSFRGEDTRNSFVDHLYAALVQQGIQTYKDDQTLPRGERIGPALLKAIQESRIAVVVFS  145

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA IME  +  + Q+V+PI  +V+PSDV+ QKG +  +F+    K  +
Sbjct  146  QNYADSSWCLDELAHIMECMDT-RGQIVIPIFYFVDPSDVRKQKGKYGKAFR----KHKR  200

Query  581  DDEEKVRRWKE  613
            ++++KV  W++
Sbjct  201  ENKQKVESWRK  211



>ref|XP_008236761.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=442

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ +L RKGIRTF DD  L++G+ ISP+LL+AI+ESK  I +FS
Sbjct  51   FLSFRGEDTRFNFTDHLHSNLTRKGIRTFIDDG-LKRGEEISPALLRAIEESKISIIVFS  109

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I+E +E  +EQ+V P+   V PSDV++Q+GSF  +  +  E   K
Sbjct  110  ENYASSKWCLDELDKILESKET-REQIVWPVFYKVNPSDVRHQRGSFGQALADY-ECEFK  167

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  168  DDMEKVQRWR  177



>ref|XP_006360469.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1239

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 96/130 (74%), Gaps = 7/130 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  +TF+D+LY +L++KGI TFKD ++LEKG+ ISP L++AI+ES+  + IFS
Sbjct  27   FLSFRGEDVRKTFVDHLYVALQQKGINTFKDSEKLEKGNSISPGLMRAIEESRISLIIFS  86

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+E+A IME  +N+K Q+V+P+   V+PS V+ QK SFE++F         
Sbjct  87   KNYANSRWCLDEVAKIME-CKNVKGQIVIPVFYDVDPSTVRKQKSSFEEAFNNY------  139

Query  581  DDEEKVRRWK  610
            +D  KV++W+
Sbjct  140  EDCFKVQKWR  149



>gb|AAG43546.1|AF211528_1 Avr9/Cf-9 rapidly elicited protein 4 [Nicotiana tabacum]
Length=536

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF  +LY  L  +GI+TF+DD RLE G  IS  L KAI+ES+F I IFS
Sbjct  14   FLSFRGEDTRKTFTSHLYEVLNDRGIKTFQDDKRLEYGATISEELCKAIEESQFSIVIFS  73

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K Y  S+WC+ EL  IME +     Q+V+PI   V+PS V+NQK SF  +F+E V K  K
Sbjct  74   KNYTTSRWCMNELVKIMECKTQFG-QIVIPIFYDVDPSHVRNQKESFAKAFEEHVTKY-K  131

Query  581  DDEEKVRRWK  610
            DD E ++RW+
Sbjct  132  DDVEGIQRWR  141



>ref|XP_007214356.1| hypothetical protein PRUPE_ppb025535mg [Prunus persica]
 gb|EMJ15555.1| hypothetical protein PRUPE_ppb025535mg [Prunus persica]
Length=216

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +F D+LY +L +KGIRTF+D++ L++G  I P LLKAI+ES+F + I S
Sbjct  17   FLSFRGEDTRTSFTDHLYLALIQKGIRTFRDEENLKRGKSIGPVLLKAIEESRFAVVILS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA I+   +  KE+ + P+  +++PS+V+NQ G+F  +F +  E   K
Sbjct  77   EDYASSGWCLDELAHIIVECKKEKEREIFPVFYHIKPSEVRNQTGNFSQAFAKHEENF-K  135

Query  581  DDEEKVRRWKE  613
             + EKV +W++
Sbjct  136  GNMEKVDKWRK  146



>ref|XP_006441740.1| hypothetical protein CICLE_v100235051mg, partial [Citrus clementina]
 gb|ESR54980.1| hypothetical protein CICLE_v100235051mg, partial [Citrus clementina]
Length=163

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT ++FI +LY +L  KGI  FKDD  LE+G  ISP LLKAI++S+  I +FS
Sbjct  17   FLSFRGADTRKSFISHLYAALNGKGIYLFKDDKELERGASISPGLLKAIEDSRISIIVFS  76

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S W L+EL  I++ + +N  +QMV P+   VEP+ V+ Q GSF ++F +  E   
Sbjct  77   QNYASSTWYLDELVKIVQCKNKNDHQQMVFPVFYDVEPTVVRKQMGSFREAFSKHEEAF-  135

Query  578  KDDEEKVRRWKE  613
            K++ EKV+ W++
Sbjct  136  KENLEKVKNWRD  147



>ref|XP_002316581.2| hypothetical protein POPTR_0011s01845g, partial [Populus trichocarpa]
 gb|EEE97193.2| hypothetical protein POPTR_0011s01845g, partial [Populus trichocarpa]
Length=213

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L   G  TF+DDD + +G  I   L KAIQ+SK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLYKALVDAGFHTFRDDDEIRRGKNIQLELQKAIQQSKIAIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IMER  N  + +V P+  +V+PS+V+NQ GSF  +F E  EK  K
Sbjct  82   KNYAWSRWCLDELVKIMERNRN-ADCIVFPVFYHVDPSEVRNQNGSFAAAFVEH-EKHYK  139

Query  581  DDEEKVRRWK  610
            ++ E+V  W+
Sbjct  140  EEMERVNGWR  149



>ref|XP_008236755.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=1096

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   FID+L+ +L +KGIRTF+DD  L++G+ ISP+LL+AI++SK  + IFS
Sbjct  6    FLSFRGEDTRFNFIDHLHINLTQKGIRTFRDD-ALKRGEEISPALLRAIKDSKSSVIIFS  64

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I++ +E+ +EQ+V PI   V PSDV+NQKGSF  +F +  E   K
Sbjct  65   ENYASSKWCLDELVKILDSKES-REQIVWPIFYKVNPSDVRNQKGSFGQAFAD-YEGEFK  122

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  123  DDMEKVQRWR  132



>emb|CAN78476.1| hypothetical protein VITISV_009816 [Vitis vinifera]
Length=826

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 89/130 (68%), Gaps = 5/130 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L  +GI TF+DD+ LE+G  I PSLLKAI+ESK  I +FS
Sbjct  16   FLSFRGEDTRXNFTDHLYSALTSRGIHTFRDDEGLERGGEIQPSLLKAIEESKVSIVVFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IME +   K Q+VVP+  +V+PSDV+ Q GSF  +F     +  K
Sbjct  76   KNYAHSQWCLDELYKIMESRRE-KGQIVVPVFYHVDPSDVRKQTGSFGKAFA----RYKK  130

Query  581  DDEEKVRRWK  610
              +E+V RW+
Sbjct  131  VTKERVLRWR  140



>gb|ABB82025.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=735

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GIR F+DDD L +G+ IS  LL+AIQESK  I +FS
Sbjct  55   FLSFRGEDTRKTFTDHLYSALVQAGIRAFRDDDDLPRGEEISDHLLRAIQESKISIVVFS  114

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I+E +     Q+V+PI  +++PSDV+ Q GSF ++F    E+   
Sbjct  115  KGYASSRWCLNELVEILECKNRKTGQIVLPIFYHIDPSDVRKQNGSFAEAFANNEERF--  172

Query  581  DDEEKVRRWKE  613
             +E+ V+ W++
Sbjct  173  -EEKLVKEWRK  182



>gb|KDO37360.1| hypothetical protein CISIN_1g039252mg [Citrus sinensis]
Length=139

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D    FI +L  +L RK I TF +DD+L +GD ISPSL  AI+ SK  I IFS
Sbjct  19   FLSFRGKDVRHNFISHLNAALCRKKIVTF-NDDKLNRGDEISPSLSSAIEGSKISIVIFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEK  571
            KGYA S+WCL EL  I+E  +N   Q+VVP+   V+PSDV+NQ G+F DSF +L E+
Sbjct  78   KGYASSRWCLNELVKILE-SKNKYGQIVVPVFYLVDPSDVRNQTGTFGDSFSKLEER  133



>ref|XP_009803027.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1399

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +LY +L+ KGI TFKDD RLE+G  ISP L+KAI++S+F I +FS
Sbjct  16   FLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRLERGKSISPELVKAIEQSRFAIVVFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  IM+ ++ L    V+PI   V+PSDV  Q G+F +SF    E + +
Sbjct  76   KNYASSTWCLDELVKIMKCKKELG-LTVMPIFYDVDPSDVSKQSGTFAESFSRHEENL-R  133

Query  581  DDEEKVRRWKE  613
            DD EKV+ W++
Sbjct  134  DDLEKVQCWRD  144



>ref|XP_009803028.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1372

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +LY +L+ KGI TFKDD RLE+G  ISP L+KAI++S+F I +FS
Sbjct  16   FLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRLERGKSISPELVKAIEQSRFAIVVFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  IM+ ++ L    V+PI   V+PSDV  Q G+F +SF    E + +
Sbjct  76   KNYASSTWCLDELVKIMKCKKELG-LTVMPIFYDVDPSDVSKQSGTFAESFSRHEENL-R  133

Query  581  DDEEKVRRWKE  613
            DD EKV+ W++
Sbjct  134  DDLEKVQCWRD  144



>ref|XP_002325607.2| hypothetical protein POPTR_0019s12840g [Populus trichocarpa]
 gb|EEE99988.2| hypothetical protein POPTR_0019s12840g [Populus trichocarpa]
Length=193

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 4/129 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DTC  F  +LY +L RK I TF D  +L +GD IS SLL+ I+E+K  + +FS
Sbjct  49   FLSFRGEDTCSDFTSHLYAALNRKQILTFIDY-QLVRGDEISASLLRTIEEAKLSVIVFS  107

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEK--I  574
            + YA SKWCLEELA I ER++N   Q+V+P+   V+PS V+NQ G F D+F  L++K  +
Sbjct  108  ENYASSKWCLEELAKIFERRKN-NGQIVIPVFYQVDPSHVRNQTGRFGDAFARLIKKKAL  166

Query  575  GKDDEEKVR  601
              D E+  R
Sbjct  167  TMDKEQSFR  175



>ref|XP_006367016.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=532

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 6/132 (5%)
 Frame = +2

Query  215  MFFLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAI  394
            +F +  RG DT  TF+ +L+ +LE+ GIR FKDD+RLE G  IS  LLKAI+ESK  I I
Sbjct  125  LFKIGVRGEDTRRTFVSHLHKALEQSGIRIFKDDERLETGKSISDELLKAIEESKIAIVI  184

Query  395  FSKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKI  574
            FSK YA S+WCLEELA I++ +  L E +V+P+   V PSDV++Q   F DSF +     
Sbjct  185  FSKSYASSRWCLEELAHIIKCKNEL-ELIVIPVFYDVTPSDVRHQNPPFADSFLQY----  239

Query  575  GKDDEEKVRRWK  610
             KDD +KV+RW+
Sbjct  240  -KDDMDKVQRWR  250


 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 87/129 (67%), Gaps = 4/129 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF+ +L+ +LE+ GIR FKDD+RLE G  IS  LLKAI+ESK  I IFS
Sbjct  15   FLSFRGEDTRRTFVSHLHKALEQSGIRIFKDDERLETGKSISDELLKAIEESKIAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCLEELA I++ +  L E +V+P+   V PSDV++Q   F+  +   + KIG 
Sbjct  75   KSYASSRWCLEELAHIIKCKNEL-ELIVIPVFYDVTPSDVRHQNPPFQSLY---LFKIGV  130

Query  581  DDEEKVRRW  607
              E+  R +
Sbjct  131  RGEDTRRTF  139



>ref|XP_009373229.1| PREDICTED: TMV resistance protein N-like isoform X2 [Pyrus x 
bretschneideri]
Length=893

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSF+G+DT ++F D+LY +LE  GI TF+DDD +E+G  I   L  AIQES+  + +FS
Sbjct  21   FLSFKGADTRKSFTDHLYNALESAGIHTFRDDDEIERGANIEQELQTAIQESRVSVIVFS  80

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL ELA IMER+      MV+P+   VEPSDV+ Q GSFE+SF    E+  K
Sbjct  81   KDYASSRWCLNELALIMERKRT-DGHMVMPVFYAVEPSDVRKQTGSFEESFTRHEERF-K  138

Query  581  DDEEKVRRWK  610
            D+ +KV  W+
Sbjct  139  DEIDKVEEWR  148



>ref|XP_009803029.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nicotiana 
sylvestris]
Length=1368

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +LY +L+ KGI TFKDD RLE+G  ISP L+KAI++S+F I +FS
Sbjct  16   FLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRLERGKSISPELVKAIEQSRFAIVVFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  IM+ ++ L    V+PI   V+PSDV  Q G+F +SF    E + +
Sbjct  76   KNYASSTWCLDELVKIMKCKKELG-LTVMPIFYDVDPSDVSKQSGTFAESFSRHEENL-R  133

Query  581  DDEEKVRRWKE  613
            DD EKV+ W++
Sbjct  134  DDLEKVQCWRD  144



>ref|XP_010648148.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1250

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 92/130 (71%), Gaps = 5/130 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF D+L+ +L +K IRTF+DD+ L++G+ I  S+LKAI+ES+  I +FS
Sbjct  19   FLSFRGEDTRFTFTDHLHSALRQKRIRTFRDDEGLDRGEEIGSSILKAIEESRMYIVVFS  78

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA SKWCL+ELA IME +   K Q VVP+  +VEPSDV+NQ GSF ++F    +K  K
Sbjct  79   NTYAHSKWCLDELAKIMECKIQ-KGQTVVPVFYHVEPSDVRNQTGSFGEAF----DKYQK  133

Query  581  DDEEKVRRWK  610
              E K+ RWK
Sbjct  134  VPEHKLMRWK  143



>gb|AAL07539.1| resistance gene analog NBS4 [Helianthus annuus]
Length=279

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 93/131 (71%), Gaps = 5/131 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +F+D+LY +L ++GI T+KDD+ L +G+ I P+LLKAIQES+  + +FS
Sbjct  25   FLSFRGEDTRNSFVDHLYVALAQQGILTYKDDETLPRGERIGPTLLKAIQESRIALVVFS  84

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA IME  +  + Q+V PI  +V+PSDV+ QKG +  +F+    K  +
Sbjct  85   ENYADSSWCLDELAHIMECVDT-RGQIVEPIFYFVDPSDVRKQKGKYGKAFR----KHKR  139

Query  581  DDEEKVRRWKE  613
            +++ KV  W++
Sbjct  140  ENKHKVESWRK  150



>gb|KDO43806.1| hypothetical protein CISIN_1g0018052mg, partial [Citrus sinensis]
Length=522

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L++KGI  F+DD  LE+G+ ISP L KAI+ESK  I +FS
Sbjct  22   FLSFRGVDTRKNFTDHLYTALDQKGIIVFRDDKELERGESISPGLFKAIEESKISIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E +    +QMV PI   VEP+DV+ Q G  E  F    E+I  
Sbjct  82   RNYACSTWCLDELVHILECKNKNHQQMVYPIFYDVEPTDVRKQSGILEAVFARH-EEILA  140

Query  581  DDEEKVRRWKE  613
             ++EKV++W++
Sbjct  141  QNKEKVQKWRD  151



>gb|KDO49601.1| hypothetical protein CISIN_1g0377522mg, partial [Citrus sinensis]
Length=162

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 88/130 (68%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D    FI +L  +L RK I TF DD +L +G+ ISPSLL AI+ SK  I IFS
Sbjct  19   FLSFRGKDVRHNFISHLNAALCRKKIVTFIDD-KLNRGNEISPSLLSAIEGSKISIVIFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I+E  +N   Q+VVP+   V+PSDV+NQ G+F DSF +L E+  K
Sbjct  78   KGYASSRWCLNELVKILE-SKNKYGQIVVPVFYLVDPSDVRNQTGTFGDSFSKLEERF-K  135

Query  581  DDEEKVRRWK  610
            +  + ++ W+
Sbjct  136  EKIDMLQTWR  145



>ref|XP_008232097.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=845

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLS+RG DT +TFID+LY +L+R+GI TF DD+ L +G+ ISP+LL AI+ESK  + +FS
Sbjct  29   FLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDE-LPRGEEISPALLNAIEESKISVIVFS  87

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E +++ K+Q+V+PI   V+PSDV+NQ+ SF D+  +   K  K
Sbjct  88   ENYASSSWCLDELVKILEYKKS-KQQLVMPIFYKVDPSDVRNQRSSFGDALADHERKF-K  145

Query  581  DDEEKVRRWK  610
            DD EKV  W+
Sbjct  146  DDMEKVLEWR  155



>ref|XP_007200803.1| hypothetical protein PRUPE_ppa025229mg, partial [Prunus persica]
 gb|EMJ02002.1| hypothetical protein PRUPE_ppa025229mg, partial [Prunus persica]
Length=853

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L RKGIRTF DD  L++G+ ISP+LL+AI+ESK  I +FS
Sbjct  6    FLSFRGEDTRFNFTDHLYSNLTRKGIRTFIDDG-LKRGEEISPALLRAIEESKISIIVFS  64

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I+E +E  +EQ+V P+   V PSDV++Q+GSF  +  +  E   K
Sbjct  65   ENYASSKWCLDELVKILESKET-REQIVWPVFYKVNPSDVRHQRGSFGQALAD-YECEFK  122

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  123  DDMEKVQRWR  132



>ref|XP_009373216.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009373224.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
Length=1104

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSF+G+DT ++F D+LY +LE  GI TF+DDD +E+G  I   L  AIQES+  + +FS
Sbjct  21   FLSFKGADTRKSFTDHLYNALESAGIHTFRDDDEIERGANIEQELQTAIQESRVSVIVFS  80

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL ELA IMER+      MV+P+   VEPSDV+ Q GSFE+SF    E+  K
Sbjct  81   KDYASSRWCLNELALIMERKRT-DGHMVMPVFYAVEPSDVRKQTGSFEESFTRHEERF-K  138

Query  581  DDEEKVRRWK  610
            D+ +KV  W+
Sbjct  139  DEIDKVEEWR  148



>ref|XP_006370852.1| hypothetical protein POPTR_0019s00910g [Populus trichocarpa]
 gb|ERP48649.1| hypothetical protein POPTR_0019s00910g [Populus trichocarpa]
Length=149

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 90/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L + GI TF+DD+ L +G+ ISP LLKAI+ S+  I +FS
Sbjct  26   FLSFRGEDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLLKAIEGSRISIVVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  I+E ++N+ +Q+V+PI    EPSDV+ Q GS+  +F E  E+  K
Sbjct  86   KHYASSRWCLDELVKILECRQNI-DQVVLPIFYDTEPSDVRKQTGSYAKAFDEHEERF-K  143

Query  581  DDEEKV  598
            ++ EK+
Sbjct  144  EEMEKL  149



>emb|CDP07826.1| unnamed protein product [Coffea canephora]
Length=1159

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 96/130 (74%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  + F+D+LY SL++KGI TFKDD++LE+G  IS +LL+AI+ES+  + IFS
Sbjct  24   FLSFRGEDVRKNFVDFLYSSLQQKGIYTFKDDEKLERGRSISSALLQAIKESRIAVIIFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA I+   + L  Q ++P+  YV+PS V+ QKGSF  +F +  ++I  
Sbjct  84   ENYAASSWCLDELAEIIYCNQALG-QTILPVFYYVDPSVVRKQKGSFGQAFVKHEDEI--  140

Query  581  DDEEKVRRWK  610
            +D+E++RRW+
Sbjct  141  EDKERIRRWR  150



>ref|XP_004292155.1| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1648

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT  +F D+LY +L++KGI TF+D++ LE+G  I+P LLKAI+ES+++I + S
Sbjct  26   FLSFRGTDTRNSFTDFLYNTLKQKGINTFRDNEELERGKEIAPELLKAIEESRYVIVVLS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+E+A ++E  + L  Q VVP+  +V+P +V+ QKGSFE +F +   ++ K
Sbjct  86   ENYADSSWCLDEVAKVVECMK-LMGQTVVPVFYHVDPFEVRRQKGSFEKAFAKHEIRL-K  143

Query  581  DDEEKVRRWK  610
            D+ EKV+RW+
Sbjct  144  DNPEKVKRWR  153



>gb|ADL36719.1| HD domain class transcription factor [Malus domestica]
Length=184

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+ +LY +L +KG +TF DD+ L++G+ IS +LLKAI++S+  + +FS
Sbjct  26   FLSFRGEDTRYNFVGHLYNNLVQKGFKTFIDDEALKRGEEISSALLKAIEQSRISVVVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  I   +E L +QMV P+   V+PSDV+NQ+ SF  +  +   K+ K
Sbjct  86   ENYASSRWCLDELVHIFHCKEQL-QQMVFPVFYKVDPSDVRNQRKSFGKALVDHESKL-K  143

Query  581  DDEEKVRRWKE  613
            D+ +KV RW+E
Sbjct  144  DNMDKVLRWRE  154



>ref|XP_011457915.1| PREDICTED: TMV resistance protein N-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1273

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 98/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT  +F D+LY +L++KGI TF+D++ LE+G  I+P LLKAI+ES+++I + S
Sbjct  26   FLSFRGTDTRNSFTDFLYNTLKQKGINTFRDNEELERGKEIAPELLKAIEESRYVIVVLS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+E+A ++E  + L  Q VVP+  +V+P +V+ QKGSFE +F +   ++ K
Sbjct  86   ENYADSSWCLDEVAKVVECMK-LMGQTVVPVFYHVDPFEVRRQKGSFEKAFAKHEIRL-K  143

Query  581  DDEEKVRRWK  610
            D+ EKV+RW+
Sbjct  144  DNPEKVKRWR  153



>ref|XP_009353817.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=210

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+ +LY +L +KGI+TF DD+ L++G+ IS +LLKAI++S+  + +FS
Sbjct  26   FLSFRGEDTRYNFVGHLYNNLVQKGIKTFIDDEALQRGEEISLALLKAIEQSRISLVVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I   +E L +QMV P+   V+PSDV+NQ+ SF  +  +   K+ K
Sbjct  86   ENYASSHWCLDELVHIFHCKEQL-QQMVFPVFYKVDPSDVRNQRKSFGKALADHESKL-K  143

Query  581  DDEEKVRRWKE  613
            D+ +KV RW+E
Sbjct  144  DNMDKVLRWRE  154



>ref|XP_010650380.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1148

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L R+GI TF+DDD L++G+ I+P LLKAI+ES+F + +FS
Sbjct  23   FLSFRGKDTRFNFTDHLYANLIRRGIHTFRDDDSLKRGEEIAPELLKAIEESRFSLIVFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IME ++ +K Q VVPI  +V+PS V+NQ G F ++F    E   +
Sbjct  83   ENYAGSRWCLDELVKIMECKKEMK-QTVVPIFYHVDPSHVRNQTGRFGEAFSYYKEDT-E  140

Query  581  DDEEKVRRWK  610
            + +EKVR W+
Sbjct  141  EMKEKVRSWR  150



>ref|XP_006442158.1| hypothetical protein CICLE_v10018611mg [Citrus clementina]
 gb|ESR55398.1| hypothetical protein CICLE_v10018611mg [Citrus clementina]
Length=1092

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +LY +L RK I+TF DD+ L +GD ISP+LL AI+ SK  + IFS
Sbjct  15   FLSFRGEDTRDNFTSHLYAALCRKKIKTFIDDEELRRGDEISPALLNAIEGSKISVVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL EL  I+E + N+  QMVVP+  + +PSDV+ Q G+F D+F +  EK  +
Sbjct  75   KDYASSKWCLNELVKILECK-NMNGQMVVPVFYHADPSDVRKQNGTFGDAFVK-HEKQFR  132

Query  581  DDEEKVRRWK  610
            D  EKV++W+
Sbjct  133  DVPEKVQKWR  142



>ref|XP_008342527.1| PREDICTED: TMV resistance protein N-like isoform X3 [Malus domestica]
Length=934

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +L+  GI TF+DDD +E+G+ I+  L  AIQES+  I +FS
Sbjct  20   FLSFRGADTRKGFTDHLYNALKLAGIHTFRDDDEIERGENIAQELQTAIQESQVSIIVFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL ELA IMER+      MV+P+  YV PSDV+ Q GSF +SF    E+  K
Sbjct  80   KDYASSTWCLNELAIIMERKRT-DGHMVIPVFYYVXPSDVRKQTGSFAESFTRHQEQF-K  137

Query  581  DDEEKVRRWK  610
            D+ +KV  W+
Sbjct  138  DEIDKVEEWR  147



>ref|XP_010650378.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=164

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+ Y +L R+GI TF+DD  LE+G+ I P LLKAI+ES+F + +FS
Sbjct  21   FLSFRGEDTRFNFTDHFYENLIRRGIHTFRDDS-LERGEEIEPELLKAIEESRFSLIVFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IM+ ++ +K Q VVPI  +V+PS V+NQ G F ++F    E   +
Sbjct  80   ENYAGSRWCLDELVKIMKCKKEMK-QTVVPIFYHVDPSLVRNQTGRFGEAFSNYKEDT-E  137

Query  581  DDEEKVRRWK  610
            + +EKVR W+
Sbjct  138  EMKEKVRSWR  147



>gb|AAF61210.1| unknown [Glycine max]
Length=148

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 93/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY +L+ KGI TF DD++L++G+ I+P+L+KAI++S+  I + S
Sbjct  17   FLSFRGEDTRSAFTGHLYNTLQSKGIHTFIDDEKLQRGEQITPALMKAIEDSRVAITVLS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S +CL+ELATI+   +  K  +V+P+   V+PSDV++QKGS+ ++  +L E+  +
Sbjct  77   EHYASSSFCLDELATILHCDQR-KRLLVIPVFYKVDPSDVRHQKGSYGEALAKL-ERRFQ  134

Query  581  DDEEKVRRWK  610
             D EK++ WK
Sbjct  135  HDPEKLQNWK  144



>ref|XP_011015315.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1140

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L + GI TF+DD+ L +G+ ISP LLKAI+ S+  I +FS
Sbjct  26   FLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLLKAIEGSRISIVVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  I+E ++N+ +Q+V+PI    EPSDV+ Q GS+  +F EL E+  K
Sbjct  86   KNYASSRWCLDELVKIIECKQNI-DQVVLPIFYDTEPSDVRKQTGSYAKAFDELEERF-K  143

Query  581  DDEEKVRRWK  610
            ++ EKV +W+
Sbjct  144  EEMEKVNKWR  153



>ref|XP_006371542.1| hypothetical protein POPTR_0019s13000g [Populus trichocarpa]
 gb|ERP49339.1| hypothetical protein POPTR_0019s13000g [Populus trichocarpa]
Length=192

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (68%), Gaps = 4/130 (3%)
 Frame = +2

Query  218  FFLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIF  397
             FLSFRG DT   F  +LY +L+RK IRTF D  +L +GD IS SLL+ I+E+K  + +F
Sbjct  48   LFLSFRGEDTRVGFTSHLYAALDRKQIRTFIDY-QLRRGDEISASLLRTIEEAKLSVIVF  106

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEK--  571
            S+ YA SKWCLEELA I+ER+ N   Q+V+P+   V+PS V+NQ GSF D+   L++K  
Sbjct  107  SENYASSKWCLEELAKIIERRRN-NGQIVIPVFYKVDPSHVRNQTGSFGDALARLIKKKA  165

Query  572  IGKDDEEKVR  601
            +  D E+  R
Sbjct  166  LTMDREQSFR  175



>emb|CDP20523.1| unnamed protein product [Coffea canephora]
Length=1150

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  +  +D+LY +LE+KGI TFKDD++LE+G  ISP+LL+AI+ES+  + IFS
Sbjct  29   FLSFRGEDVRKGIVDHLYSALEQKGIHTFKDDEKLERGRSISPTLLQAIKESRIAVIIFS  88

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ELA I++ +  L  Q V+P+  YV+PS V+ QKGSF+ +F +  ++I  
Sbjct  89   ENYATSSWCLDELAEIIDCKHVLG-QTVLPVFYYVDPSVVRRQKGSFDRAFVKHEDEI--  145

Query  581  DDEEKVRRWK  610
            +D+E++++W+
Sbjct  146  EDKERIQKWR  155



>ref|XP_008342525.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=1160

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +L+  GI TF+DDD +E+G+ I+  L  AIQES+  I +FS
Sbjct  20   FLSFRGADTRKGFTDHLYNALKLAGIHTFRDDDEIERGENIAQELQTAIQESQVSIIVFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL ELA IMER+      MV+P+  YV PSDV+ Q GSF +SF    E+  K
Sbjct  80   KDYASSTWCLNELAIIMERKRT-DGHMVIPVFYYVXPSDVRKQTGSFAESFTRHQEQF-K  137

Query  581  DDEEKVRRWK  610
            D+ +KV  W+
Sbjct  138  DEIDKVEEWR  147



>gb|KDO38309.1| hypothetical protein CISIN_1g0397312mg, partial [Citrus sinensis]
Length=144

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +L+ +L RK I+TF D++ L +GD ISP++LKAI+ SK  + IFS
Sbjct  17   FLSFRGEDTRDNFTSHLHAALCRKKIKTFIDEE-LNRGDEISPAILKAIEGSKITVIIFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  I+E  + +  QMVVP+   ++PSDV+ Q G F+D+F +  E+  K
Sbjct  76   KNYASSKWCLDELVKILECHK-MNSQMVVPVFYRIDPSDVRKQSGRFKDAFVKHEEQF-K  133

Query  581  DDEEKVRRWK  610
            D  EK++ W+
Sbjct  134  DMPEKIQIWR  143



>gb|AAL07540.1| resistance gene analog NBS5 [Helianthus annuus]
Length=285

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 91/130 (70%), Gaps = 5/130 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F+D+LY  L ++GI+T+KDD+ L +G+ I P+LLKAIQES+  + +FS
Sbjct  50   FLSFRGEDTRKNFVDHLYKDLVQQGIQTYKDDETLRRGESIRPALLKAIQESRIAVIVFS  109

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E  +    Q+V+PI  +V+PSDV+ Q G +  +F+    K  K
Sbjct  110  ENYADSSWCLDELQQIIECMDT-NGQIVIPIFYHVDPSDVRKQNGKYGKAFR----KHKK  164

Query  581  DDEEKVRRWK  610
            ++++KV  W+
Sbjct  165  ENKQKVESWR  174



>ref|XP_008244454.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=254

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L  KGI TF D + L +G+ ISP+L+KAI+ES+  + +FS
Sbjct  22   FLSFRGKDTRTNFTDHLYKALCDKGINTFIDRE-LVRGEEISPALVKAIEESRISLIVFS  80

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  I++ +++ K+Q+V+PI   V+PSDV NQ  SF  +F+EL+E   K
Sbjct  81   EKYASSRWCLDELVKILQCKQS-KQQIVLPIFYKVDPSDVGNQTNSFGYAFEELIESKFK  139

Query  581  DDEEKVRRWKE  613
            D+EEKV  W+E
Sbjct  140  DNEEKVLIWRE  150



>ref|XP_009794563.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=166

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  +TF+D+LY +L++KGI TFKDD++LE+G  ISP L +AI+ES+  + IFS
Sbjct  22   FLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDEKLERGKSISPDLTRAIEESRIALIIFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSF  553
            K YA S WCL+EL  IME  +  K Q+V+P+   V+PS V+ QK SF ++F
Sbjct  82   KNYANSTWCLDELMKIMECNKQ-KGQIVLPVFYDVDPSTVRKQKSSFGEAF  131



>gb|KDO40658.1| hypothetical protein CISIN_1g009845mg [Citrus sinensis]
Length=524

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F   L+ +L RK I TF DD+ L +GDCISP++  AIQ SK  + I S
Sbjct  15   FLSFRGEDTRDNFTSRLHAALCRKKINTFIDDEELRRGDCISPAIFDAIQGSKISVIILS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL EL  I+E + ++  QMVVP+  +V+PSDV+ Q G+F D+F +  EK  K
Sbjct  75   KDYASSKWCLNELVKILECK-SMNGQMVVPVFYHVDPSDVRKQNGTFGDAFVKH-EKQFK  132

Query  581  DDEEKVRRWK  610
            D  EKV++W+
Sbjct  133  DVPEKVQKWR  142



>ref|XP_007203308.1| hypothetical protein PRUPE_ppa025905mg [Prunus persica]
 gb|EMJ04507.1| hypothetical protein PRUPE_ppa025905mg [Prunus persica]
Length=563

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F DYLY +L +KGI TF+DD++L+ G+ IS +LLKAI+ES+  + I S
Sbjct  22   FLSFRGLDTRKGFTDYLYNALMQKGIHTFRDDEQLDSGEPISTALLKAIEESQISVVILS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+ELAT++E   N+K ++++P+   V PS+V+ Q G   + FKE+  +  K
Sbjct  82   KNYATSTWCLDELATMVELAANIKSRLILPVFYDVTPSEVREQTG---EHFKEVFAQHDK  138

Query  581  D---DEEKVRRWKE  613
            D   +  KV RWKE
Sbjct  139  DFKGEPGKVTRWKE  152



>emb|CAN74711.1| hypothetical protein VITISV_009242 [Vitis vinifera]
Length=1354

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 89/130 (68%), Gaps = 9/130 (7%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L   GI TFKDD+ LEKG  I+  LL+AI+ES   I IFS
Sbjct  22   FLSFRGGDTRKNFTDHLYTTLTSYGIHTFKDDEELEKGGDIASDLLRAIEESTIFIIIFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+ER+   KE +V+PI  +V+PSDV+NQKGSF D+ +E       
Sbjct  82   KNYAYSRWCLNELVKIIERKSQ-KESLVLPIFYHVDPSDVRNQKGSFGDANQE-------  133

Query  581  DDEEKVRRWK  610
              +E V++W+
Sbjct  134  -KKEMVQKWR  142



>ref|XP_006370864.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
 gb|ERP48661.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
Length=1058

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L++ GIR F+DDD L +G+ IS  LL+AIQESK  I +FS
Sbjct  55   FLSFRGEDTRKTFTDHLYAALDQAGIRAFRDDDELPRGEEISDHLLRAIQESKISIVVFS  114

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I+E ++    Q+V+PI   ++PSDV+ Q GSF ++F +  E+   
Sbjct  115  KGYASSRWCLNELVEILECKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERF--  172

Query  581  DDEEKVRRWKE  613
             +E+ V+ W++
Sbjct  173  -EEKLVKEWRK  182



>ref|XP_006495365.1| PREDICTED: TMV resistance protein N-like, partial [Citrus sinensis]
Length=159

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 89/131 (68%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TFI +LY +L  KGI  F+DD +LEKG  ISP+LLKAI+ES+  I + S
Sbjct  17   FLSFRGEDTRQTFISHLYTALNDKGIYVFRDDKQLEKGGSISPNLLKAIEESRISIIVLS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E +   +E  + PI   VEP+ V+ Q  SF ++F +  E+  +
Sbjct  77   RNYASSTWCLDELVKIVEYKN--REDQIFPIFYDVEPTVVRKQTTSFGEAFTKH-EEFFR  133

Query  581  DDEEKVRRWKE  613
            D+ EKV++W+ 
Sbjct  134  DNIEKVQKWRH  144



>ref|XP_009374162.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=748

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 88/131 (67%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +LER GI TFKDD  L+KG  ISP L  AIQES+F + + S
Sbjct  21   FLSFRGDDTRRGFTDHLYSALERHGILTFKDDPELQKGKSISPELFSAIQESRFALIVLS  80

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  I+E  E    + V+PI   V+PSDV+ QKGSF ++F +  E + K
Sbjct  81   KNYASSTWCLDELLKILECME--ARKTVLPIFYEVDPSDVRKQKGSFAEAFTKHEENL-K  137

Query  581  DDEEKVRRWKE  613
            +D  KV+ W++
Sbjct  138  NDLMKVQSWRD  148



>ref|XP_008236613.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=701

 Score =   129 bits (325),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 68/130 (52%), Positives = 93/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT   F D+L+ SL R+GI TF DDD+LE+G  IS  +  AI+ES+  I IFS
Sbjct  32   FLSFRGADTRYGFTDHLHSSLLRRGINTFMDDDQLERGQDISEVINPAIRESRIFIIIFS  91

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCLEELA I+E + N ++Q+V+P+   V+P+DV+NQKG F ++F +   +  K
Sbjct  92   ENYASSSWCLEELARIIEYK-NPQQQIVIPVYYKVDPADVRNQKGPFGEAFVQHENRF-K  149

Query  581  DDEEKVRRWK  610
            DD EKV RW+
Sbjct  150  DDLEKVSRWR  159



>ref|XP_010050815.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=190

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +  D+LY  L   G+RTF+DD+ L  G+ I P L++AI++SK  I IFS
Sbjct  9    FLSFRGPDTRTSITDHLYTRLTEAGVRTFRDDEELRIGEEIGPDLIRAIEQSKISIPIFS  68

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+ELA I+E +++ + Q ++PI  Y+EPS+V+ Q G + D+F    EK  +
Sbjct  69   KNYASSKWCLKELAQIVECRKS-RGQKIMPIFYYIEPSEVRYQTGGYGDAFHSH-EKKKR  126

Query  581  DDEEKVRRWK  610
             DEE +  WK
Sbjct  127  VDEETIPEWK  136



>ref|XP_009361379.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=651

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT ++F D+LY +LE  GI TF+DDD +++G+ I+  L KAI ESK  I +FS
Sbjct  24   FLSFRGEDTRKSFTDHLYRALELAGIHTFRDDDEIKRGEDIAEELHKAINESKVSIIVFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IMER+    E  V+P+   V+PS V+ Q GSFE+SF    E+  K
Sbjct  84   KNYASSRWCLDELVKIMERRRRDDEHFVLPVFYDVDPSHVRKQTGSFEESFHRHKERF-K  142

Query  581  DDEEKVRRWK  610
            ++ EKV  W+
Sbjct  143  EEMEKVDGWR  152



>ref|XP_008351316.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1163

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +LE  GI TF+DDD +E+G  I   L  AIQES+  + +FS
Sbjct  21   FLSFRGTDTRKGFTDHLYSALESAGIHTFRDDDEIERGANIEQELQTAIQESRVSVIVFS  80

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL ELA IMER+      MV+P+   VEPSDV+ Q GSF +SF    E+  K
Sbjct  81   KDYASSRWCLNELAVIMERKRT-DGHMVIPVFYDVEPSDVRKQTGSFAESFTRHEERF-K  138

Query  581  DDEEKVRRWK  610
            D+ +KV  W+
Sbjct  139  DEIDKVEEWR  148



>ref|XP_010645853.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1019

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 89/130 (68%), Gaps = 5/130 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L  +GI TF+DD+ LE+G  I PSLLKAI+ESK  I +FS
Sbjct  16   FLSFRGEDTRFNFTDHLYSALTSRGIHTFRDDEGLERGGEIQPSLLKAIEESKVSIVVFS  75

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IME +   K Q+VVP+  +V+PSDV+ Q GSF  +F     +  K
Sbjct  76   KNYAHSQWCLDELYKIMESRRE-KGQIVVPVFYHVDPSDVRKQTGSFGKAFA----RYKK  130

Query  581  DDEEKVRRWK  610
              +E+V RW+
Sbjct  131  VTKERVLRWR  140



>gb|KDO36672.1| hypothetical protein CISIN_1g035646mg, partial [Citrus sinensis]
Length=584

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L+ KGI  F+DD  LE+G+ ISP L KAI+ESK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLYSALDEKGIIVFRDDKELERGESISPGLFKAIEESKISIVVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E +    +QMV PI   VEP+ V+ Q  +F+++F +  E++  
Sbjct  82   RSYAFSTWCLDELVHILECKNTNNQQMVYPIFYDVEPAVVRKQTETFQEAFAQ-YEEVFS  140

Query  581  DDEEKVRRWKE  613
            ++ EKV++W++
Sbjct  141  ENIEKVQKWRD  151



>ref|XP_008236730.1| PREDICTED: TMV resistance protein N-like isoform X1 [Prunus mume]
 ref|XP_008236731.1| PREDICTED: TMV resistance protein N-like isoform X2 [Prunus mume]
Length=1087

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ +L RKGIRTF DD  L++G+ ISP+LL+AI+ESK  I +FS
Sbjct  6    FLSFRGEDTRFNFTDHLHSNLTRKGIRTFLDDG-LKRGEEISPALLRAIEESKISIIVFS  64

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I+E +E  +EQ+V P+   V+PSDV++Q+GSF  +  +  E   K
Sbjct  65   ENYASSKWCLDELVKILESKET-REQIVWPVFYKVDPSDVRHQRGSFGQALAD-YECEFK  122

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  123  DDTEKVQRWR  132



>ref|XP_006371398.1| hypothetical protein POPTR_0019s098402g, partial [Populus trichocarpa]
 gb|ERP49195.1| hypothetical protein POPTR_0019s098402g, partial [Populus trichocarpa]
Length=157

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 90/130 (69%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY ++ RK I+TF DD  LE+G+ I+P+LLK+I+ES+  + IFS
Sbjct  16   FLSFRGKDTRNNFTSHLYDAMRRKKIKTFIDDG-LERGEEITPALLKSIEESRISVVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WC++EL  I+E +E    Q+V+P+  +V+PSDV  Q GSF ++F EL EK  K
Sbjct  75   KNYASSPWCVDELVKILECKETYG-QIVLPVFYHVDPSDVDEQTGSFGNAFAEL-EKNFK  132

Query  581  DDEEKVRRWK  610
               +KV RW+
Sbjct  133  WKMDKVPRWR  142



>emb|CAN64588.1| hypothetical protein VITISV_008452 [Vitis vinifera]
Length=259

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L   G+ TF+DD+ LE+GD I+P LLKAI++S+  I +FS
Sbjct  113  FLSFRGEDTRYHFTDHLYSALRDNGVHTFRDDEELERGDVIAPGLLKAIEQSRISIVVFS  172

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  I+E     ++Q+V+P+  +V+PS V+ Q GS+ ++F +  +    
Sbjct  173  EKYAQSRWCLDELVKIIECMTE-RKQIVLPVFYHVDPSHVRKQMGSYGEAFADHEKDADL  231

Query  581  DDEEKVRRWK  610
               EK+++W+
Sbjct  232  KKREKIQKWR  241



>ref|XP_004295629.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=382

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +LY SL R+GI+TF D+D L +G+ IS +LL+AI+ESK  + +FS
Sbjct  25   FLSFRGEDTRDGFTGHLYDSLVRRGIKTFIDND-LTRGEEISQALLRAIEESKLSLIVFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCLEEL  I+ +   LK QMV PI   V+PSDV++Q+G F +S  +L E+  K
Sbjct  84   ENYASSKWCLEELVHIL-KCRRLKNQMVQPIFYKVDPSDVRHQRGKFGESHADL-ERRFK  141

Query  581  DDEEKVRRWK  610
            DD  KV RW+
Sbjct  142  DDMRKVLRWR  151



>ref|XP_010665272.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1164

 Score =   130 bits (327),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSL-ERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIF  397
            FLSFRG DT  TF D+LY +L ++KGIRTF+D++ L +G+ I  SLLKAI+ES+  I +F
Sbjct  19   FLSFRGEDTRFTFTDHLYSALCQQKGIRTFRDNEGLHRGEEIGSSLLKAIEESRMCIVVF  78

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            SK YA SKWCL+ELA IME +   K Q+VVP+  +V+P DV+NQ  SF ++F    +K  
Sbjct  79   SKTYAHSKWCLDELAKIMECKTQ-KGQIVVPVFYHVDPCDVRNQTRSFGEAF----DKYQ  133

Query  578  KDDEEKVRRWK  610
            K  E+KV RWK
Sbjct  134  KVPEDKVMRWK  144



>ref|XP_010026669.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=585

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT E F D+LY  L   GIRTF+DDD L +G+ I P LL AI+ SK LI I S
Sbjct  75   FLSFRGPDTREGFTDHLYNGLVDAGIRTFRDDDELRQGEKIGPDLLAAIENSKILIPILS  134

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              Y  SKWCL+EL  IME + N  + +V+PI   VEP+ V++Q GSF D+F     +   
Sbjct  135  VNYGSSKWCLDELVRIMEFKNNFMDHLVLPIFYKVEPAHVRHQIGSFGDAFHTRERRF--  192

Query  581  DDEEKVRRWKE  613
             D+  + +WK+
Sbjct  193  -DQTILDKWKQ  202



>ref|XP_010042728.1| PREDICTED: TMV resistance protein N-like, partial [Eucalyptus 
grandis]
Length=156

 Score =   121 bits (304),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +  D+LY  L   G+RTF+DD+ L  G+ I P L++AI++SK  I IFS
Sbjct  9    FLSFRGPDTRTSITDHLYTRLTEAGVRTFRDDEELRIGEEIGPDLIRAIEQSKISIPIFS  68

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+ELA ++E +++ + Q ++PI  Y+EPS+V+ Q G + D+F    EK  +
Sbjct  69   KNYASSKWCLKELAQMVECKKS-RGQKIMPIFYYIEPSEVRYQTGGYGDAFHSH-EKKKR  126

Query  581  DDEEKVRRWK  610
             DEE +  WK
Sbjct  127  VDEETIPEWK  136



>ref|XP_008351874.1| PREDICTED: putative disease resistance protein At4g11170 [Malus 
domestica]
Length=192

 Score =   122 bits (306),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 91/130 (70%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L  KGI TF D + L +G+ ISP+LL+ I+ES+  + IFS
Sbjct  20   FLSFRGEDTRTNFTDHLYKALVDKGINTFIDRE-LRRGEEISPTLLQVIEESRISLVIFS  78

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I++ +E+ K+Q+V+P+   VEPS V+ Q+ SF ++F ELV K G 
Sbjct  79   RTYASSSWCLDELVKILQCRES-KQQIVLPVFYKVEPSHVRKQESSFGNAFTELVSKSGN  137

Query  581  DDEEKVRRWK  610
            ++ EKV  WK
Sbjct  138  NN-EKVPVWK  146



>ref|XP_007201560.1| hypothetical protein PRUPE_ppa017937mg, partial [Prunus persica]
 gb|EMJ02759.1| hypothetical protein PRUPE_ppa017937mg, partial [Prunus persica]
Length=894

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ +L RKGIRTF DD  L++G+ ISP+LL+AI+ESK  I +FS
Sbjct  6    FLSFRGEDTRFNFTDHLHSNLTRKGIRTFIDDG-LKRGEEISPALLRAIEESKISIIVFS  64

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I+E +E  +EQ+V P+   V PSDV++Q+GSF  +  +  E   K
Sbjct  65   ENYASSKWCLDELVKILESKET-REQIVWPVFYKVNPSDVRHQRGSFGQALAD-YECEFK  122

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  123  DDMEKVQRWR  132



>gb|KDO37805.1| hypothetical protein CISIN_1g044964mg, partial [Citrus sinensis]
Length=163

 Score =   121 bits (304),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 5/131 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +LY +L RK I TF D+ +L +G+ ISPSLL AI+ SK  + IFS
Sbjct  20   FLSFRGEDTRDNFTSHLYAALCRKKIETFIDN-QLIRGEDISPSLLDAIERSKISVVIFS  78

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEK-IG  577
            KGYA S WCLEEL  I+E ++    Q+V+P+  +VEPS+V+NQ G F D+F    E+ +G
Sbjct  79   KGYASSGWCLEELVKILECKDKYG-QIVIPVFYHVEPSNVRNQTGIFGDAFSMFEERFVG  137

Query  578  KDDEEKVRRWK  610
            ++D  K+R W+
Sbjct  138  RED--KLRTWR  146



>ref|XP_008349077.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=171

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L R GI TF D   L  G+ ISP+LLKAI +S+  + +FS
Sbjct  22   FLSFRGEDTRTNFTDHLYHALVRHGINTFIDHRELPTGEEISPTLLKAIDKSRISVIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  I+E +++ K  M  PI   V+PSDV++Q  S+  +F +   K  K
Sbjct  82   KNYASSRWCLDELVHILECRKS-KGXMTRPIFYKVDPSDVRHQTNSYGAAFADHTRKY-K  139

Query  581  DDEEKVRRWK  610
            +D EKV+RW+
Sbjct  140  NDLEKVQRWR  149



>gb|KDO36130.1| hypothetical protein CISIN_1g045860mg [Citrus sinensis]
Length=160

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + FI YLY +L  KGI  F+DD +LEKG  ISP+LLKAI ES+  I + S
Sbjct  17   FLSFRGEDTRKGFIGYLYTALNNKGIYVFRDDKQLEKGGSISPNLLKAIDESRISIIVLS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  I E +   +E  + PI   VEP+ V+ Q  SF ++F E  E+  +
Sbjct  77   KNYASSTWCLDELLKITECKN--REDQIFPIFYGVEPTVVRKQTASFGEAFAEH-EEFFR  133

Query  581  DDEEKVRRWKE  613
            D+ EKV++W+ 
Sbjct  134  DNIEKVQKWRH  144



>ref|XP_006364843.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1230

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT ++F+D+LY SL  KGI TF+DD  L +G  ISP LL AI++S+F + IFS
Sbjct  23   FLSFRGEDTRKSFVDHLYTSLREKGIHTFRDDKELSRGKSISPELLNAIEKSRFAVVIFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKI-G  577
            K YA S WCLEEL  I+E  +  + Q ++P+   V+PS V+ QK S+ D+F +  E + G
Sbjct  83   KNYADSSWCLEELTKIVECNQQ-RGQTLIPVFYSVDPSVVRKQKESYGDAFAKHEENLKG  141

Query  578  KDDEEKVRRWKE  613
             D+  K++RW++
Sbjct  142  SDERNKIQRWRD  153



>ref|XP_007221584.1| hypothetical protein PRUPE_ppa025848mg [Prunus persica]
 gb|EMJ22783.1| hypothetical protein PRUPE_ppa025848mg [Prunus persica]
Length=860

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L ++GI TF+DDD L +G+ IS SLL AI+ESK  + +FS
Sbjct  26   FLSFRGVDTRHNFTDHLYSALCQRGINTFRDDDELRRGEEISTSLLTAIEESKISVVVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  I++ +E+  +Q V+P+   V PSDV+NQ GSF D+   +  K  K
Sbjct  86   KNYASSKWCLDELVKILDCKES-NQQQVIPVFYKVNPSDVRNQGGSFGDALANMECKY-K  143

Query  581  DDEEKVRRWK  610
            ++ +KV++W+
Sbjct  144  ENMKKVKKWR  153



>gb|AFP55552.1| TIR-NBS-LRR [Rosa rugosa]
Length=1144

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F DYLY  LER+GIRTF+DD +LE+G  ISP LL AI++S+F I + S
Sbjct  22   FLSFRGEDTRKGFTDYLYHELERQGIRTFRDDPQLERGTAISPELLTAIEQSRFAIVVLS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL EL+ I+E  E  +   ++PI   V+PS V++Q+GSF ++F+E  EK G+
Sbjct  82   PKYATSTWCLLELSKILECME--ERGTILPIFYEVDPSHVRHQRGSFAEAFQEHEEKFGE  139

Query  581  DDEEKVRRWKE  613
             ++E V  W++
Sbjct  140  GNKE-VEGWRD  149



>emb|CAC95127.1| part I of G08 TIR/NBS/LRR protein [Populus deltoides]
Length=226

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 89/131 (68%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GI TF+DDD L +G+ IS  LL+AIQESK  I +FS
Sbjct  18   FLSFRGEDTRKTFTDHLYTALVQAGIYTFRDDDELPRGEEISYHLLRAIQESKISIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +     Q+V+PI   ++PS V+ Q GSF ++F +  E+   
Sbjct  78   KGYASSRWCLNELVEILKCKNGKTGQIVLPIFYDIDPSYVRKQNGSFAEAFVKHEERF--  135

Query  581  DDEEKVRRWKE  613
             +E  V+ W++
Sbjct  136  -EETLVKEWRK  145



>ref|XP_002325276.2| hypothetical protein POPTR_0019s01160g [Populus trichocarpa]
 gb|EEE99657.2| hypothetical protein POPTR_0019s01160g [Populus trichocarpa]
Length=829

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GI  F+DDD L +G+ IS  LL+AIQESK  I +FS
Sbjct  18   FLSFRGEDTRKTFTDHLYSALVQAGIHAFRDDDDLPRGEEISDHLLRAIQESKISIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I+E +     Q+V+PI  +++PSDV+ Q GSF ++F    E+   
Sbjct  78   KGYASSRWCLNELVEILECKNRKTGQIVLPIFYHIDPSDVRKQNGSFAEAFANNEERF--  135

Query  581  DDEEKVRRWKE  613
             +E+ V+ W++
Sbjct  136  -EEKLVKEWRK  145



>ref|XP_010665467.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1134

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 95/130 (73%), Gaps = 5/130 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ +L+RKGI TF+DD RLE+G+ I+  LLK I+ES+  + +FS
Sbjct  23   FLSFRGEDTRYNFTDHLFVNLDRKGINTFRDD-RLERGEEITSELLKTIEESRISVVVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+ELA IME +E + EQ+V+P+  +V+PSDV+ Q GSF ++F      +  
Sbjct  82   KNYAHSKWCLDELAKIMECKEKM-EQIVLPVFYHVDPSDVEEQTGSFGEAFSIHERNV--  138

Query  581  DDEEKVRRWK  610
             DE+K++RW+
Sbjct  139  -DEKKMQRWR  147



>ref|XP_006478372.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1343

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L++KGI  F+DD  LE+G+ ISP L KAI+ESK  I +FS
Sbjct  22   FLSFRGVDTRKNFTDHLYTALDQKGIIVFRDDKELERGESISPGLFKAIEESKISIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E +    +QMV PI   VEP+DV+ Q G  E+ F    E+I  
Sbjct  82   RNYACSTWCLDELVHILECKNKNHQQMVYPIFYDVEPTDVRKQTGILEEVFAR-HEEILA  140

Query  581  DDEEKVRRWKE  613
             ++EKV++W++
Sbjct  141  QNKEKVQKWRD  151



>ref|XP_008339367.1| PREDICTED: toll/interleukin-1 receptor-like protein [Malus domestica]
Length=304

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+ +LY +L RKGI+TF DD+ L++G+ IS +LLKAI++S+  + +FS
Sbjct  28   FLSFRGEDTRNNFVGHLYNNLVRKGIKTFIDDEALKRGEEISAALLKAIEQSRVSVVVFS  87

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  I   +E L +QMV P+   V+PSDV+NQ  S   +      K+ K
Sbjct  88   ENYASSEWCLDELVHIFHCKEQL-QQMVFPVFYKVDPSDVRNQTKSLGKALAHHESKL-K  145

Query  581  DDEEKVRRWKE  613
            D+ +KV RW+E
Sbjct  146  DNMDKVLRWRE  156



>ref|XP_004233763.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1228

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT ++F+D+LY +L  KGI  F+DD  L +G  ISP L+KAI++S+F + IFS
Sbjct  21   FLSFRGEDTRKSFVDHLYTTLHDKGIHAFRDDKELSRGKSISPELVKAIEKSRFAVVIFS  80

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKI-G  577
            K YA S WCLEEL  I+E  +  + Q ++P+   V+PS V+ QKGS+ D+F +  E + G
Sbjct  81   KNYADSSWCLEELTKIVECNKQ-RGQTLIPVFYSVDPSVVRKQKGSYGDAFAKHEENLKG  139

Query  578  KDDEEKVRRWKE  613
             D+  K++RW++
Sbjct  140  SDESYKIQRWRD  151



>ref|XP_006495323.1| PREDICTED: putative disease resistance protein At4g11170-like, 
partial [Citrus sinensis]
Length=377

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG++T ++FI +LY +L  KGI  FKDD  LE+G  ISP LLKAI++S+  I +FS
Sbjct  17   FLSFRGANTRKSFISHLYAALNGKGIYVFKDDKELERGASISPGLLKAIEDSRISIIVFS  76

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S WCL+EL  I++ + +N  +QM+ PI   VEP+ V+ Q GSF ++F +  E+  
Sbjct  77   QNYASSTWCLDELVKIVQCKNKNDHQQMIFPIFYDVEPTVVRKQTGSFREAFSKH-EEAY  135

Query  578  KDDEEKVRRWKE  613
            +++ EKV+ W++
Sbjct  136  RENLEKVKNWRD  147



>ref|XP_009790280.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=826

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 89/131 (68%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +LY  L R GI TFKDD+ LE+G  ISP L+ AI+ S+F I IFS
Sbjct  20   FLSFRGEDTRKTFVAHLYRELRRAGINTFKDDETLERGASISPQLVNAIKRSRFAIIIFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  IME +  +  Q V+PI   + PS+V++Q+ SF ++F +  E+  K
Sbjct  80   KNYASSKWCLDELVKIMECRNEIG-QAVIPIFYDINPSEVRSQRNSFAEAFSKYEEEF-K  137

Query  581  DDEEKVRRWKE  613
             D  KV  W++
Sbjct  138  GDTNKVHSWRK  148



>ref|XP_006370866.1| hypothetical protein POPTR_0019s01210g [Populus trichocarpa]
 gb|ABB82032.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
 gb|ERP48663.1| hypothetical protein POPTR_0019s01210g [Populus trichocarpa]
Length=509

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GI TF+DDD L +G+ IS  LL+AIQESK  I +FS
Sbjct  18   FLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAIQESKISIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +     Q+V+PI   ++PSDV+ Q GSF + F +  E+   
Sbjct  78   KGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEPFDKHEERF--  135

Query  581  DDEEKVRRWKE  613
             +E+ V+ W++
Sbjct  136  -EEKLVKEWRK  145



>ref|XP_007220726.1| hypothetical protein PRUPE_ppa023276mg [Prunus persica]
 gb|EMJ21925.1| hypothetical protein PRUPE_ppa023276mg [Prunus persica]
Length=1201

 Score =   129 bits (325),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 63/130 (48%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +LE  GI TF+DDD +E+G  I+  L KAI ESK  I +FS
Sbjct  25   FLSFRGEDTRKGFTDHLYRALELAGIHTFRDDDEIERGADIAAELNKAINESKVSIIVFS  84

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IMER+++    +V+P+  +V+PS V+NQ+GSF ++F    E+  K
Sbjct  85   QNYASSRWCLDELVKIMERRKHDDGHIVMPVFYHVDPSHVRNQRGSFAEAFSRHEERF-K  143

Query  581  DDEEKVRRWK  610
            ++  KV  W+
Sbjct  144  EEMNKVEEWR  153



>ref|XP_009791999.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=340

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 88/131 (67%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +L   L R GI TFKDD+ LE+G  ISP L+ AI+ S+F I IFS
Sbjct  20   FLSFRGEDTRKTFVAHLNRELCRAGINTFKDDETLERGASISPQLISAIKRSRFAIIIFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  IME +  +  Q VVPI   + PS+V++Q+ SF ++F +  E+  K
Sbjct  80   KNYASSKWCLDELVKIMECRNEIG-QAVVPIFYDINPSEVRSQRNSFAEAFSKYEEEF-K  137

Query  581  DDEEKVRRWKE  613
             D  KV  W++
Sbjct  138  GDTNKVHSWRK  148



>ref|XP_006342413.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A6-like [Solanum tuberosum]
Length=377

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D   TF+ +LY +L +  I  FKDD+RLE G  IS  L KAI+ESKF I IFS
Sbjct  15   FLSFRGVDIRRTFVSHLYNALIQGRINVFKDDERLETGKSISDELPKAIEESKFAIVIFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+ELA I++ ++   + +V+PI   V+PSDV++Q  +F +SF +  EK  K
Sbjct  75   ESYASSKWCLDELAHIIKCRKEF-DLIVIPIFYNVDPSDVRHQTQTFAESFSKHEEKY-K  132

Query  581  DDEEKVRRWKE  613
            DD EK++RW++
Sbjct  133  DDMEKIQRWRD  143



>emb|CAN61899.1| hypothetical protein VITISV_029813 [Vitis vinifera]
Length=167

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 89/130 (68%), Gaps = 6/130 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L R+GI TF+DD +L +G+ I+P LLKAI+ES+  + +FS
Sbjct  27   FLSFRGEDTRYNFTDHLYSALGRRGIHTFRDD-KLRRGEAIAPELLKAIEESRSSVIVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IME Q++    +V PI  +V+PS V+ Q+GSF ++F    E    
Sbjct  86   ENYAHSRWCLDELVKIMECQKD-PAHVVFPIFYHVDPSHVRKQEGSFGEAFAGYEENW--  142

Query  581  DDEEKVRRWK  610
              ++K+ RW+
Sbjct  143  --KDKIPRWR  150



>ref|XP_009345565.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1210

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT ++F D+LY +LE  GI TF+DDD +++G+ I+  L KAI ESK  I +FS
Sbjct  24   FLSFRGEDTRKSFTDHLYRALELAGIHTFRDDDEIKRGEDIAAELHKAINESKVSIIVFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IMER+ +  E  V+P+   V+PS V+ Q GSFE+SF    E+  K
Sbjct  84   KNYASSRWCLDELVKIMERRRSDDEHFVLPVFYDVDPSHVRKQTGSFEESFHRHKERF-K  142

Query  581  DDEEKVRRWK  610
            ++ EKV  W+
Sbjct  143  EEMEKVDGWR  152



>dbj|BAD12595.1| truncated N protein [Nicotiana tabacum]
Length=638

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF  +LY  L  KGI+TF+DD RLE G  I   L KAI+ES+F I +FS
Sbjct  7    FLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFS  66

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL EL  IME +   K Q V+PI   V+PS V+NQK SF  +F+E   K  K
Sbjct  67   ENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHETKY-K  124

Query  581  DDEEKVRRWK  610
            DD E ++RW+
Sbjct  125  DDVEGIQRWR  134



>gb|KDO42763.1| hypothetical protein CISIN_1g002220mg [Citrus sinensis]
Length=951

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +LY +L RK I+TF DD+ L +GD ISP+LL AIQ SK  + IFS
Sbjct  14   FLSFRGEDTRDNFTSHLYAALCRKKIKTFIDDEELRRGDDISPALLNAIQGSKISVIIFS  73

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  I++  +NL  QMVVP+   V+PSDV+ Q G F D+F +  +K  K
Sbjct  74   KDYASSKWCLDELVKILD-CKNLNGQMVVPVFYQVDPSDVRKQTGCFRDAFVK-HQKQFK  131

Query  581  DDEEKVRRWK  610
            D  EK + WK
Sbjct  132  DMPEKAQNWK  141



>ref|XP_010650377.1| PREDICTED: uncharacterized protein LOC104879391 [Vitis vinifera]
Length=555

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L R+GI TF+DDD L++G+ I+P LLKAI+ES+F + +FS
Sbjct  23   FLSFRGEDTRFNFTDHLYANLIRRGIATFRDDDSLKRGEEIAPELLKAIEESRFSLIVFS  82

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S+WCL+EL  IM+ ++ +K Q+VVPI   V+PS V++Q G F  +F    E   +
Sbjct  83   GNYAGSRWCLDELVKIMKCRKEMK-QIVVPIFYQVDPSHVRHQTGRFGKAFSNYKEDT-E  140

Query  581  DDEEKVRRWK  610
            + +EKVR W+
Sbjct  141  EMKEKVRSWR  150



>ref|XP_008359477.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=199

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L+ KGI TF+DD +L +G  I+P LLKAI+ES+F + IFS
Sbjct  18   FLSFRGEDTRMNFTDHLYAALDLKGIMTFRDDLKLGRGKSIAPELLKAIEESRFAVVIFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+ L+ I E  + L  Q V P+   V+PS+V+ Q GSF  +F    E   K
Sbjct  78   RNYASSAWCLDGLSKICECMKELG-QTVFPVFYDVDPSEVRRQTGSFGKAFAAHEESF-K  135

Query  581  DDEEKVRRWK  610
             + EKV+RW+
Sbjct  136  GNVEKVQRWR  145



>gb|AES66953.2| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=763

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            F+SFRG+DT  TF+D+L+  L  KGI  FKDD RLEKG+ +SP LL+AIQ S+  I +FS
Sbjct  42   FISFRGADTRSTFVDHLHAHLTTKGIFAFKDDKRLEKGESLSPQLLQAIQSSRISIVVFS  101

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S  CLEE+ATI E    LK Q V PI    +PS V+ Q G ++++F  L  K  K
Sbjct  102  KNYAESTLCLEEMATIAEYHTELK-QTVFPIFYDADPSHVRKQSGVYQNAFVLLQNKF-K  159

Query  581  DDEEKVRRW  607
             D  KV RW
Sbjct  160  HDPNKVMRW  168



>emb|CAN68265.1| hypothetical protein VITISV_020931 [Vitis vinifera]
Length=1441

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 92/131 (70%), Gaps = 6/131 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRL-EKGDCISPSLLKAIQESKFLIAIF  397
            FLSFRG+DT   F D+LY +L ++GI TFKDDD L  +G+ I+P LLKA++ES+  I + 
Sbjct  39   FLSFRGADTRYNFTDHLYTALVQRGINTFKDDDNLIRRGEEIAPKLLKAVEESRSCIVVL  98

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            SK YA S+WCL+ELATIMER+     Q+V PI  +V+PSDV+NQ GSF  +F    E   
Sbjct  99   SKTYADSRWCLDELATIMERRREFG-QLVFPIFYHVDPSDVRNQSGSFGKAFANYEE---  154

Query  578  KDDEEKVRRWK  610
             + ++KV RW+
Sbjct  155  -NWKDKVERWR  164



>emb|CAA08797.1| NL25 [Solanum tuberosum]
Length=533

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF  +L+  L+ +GI TF+DD RLEKGD I   LLKAI+ES+  + IFS
Sbjct  24   FLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVALVIFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSF  553
            K YA S+WCL EL  IME +E +K+Q+V+P+   V+PSDV++Q GSF ++F
Sbjct  84   KNYATSRWCLNELVKIMECKE-VKKQIVMPVFYDVDPSDVRHQTGSFAEAF  133



>ref|XP_006441589.1| hypothetical protein CICLE_v10018553mg [Citrus clementina]
 gb|ESR54829.1| hypothetical protein CICLE_v10018553mg [Citrus clementina]
Length=1217

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +LY +L RK I+TF DD+ L +GD ISP+LL AIQ SK  + IFS
Sbjct  14   FLSFRGEDTRDNFTSHLYAALCRKKIKTFIDDEELRRGDDISPALLNAIQGSKISVIIFS  73

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  I++ + NL  QMVVP+   V+PSDV+ Q G F D+F +  +K  K
Sbjct  74   KDYASSKWCLDELVKILDCK-NLNGQMVVPVFYQVDPSDVRKQTGCFRDAFVK-HQKQFK  131

Query  581  DDEEKVRRWK  610
            D  EK + WK
Sbjct  132  DMPEKAQNWK  141



>ref|XP_006478214.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1250

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  +LY +L RK I+TF DD+ L +GD ISP+LL AIQ SK  + IFS
Sbjct  14   FLSFRGEDTRDNFTSHLYAALCRKKIKTFIDDEELRRGDDISPALLNAIQGSKISVIIFS  73

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  I++ + NL  QMVVP+   V+PSDV+ Q G F D+F +  +K  K
Sbjct  74   KDYASSKWCLDELVKILDCK-NLNGQMVVPVFYQVDPSDVRKQTGCFRDAFVKH-QKQFK  131

Query  581  DDEEKVRRWK  610
            D  EK + WK
Sbjct  132  DMPEKAQNWK  141



>ref|XP_010665287.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1325

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 92/130 (71%), Gaps = 6/130 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSF G DT   F D+LY +L RKGIRTF+D + L KG+ I+P LLKAI++S+  + I S
Sbjct  28   FLSFMGEDTRHNFTDHLYRALNRKGIRTFRDAEELRKGEEIAPELLKAIEKSRICLIILS  87

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCLEEL  IMER++++  Q+V PI  +V+PSDV+ Q GS+E +F+       +
Sbjct  88   KNYARSRWCLEELVKIMERRQSMG-QLVFPIFYHVDPSDVRRQTGSYEQAFER-----HE  141

Query  581  DDEEKVRRWK  610
             + ++++RW+
Sbjct  142  RNPDQIQRWR  151


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 54/111 (49%), Gaps = 33/111 (30%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSF+G DT   F D LY                                 S+ ++ I S
Sbjct  221  FLSFKGKDTSHNFTDNLY--------------------------------ISRLVLVILS  248

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSF  553
              YA S WCLEEL  IME +E +  ++V P+  +V+PS V+NQKGS+ ++F
Sbjct  249  HNYARSNWCLEELVRIMECREEMG-KIVFPVFYHVDPSHVRNQKGSYGEAF  298



>gb|AAA91021.1| L6tr [Linum usitatissimum]
Length=705

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT E F D+LY SL R  I TF+DDD L KG  I P+LL+AI +SK  + I S
Sbjct  64   FLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIIS  123

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
             GYA SKWCL ELA I+ RQE    ++++PI   V+PSDV++Q G ++ +F++   K   
Sbjct  124  SGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKF--  181

Query  581  DDEEKVRRWKE  613
             D + ++ WK+
Sbjct  182  -DGQTIQNWKD  191



>ref|XP_009630491.1| PREDICTED: uncharacterized protein LOC104120435 [Nicotiana tomentosiformis]
Length=1980

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D  + F+D+LY +L++KGI TFKDD++LE+G  ISP+L++AI+ES+  + IFS
Sbjct  21   FLSFRGEDVRKKFVDHLYVALQQKGIHTFKDDEKLERGKSISPNLMRAIEESRIALIIFS  80

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IME  +NLK Q+V P+   V+PS V+ QK SF ++F    E  G 
Sbjct  81   KNYANSRWCLDELVKIME-CKNLKGQIVFPVFYDVDPSTVRKQKSSFGEAFSN-HEARGC  138

Query  581  DDEEKVRRWK  610
              + K+++W+
Sbjct  139  IKDNKLQKWR  148


 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = +2

Query  221   FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
             FLSFRG D  +TF+D+LY +L+++GI TFKDD++LE+G  ISP L++AI+E++  + IFS
Sbjct  1180  FLSFRGEDVRKTFVDHLYVALQQRGIHTFKDDEKLERGKSISPDLIRAIEEARIALIIFS  1239

Query  401   KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
             K YA SKWCL+EL  IME  +  K Q+V+P+   V+PS V+ QK SF ++F     +I  
Sbjct  1240  KNYADSKWCLDELMKIMECNKQ-KGQIVLPVFYDVDPSTVRKQKSSFGEAFSN--HEISC  1296

Query  581   DDEEKVRRWK  610
               + KV +W+
Sbjct  1297  FKDNKVEKWR  1306



>gb|AFP55548.1| TIR-NBS-LRR [Rosa rugosa]
Length=1115

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F DYLY  L+R+GIRTF+DD +LE+G  ISP LL AI++S+F I + S
Sbjct  22   FLSFRGEDTRKGFTDYLYHELQRRGIRTFRDDPQLERGTAISPELLTAIEQSRFAIVVLS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL EL+ I+E  E  +   ++PI   V+PS V++Q+GSF ++F+E  EK G 
Sbjct  82   PNYASSTWCLLELSKILECME--ERGTILPIFYEVDPSHVRHQRGSFAEAFQEHEEKFGV  139

Query  581  DDEEKVRRWKE  613
             + +KV  W++
Sbjct  140  GN-KKVEGWRD  149



>ref|XP_003596702.1| TIR-NBS-LRR type disease resistance protein [Medicago truncatula]
Length=747

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 2/129 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            F+SFRG+DT  TF+D+L+  L  KGI  FKDD RLEKG+ +SP LL+AIQ S+  I +FS
Sbjct  71   FISFRGADTRSTFVDHLHAHLTTKGIFAFKDDKRLEKGESLSPQLLQAIQSSRISIVVFS  130

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S  CLEE+ATI E    LK Q V PI    +PS V+ Q G ++++F  L  K  K
Sbjct  131  KNYAESTLCLEEMATIAEYHTELK-QTVFPIFYDADPSHVRKQSGVYQNAFVLLQNKF-K  188

Query  581  DDEEKVRRW  607
             D  KV RW
Sbjct  189  HDPNKVMRW  197



>ref|XP_006371227.1| hypothetical protein POPTR_0019s06300g [Populus trichocarpa]
 gb|ERP49024.1| hypothetical protein POPTR_0019s06300g [Populus trichocarpa]
Length=850

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GI TF+DDD L +G+ IS  LL+AIQESK  I +FS
Sbjct  18   FLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELSRGEEISKHLLRAIQESKISIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +    +Q+V+PI   ++PSDV+ Q GSF ++F +  E+   
Sbjct  78   KGYASSRWCLNELVEILKCKNRKTDQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEERF--  135

Query  581  DDEEKVRRWKE  613
             +E+ V+ W++
Sbjct  136  -EEKLVKEWRK  145



>ref|XP_002310389.2| hypothetical protein POPTR_0007s00600g [Populus trichocarpa]
 gb|EEE90839.2| hypothetical protein POPTR_0007s00600g [Populus trichocarpa]
Length=1113

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GI TF+DDD L +G+ IS  LL+AIQESK  I +FS
Sbjct  18   FLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISQHLLEAIQESKICIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL+EL  I++ +     Q+ +PI   ++PSDV+ Q GSF ++F +  E+   
Sbjct  78   KGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVKHEER---  134

Query  581  DDEEKVRRWKE  613
              EEKV+ W+E
Sbjct  135  -SEEKVKEWRE  144



>ref|XP_010665437.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=163

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY +L++KGI TF DD +L  G+ ISP L+ AIQ S+  I + S
Sbjct  19   FLSFRGEDTRNNFTSHLYKALDQKGIETFMDDKKLRTGEEISPILVGAIQRSRCSIIVLS  78

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCLEEL  I+E +   K Q VVPI   V+PS V+NQ GSF ++  +  E + K
Sbjct  79   ENYASSKWCLEELVEILECKRT-KNQRVVPIFYNVDPSHVRNQTGSFGEALSKHEENL-K  136

Query  581  DDEEKVRRWKE  613
               EK+R+W+E
Sbjct  137  IKGEKLRKWRE  147



>ref|XP_007134526.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 ref|XP_007134527.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06520.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06521.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
Length=185

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            F+SFRG DT  TF D+L+ SL  KGI  FKDD+ L+KG+ I+P LL+AIQ S+  I +FS
Sbjct  24   FVSFRGEDTRNTFTDFLFHSLRTKGINVFKDDEDLKKGESIAPELLQAIQVSRLFIVVFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL ELA I    E     +++PI   V+PS V+ Q G +E +F E  ++ G+
Sbjct  84   ENYASSTWCLRELAEICNCCET-SPSVIIPIFYDVDPSVVRKQSGRYEKAFAEHEKRFGE  142

Query  581  DD--EEKVRRWKE  613
            D+   E+V+RW++
Sbjct  143  DEVKMEEVQRWRQ  155



>ref|XP_004489474.1| PREDICTED: TMV resistance protein N-like isoform X2 [Cicer arietinum]
Length=1136

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +F  +LY SL+  GI  FKDDD LE+GDCIS S+ +AIQES+  + +FS
Sbjct  81   FLSFRGEDTRASFTSHLYASLQNAGITVFKDDDSLERGDCISSSIYQAIQESQISVIVFS  140

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IM+    +  Q+V+PI   V+PS+V++QKG F  +F+ L+ +I  
Sbjct  141  RNYADSRWCLDELVEIMKCHRTI-SQVVLPIFYGVDPSEVRHQKGEFGKAFQNLLNRIST  199

Query  581  DDEEKV  598
            + +E +
Sbjct  200  EKDESL  205



>ref|XP_003622506.1| TMV resistance protein N [Medicago truncatula]
 gb|KEH18830.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1137

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+L+ SLER+GI+TFKDD  LE+G+ IS  L KAI+ES F I I S
Sbjct  27   FLSFRGEDTRQGFTDHLFASLERRGIKTFKDDHDLERGEVISYELNKAIEESMFAIIILS  86

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL+EL  I+E  ++   Q V PI   V+PSDV++Q+GSF+++F++  EK  K
Sbjct  87   PNYASSTWCLDELKKIVECSKSFG-QAVFPIFYGVDPSDVRHQRGSFDEAFRKHEEKFRK  145

Query  581  DDEEKVRRWKE  613
             D  KV RW++
Sbjct  146  -DRTKVERWRD  155



>ref|XP_004489473.1| PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum]
Length=1145

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 88/126 (70%), Gaps = 1/126 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +F  +LY SL+  GI  FKDDD LE+GDCIS S+ +AIQES+  + +FS
Sbjct  90   FLSFRGEDTRASFTSHLYASLQNAGITVFKDDDSLERGDCISSSIYQAIQESQISVIVFS  149

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IM+    +  Q+V+PI   V+PS+V++QKG F  +F+ L+ +I  
Sbjct  150  RNYADSRWCLDELVEIMKCHRTI-SQVVLPIFYGVDPSEVRHQKGEFGKAFQNLLNRIST  208

Query  581  DDEEKV  598
            + +E +
Sbjct  209  EKDESL  214



>gb|KEH15762.1| disease resistance protein (TIR-NBS-LRR class), partial [Medicago 
truncatula]
Length=166

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 89/131 (68%), Gaps = 2/131 (2%)
 Frame = +2

Query  218  FFLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIF  397
             FLSFRG DT      +LY +L RK I TF D++ L+KGD IS +L+KAI+ES   I IF
Sbjct  21   IFLSFRGEDTRRNLTSHLYDALSRKKIETFMDNNELQKGDEISAALIKAIEESHASIVIF  80

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            S+ YA SKWCL EL  I+E ++ + EQMV+P+   ++P++V+ Q GS+E +F++    + 
Sbjct  81   SENYASSKWCLNELKKILECKQYM-EQMVIPVFYNLDPANVRKQTGSYEQAFEKHKRDL-  138

Query  578  KDDEEKVRRWK  610
            K + +K++ WK
Sbjct  139  KSNNDKLKNWK  149



>ref|XP_004228809.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1326

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+ +L  +L++KGI TFKDD+RLE+G  ISP L+KAI+ES+F I +FS
Sbjct  14   FLSFRGKDTRKTFVGHLNYALKQKGIHTFKDDERLERGKTISPELVKAIEESRFAIVVFS  73

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  IME ++ L  Q V+PI   V+PS V  Q  +F  SF    E + K
Sbjct  74   KNYASSTWCLDELVKIMECKKELG-QTVIPIFYDVDPSHVTKQSETFAKSFAIHEENL-K  131

Query  581  DDEEKVRRWKE  613
            DD EKV  W++
Sbjct  132  DDVEKVLCWRD  142



>gb|KHN01586.1| TMV resistance protein N, partial [Glycine soja]
Length=367

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 95/130 (73%), Gaps = 4/130 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY +L+ KGI TF DD+ L++G+ I+P+L+KAI +S+  I + S
Sbjct  17   FLSFRGEDTRHGFTGHLYNTLQSKGIHTFIDDEELKRGEEITPALMKAIPDSRVAITVLS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S +CL+ELATI+++++ L   +V+P+   V+PSDV+NQ+GS+ ++  EL E+  +
Sbjct  77   EHYASSSFCLDELATILDQRKRL---LVIPVFYKVDPSDVRNQRGSYGEALAEL-ERRFQ  132

Query  581  DDEEKVRRWK  610
             D EK+++WK
Sbjct  133  HDPEKLQKWK  142



>ref|XP_008232158.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=679

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +LE  GI TF+DDD +E+G  I+  L KAI ESK  I +FS
Sbjct  18   FLSFRGEDTRKGFTDHLYRALELAGIHTFRDDDEIERGADIAAELNKAINESKVSIIVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  IMER+++    +V+P+  +V+PS V+NQ+ SF ++F    E+  K
Sbjct  78   QNYASSRWCLDELVKIMERRKHDDGHIVMPVFYHVDPSHVRNQRESFAEAFSRHEERF-K  136

Query  581  DDEEKVRRWK  610
            ++  KV +W+
Sbjct  137  EEMNKVEKWR  146



>ref|XP_007219308.1| hypothetical protein PRUPE_ppa018964mg, partial [Prunus persica]
 gb|EMJ20507.1| hypothetical protein PRUPE_ppa018964mg, partial [Prunus persica]
Length=1005

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ +L RKGIRTF D + L +G+ ISP+L++AI+ES+  + +FS
Sbjct  34   FLSFRGEDTRTNFTDHLHEALVRKGIRTFIDRE-LVRGEEISPALVRAIEESRISLIVFS  92

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + Y  S+WCL+EL  I++ +E+ K+Q+V+PI   V+PSDV+ Q  SF D+FK L++   K
Sbjct  93   ENYPSSRWCLDELVKILQCKES-KQQIVLPIFYKVDPSDVRKQTNSFGDAFKGLIQSKFK  151

Query  581  DDEEKVRRWKE  613
            DD+EKV  WKE
Sbjct  152  DDKEKVLIWKE  162



>ref|XP_004492775.1| PREDICTED: TMV resistance protein N-like isoform X2 [Cicer arietinum]
Length=1079

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+L  SLERKGI TF+DD  L +G  IS  L+ AIQ+S F I I S
Sbjct  30   FLSFRGEDTRKGFTDHLCASLERKGITTFRDDKDLVRGQVISKKLINAIQDSMFAITILS  89

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S WCL+EL  IME    NL+   V P+   V+PSDV++Q+GS+ED+F++  E+ G
Sbjct  90   QDYASSTWCLDELQMIMECSNNNLQGLEVFPVFYGVDPSDVRHQRGSYEDAFRKHQERFG  149

Query  578  KDDEEKVRRWKE  613
            +   +KV RW++
Sbjct  150  Q-HSDKVERWRD  160



>ref|XP_011002560.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=166

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+L  +L   G  TF+DDD + +G  I   L KAIQ+SK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLSKALVDAGFHTFRDDDEIRRGKNIQLELQKAIQQSKIAIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K +A S+WCL+EL  IMER+ N  + +V P+  +V+PS+V+NQ GSF  +F E  EK  K
Sbjct  82   KNHASSRWCLDELVMIMERKRN-ADCIVFPVFYHVDPSEVRNQTGSFAAAFVEH-EKHFK  139

Query  581  DDEEKVRRWK  610
            ++ E+V  W+
Sbjct  140  EEMERVNGWR  149



>ref|XP_010644041.1| PREDICTED: uncharacterized protein LOC104877471 [Vitis vinifera]
Length=2027

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT ++F D+LY +L R  I TF+DD+ L +G+ I+P LLKAI+ES+  I +FS
Sbjct  24   FLSFRGEDTRKSFTDHLYSALIRNNIHTFRDDEELPRGEEIAPELLKAIEESRSAIIVFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCLEEL  IM+ +E  ++ +V+PI  +V+PS+V+NQ   + ++F    +   +
Sbjct  84   KTYAHSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQSEIYGEAFSHHEKNADE  143

Query  581  DDEEKVRRWK  610
            + +EK+R+WK
Sbjct  144  ERKEKIRKWK  153



>ref|XP_011044953.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=542

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L + GI TF+DD+ L KG+ IS  LLKAIQESK  I +FS
Sbjct  17   FLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNELRKGEEISSHLLKAIQESKISIVVFS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S WCL+EL+ I++ ++    Q+V+P+   ++PSD++ QK SF ++F    E++ K
Sbjct  77   KGYASSTWCLDELSEILDCRQT-AGQIVLPVFYDIDPSDIRKQKRSFAEAFDRH-EELFK  134

Query  581  DDEEKVRRWKE  613
            ++ EKV++W++
Sbjct  135  EEMEKVQKWRK  145



>ref|XP_007199998.1| hypothetical protein PRUPE_ppa024831mg, partial [Prunus persica]
 gb|EMJ01197.1| hypothetical protein PRUPE_ppa024831mg, partial [Prunus persica]
Length=894

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L RKGIRTF DD  L++G+ IS +LL+AI+ESK  I +FS
Sbjct  6    FLSFRGEDTRFNFTDHLYSNLTRKGIRTFIDDG-LKRGEEISRALLRAIEESKTSIIVFS  64

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I+E +E  +EQMV P+   V PSDV++Q+GSF  +  +  E   K
Sbjct  65   ENYASSKWCLDELVKILESKET-REQMVWPVFYKVNPSDVRHQRGSFGQALAD-YECEFK  122

Query  581  DDEEKVRRWK  610
            DD EKV+RW+
Sbjct  123  DDMEKVQRWR  132



>gb|ABF81471.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1368

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GI TF+DDD L +G+ IS  LL+AIQESK  I +FS
Sbjct  124  FLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISQHLLEAIQESKICIVVFS  183

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL+EL  I++ +     Q+ +PI   ++PSDV+ Q GSF ++F +  E+   
Sbjct  184  KGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVKHEER---  240

Query  581  DDEEKVRRWKE  613
              EEKV+ W+E
Sbjct  241  -SEEKVKEWRE  250



>ref|XP_002316578.2| hypothetical protein POPTR_0011s01930g [Populus trichocarpa]
 gb|EEE97190.2| hypothetical protein POPTR_0011s01930g [Populus trichocarpa]
Length=368

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L   G  TF+DDD + +G  I   L KAIQ+SK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLYKALVDAGFHTFRDDDEIRRGKNIELELQKAIQQSKIAIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IMER+ N  + +V P+  +V+PS+V+NQ GSF  +F E  EK  K
Sbjct  82   KNYAWSRWCLDELVMIMERKRN-ADCIVFPVFYHVDPSEVRNQTGSFAAAFVEH-EKHYK  139

Query  581  DDEEKVRRWK  610
            ++ E+V  W+
Sbjct  140  EEMERVNGWR  149



>ref|XP_007226709.1| hypothetical protein PRUPE_ppa020033mg [Prunus persica]
 gb|EMJ27908.1| hypothetical protein PRUPE_ppa020033mg [Prunus persica]
Length=1168

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY +L R+GI TF DDD L +G+ IS +LL AI++SK  + +FS
Sbjct  22   FLSFRGFDTRSNFTSHLYSALRREGINTFMDDDELRRGEEISNALLTAIEDSKISVVVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I++ +E+  +Q+V+P+   V PSDV+NQ+GSF D+   +      
Sbjct  82   ENYASSKWCLDELVKILDCKES-NQQLVIPVFYKVNPSDVRNQRGSFRDALANM----DC  136

Query  581  DDEEKVRRWKE  613
            ++ EKV RWKE
Sbjct  137  NNLEKVNRWKE  147



>ref|XP_010645836.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=176

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 2/133 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F+D+LY  L   G  TF+DD++LE+G  IS  LL AI+ES   + +FS
Sbjct  22   FLSFRGGDTRTNFVDHLYAGLVANGFHTFRDDEQLERGGEISSQLLDAIEESHIFLVVFS  81

Query  401  KGYALSKWCLEELATIMERQENL--KEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKI  574
            + YA S+WCL EL  I+   E    K ++V+PI  +V PSDV++Q GS+   +   VE  
Sbjct  82   ENYADSRWCLNELLDIINSTEFARDKSRIVLPIFYHVNPSDVRHQSGSYATRYTSPVEDA  141

Query  575  GKDDEEKVRRWKE  613
             +D+   +  WK 
Sbjct  142  DEDEVAIIENWKN  154



>ref|XP_010070519.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=231

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 90/131 (69%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D    F+ +LY +L++ GI T+ D++ L KG+ ISP+L+KAI+ES+  I +FS
Sbjct  76   FLSFRGPDVRNHFLSHLYAALDQVGISTYIDNEELRKGEQISPALMKAIEESQIAIVVFS  135

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCLEE++ IME +E  K  MV+P+   VEP +V+ QK S+  +  E   K GK
Sbjct  136  ENYASSTWCLEEISKIMECKEK-KGLMVLPVFYKVEPREVRGQKQSYGKAMGEHEVKFGK  194

Query  581  DDEEKVRRWKE  613
            + E+ V+RWK+
Sbjct  195  NSEQ-VKRWKK  204



>ref|XP_007134525.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06519.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
Length=205

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            F+SFRG DT  TF D+L+ SL  KGI  FKDD+ L+KG+ I+P LL+AIQ S+  I +FS
Sbjct  24   FVSFRGEDTRNTFTDFLFHSLRTKGINVFKDDEDLKKGESIAPELLQAIQVSRLFIVVFS  83

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL ELA I    E     +++PI   V+PS V+ Q G +E +F E  ++ G+
Sbjct  84   ENYASSTWCLRELAEICNCCET-SPSVIIPIFYDVDPSVVRKQSGRYEKAFAEHEKRFGE  142

Query  581  DD--EEKVRRWKE  613
            D+   E+V+RW++
Sbjct  143  DEVKMEEVQRWRQ  155



>gb|AEE43929.1| TIR-NBS-LRR resistance protein muRdr1E [Rosa multiflora]
Length=1143

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 89/131 (68%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F  YLY  L+R+GIRTF+DD +LE+G  ISP LL AI++S+F I + S
Sbjct  22   FLSFRGEDTRKGFTGYLYHELQRRGIRTFRDDPQLERGTAISPELLTAIEQSRFAIVVLS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL EL+ I+E  E  +   ++PI   V PS V++Q+GSF ++F+E  EK GK
Sbjct  82   PNYASSTWCLLELSKILECME--ERGTILPIFYEVNPSHVRHQRGSFAEAFQEHQEKFGK  139

Query  581  DDEEKVRRWKE  613
             + E V  W++
Sbjct  140  GNNE-VEGWRD  149



>ref|XP_011012496.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1109

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L + G  TF+DDD + +G+ I   L KAIQESK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLYWALVQAGFHTFRDDDEIRRGENIELELQKAIQESKISIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL+EL  IMER+ N  + +V P+  +V+PS+V+NQ GSF  +F E  EK  K
Sbjct  82   KGYASSRWCLDELVMIMERKRN-ADCIVFPVFYHVDPSEVRNQTGSFATAFVEH-EKHYK  139

Query  581  DDEEKVRRWK  610
            D+ E V  W+
Sbjct  140  DEVELVNGWR  149



>gb|AEE43927.1| TIR-NBS-LRR resistance protein muRdr1C [Rosa multiflora]
Length=1139

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F DYLY  L+R+GI TF+DD +LE+G  ISP LL AI++S+F I + S
Sbjct  22   FLSFRGEDTRKGFTDYLYHELQRRGIWTFRDDPQLERGTAISPELLTAIEQSRFAIVVLS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA SKWCL EL+ I+E  E  +   ++P+   V+PS V++Q+GSF ++F+E  EK G+
Sbjct  82   PNYATSKWCLLELSKIIECME--ERGTILPVFYEVDPSHVRHQRGSFAEAFQEHEEKFGE  139

Query  581  DDEE  592
             +EE
Sbjct  140  GNEE  143



>ref|XP_011011343.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=166

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L + GI TF+DD+ + +G+ I   L KAIQESK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLYTALVQAGIHTFRDDNEIRRGENIDFELQKAIQESKISIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IMER+ N+ + +V+P+   V+PS V  Q GSF  +F E  EK   
Sbjct  82   KDYASSRWCLDELVMIMERKRNV-DCLVLPVFYDVDPSQVGRQTGSFAAAFVEH-EKSFN  139

Query  581  DDEEKVRRWK  610
            +++E+V  W+
Sbjct  140  EEKERVSGWR  149



>gb|AFP55569.1| TIR-NBS-LRR [Rosa rugosa]
Length=1134

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F DYLY  L+R+GIRTF+DD +LE+G  ISP LL AI++S+F I + S
Sbjct  22   FLSFRGEDTRKGFTDYLYIELQRQGIRTFRDDPQLERGTAISPELLTAIEQSRFAIVVLS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL EL+ I+E  E  +   ++PI   V+PS V++Q+GSF ++F+E  EK G 
Sbjct  82   PKYATSTWCLRELSKILECME--ERGTILPIFYEVDPSHVRHQRGSFAEAFQEHEEKFGV  139

Query  581  DDEEKVRRWKE  613
             ++E V  W++
Sbjct  140  GNKE-VEGWRD  149



>ref|XP_011012495.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1122

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L + G  TF+DDD + +G+ I   L KAIQESK  I +FS
Sbjct  35   FLSFRGEDTRKNFTDHLYWALVQAGFHTFRDDDEIRRGENIELELQKAIQESKISIIVFS  94

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL+EL  IMER+ N  + +V P+  +V+PS+V+NQ GSF  +F E  EK  K
Sbjct  95   KGYASSRWCLDELVMIMERKRN-ADCIVFPVFYHVDPSEVRNQTGSFATAFVEH-EKHYK  152

Query  581  DDEEKVRRWK  610
            D+ E V  W+
Sbjct  153  DEVELVNGWR  162



>ref|XP_004492774.1| PREDICTED: TMV resistance protein N-like isoform X1 [Cicer arietinum]
Length=1143

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+L  SLERKGI TF+DD  L +G  IS  L+ AIQ+S F I I S
Sbjct  30   FLSFRGEDTRKGFTDHLCASLERKGITTFRDDKDLVRGQVISKKLINAIQDSMFAITILS  89

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S WCL+EL  IME    NL+   V P+   V+PSDV++Q+GS+ED+F++  E+ G
Sbjct  90   QDYASSTWCLDELQMIMECSNNNLQGLEVFPVFYGVDPSDVRHQRGSYEDAFRKHQERFG  149

Query  578  KDDEEKVRRWKE  613
            +   +KV RW++
Sbjct  150  Q-HSDKVERWRD  160



>ref|XP_007199645.1| hypothetical protein PRUPE_ppa022914mg, partial [Prunus persica]
 gb|EMJ00844.1| hypothetical protein PRUPE_ppa022914mg, partial [Prunus persica]
Length=873

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+  L RKGIRTF DD  L++G+ ISP+LL+AI+ESK  I +FS
Sbjct  6    FLSFRGEDTRFNFTDHLHSHLTRKGIRTFIDDG-LKRGEEISPALLRAIKESKISIIVFS  64

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  I+E +E  +EQ+V P+   V PSDV++Q+GSF  +  +  E   K
Sbjct  65   ENYASSKWCLDELVKILESKET-REQIVWPVFYKVNPSDVRHQRGSFGQALAD-YECEFK  122

Query  581  DDEEKVRRWK  610
            DD +KV+RW+
Sbjct  123  DDMKKVQRWR  132



>ref|XP_002325612.2| hypothetical protein POPTR_0019s127002g, partial [Populus trichocarpa]
 gb|EEE99993.2| hypothetical protein POPTR_0019s127002g, partial [Populus trichocarpa]
Length=192

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 87/129 (67%), Gaps = 4/129 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY +L+RK I TF D  +L +GD IS SLL+ I+E+K  + +FS
Sbjct  49   FLSFRGEDTRFDFTSHLYAALKRKQILTFIDY-QLVRGDEISASLLRTIEEAKLSVIVFS  107

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEK--I  574
            + YA SKWCLEELA I ER++N   Q+V+P+   V+PS V+NQ GSF D+F  L+ K  +
Sbjct  108  ENYASSKWCLEELAKIFERRKN-NGQIVIPVFYQVDPSHVRNQTGSFGDAFARLIRKKAL  166

Query  575  GKDDEEKVR  601
              D E+  R
Sbjct  167  TMDKEQSFR  175



>ref|XP_008382746.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
 ref|XP_008382749.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=185

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  TF  +LY +L RK I TF D  +LE+GD I+P+L++AI++SK  + IFS
Sbjct  18   FLSFRGEDTRNTFTSHLYAALRRKKIETFIDY-KLERGDKIAPALVEAIEKSKLSVIIFS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  I+  +E    Q V+PI   ++PS ++ Q+G++ D+F  L E+  K
Sbjct  77   KNYASSTWCLDELVHILRCKERYG-QFVIPIFYDIDPSHIRKQQGTYADAFARLEERF-K  134

Query  581  DDEEKVRRWKE  613
            D  +KV +W++
Sbjct  135  DSMDKVHKWRD  145



>ref|XP_007204862.1| hypothetical protein PRUPE_ppa021004mg, partial [Prunus persica]
 gb|EMJ06061.1| hypothetical protein PRUPE_ppa021004mg, partial [Prunus persica]
Length=165

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L  +GI TF+D+ ++ KG  IS  L+ AI+ SKF + + S
Sbjct  22   FLSFRGDDTRKGFTDHLYETLRAQGIITFRDEPKISKGKSISGELIAAIEGSKFALIVLS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I++  E    + V+PI  YV+PS V+ Q G FE +F +L E+   
Sbjct  82   QNYASSTWCLDELLHILKFME--AREAVLPIFYYVDPSHVRKQTGCFEKAFTQLEERFSS  139

Query  581  DDEEKVRRWKE  613
            DD+ KV+ W++
Sbjct  140  DDKTKVQEWRD  150



>ref|XP_006353757.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1218

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +T I YLY  L RKGI  F+DD RLE+GD I   LLKAIQ+S+  + IFS
Sbjct  20   FLSFRGEDTRKTIIGYLYERLTRKGIIAFQDDKRLERGDSIPEELLKAIQDSQVALIIFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S+WCL+EL  IME  ++  E++V+P+   VEPS V+NQ  SF ++F E   K   
Sbjct  80   GNYATSRWCLDELVKIMECTKDENEKIVMPVFYGVEPSHVRNQSDSFAEAFAEHESKYKD  139

Query  581  DDE--EKVRRWK  610
            D E  +KV+ W+
Sbjct  140  DGEGMQKVKEWR  151



>ref|XP_006602339.1| PREDICTED: TMV resistance protein N-like [Glycine max]
Length=162

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            F+SFRG DT  TF  +L  +  R  IRT+ D  +L +GD ISP+L++AI+ESK  + + S
Sbjct  18   FISFRGEDTRHTFTAHLLAAFYRLKIRTYVDY-KLGRGDEISPTLIRAIEESKVSVIVLS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCLEEL  IME +   K Q+ +P+  +V+PSDV+NQ GS+ D+F    ++  K
Sbjct  77   KNYATSKWCLEELVKIMECRRT-KGQIAIPVFYHVDPSDVRNQTGSYADAFANHEQRF-K  134

Query  581  DDEEKVRRWK  610
            D+ +KV  W+
Sbjct  135  DNVQKVELWR  144



>ref|XP_010646047.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=205

 Score =   120 bits (302),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 8/132 (6%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +LY  L RKGIRTF+DD +L +G+ I+P LL AI++S+  I +FS
Sbjct  24   FLSFRGEDTRNNFTSHLYTDLVRKGIRTFRDD-KLPRGEKIAPELLNAIEKSRSSIIVFS  82

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            K YA S+WCL+ELA IME RQE    Q V+PI  +V+PSDV+ Q G F ++F    E   
Sbjct  83   KTYADSRWCLDELAKIMECRQE--YRQKVLPIFYHVDPSDVRKQTGRFGEAFTRHEENW-  139

Query  578  KDDEEKVRRWKE  613
               + KV+ W+E
Sbjct  140  ---KNKVQSWRE  148



>gb|AAY43787.1| disease resistance protein [(Populus tomentosa x Populus bolleana) 
x Populus tomentosa var. truncata]
Length=428

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + GIRTF+DDD L +G+ IS  LL+AI+ES+  I +FS
Sbjct  55   FLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDELPRGEEISHHLLRAIEESRISIVVFS  114

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +     Q+V+PI   ++PSDV+ Q  SF ++F   V+   +
Sbjct  115  KGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDIDPSDVRKQTASFAEAF---VKHEER  171

Query  581  DDEEKVRRWKE  613
              E+ V+ W++
Sbjct  172  SQEKLVQEWRK  182



>ref|XP_006377202.1| hypothetical protein POPTR_0011s01910g, partial [Populus trichocarpa]
 gb|ERP54999.1| hypothetical protein POPTR_0011s01910g, partial [Populus trichocarpa]
Length=395

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L   G  TF+DDD + +G  I   L KAI++SK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLYKALIHAGFHTFRDDDEIRRGKNIRLELQKAIKQSKIAIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL+EL  IMER+ N  E +V P+  +V+PS+V+NQ GSF  +F E  EK  K
Sbjct  82   KNYAWSKWCLDELVKIMERKRN-AECIVFPVFYHVDPSEVRNQTGSFAAAFVEH-EKHYK  139

Query  581  DDEEKVRRWK  610
            +  E+V  W+
Sbjct  140  EKMERVNGWR  149



>ref|XP_006380260.1| hypothetical protein POPTR_0007s00620g, partial [Populus trichocarpa]
 gb|ERP58057.1| hypothetical protein POPTR_0007s00620g, partial [Populus trichocarpa]
Length=470

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 90/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+L+ +L + GI TF+DDD L +G+ IS  LLKAI+ESK    +FS
Sbjct  46   FLSFRGEDTRKTFTDHLHTALVQAGIHTFQDDDELPRGEEISDHLLKAIRESKISTVVFS  105

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ ++    Q+ +PI   ++PSDV+ Q GSF ++F +  E+   
Sbjct  106  KGYASSRWCLNELVEILKCRKRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVKHEER---  162

Query  581  DDEEKVRRWKE  613
              +EKV+ W+E
Sbjct  163  -SKEKVKEWRE  172



>ref|XP_007199304.1| hypothetical protein PRUPE_ppa023180mg, partial [Prunus persica]
 gb|EMJ00503.1| hypothetical protein PRUPE_ppa023180mg, partial [Prunus persica]
Length=1022

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L+ SL+RKGI TF D+D LE+G  ISP+LLKAIQ S   + IFS
Sbjct  25   FLSFRGEDTRYNFTDHLHSSLDRKGINTFMDNDELERGTDISPALLKAIQGSMISLIIFS  84

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCLEELA I++ +E+ K+QMV PI   V+PS V++Q+G+F ++     E   K
Sbjct  85   ENYASSTWCLEELAHIIQCRES-KQQMVFPIFYKVDPSHVRHQRGTFGEAIANH-ECNFK  142

Query  581  DDEEKVRRWK  610
            +D  K  RWK
Sbjct  143  NDMNKKLRWK  152



>ref|XP_006367169.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006367170.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
tuberosum]
Length=168

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 87/132 (66%), Gaps = 4/132 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT  TF  +LY  L+ +GI TF+DD RLE+GD I   LLKAI+ES+  + IFS
Sbjct  22   FLSFRGTDTRRTFTGHLYEGLKNRGIFTFQDDKRLEQGDSIPEELLKAIEESQVALIIFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSF--KELVEKI  574
            K YA S+WCL EL  IM+ +E  + Q ++PI   V+PS V+NQ  SF ++F   E   K 
Sbjct  82   KNYATSRWCLNELVKIMKCKE--EGQTIIPIFYDVDPSHVRNQSESFAEAFAKHESTYKD  139

Query  575  GKDDEEKVRRWK  610
              D  +KV+ W+
Sbjct  140  DVDGMQKVQGWR  151



>ref|XP_002263928.2| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=251

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+L  +L R+GIRTF+DD ++ +G+ ++P LLK I+ES+  + +FS
Sbjct  27   FLSFRGEDTRYNFTDHLNQALVRRGIRTFRDD-KIRRGEEVAPELLKVIEESRSSVIVFS  85

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL+EL  IME Q++L    V PI  +V PSDV+ Q GSF ++F +  E IG 
Sbjct  86   KNYAHSRWCLDELVKIMECQKDLG-HTVFPIFYHVYPSDVRRQTGSFGEAF-DRYEGIGT  143

Query  581  DDEEKVRRWKE  613
            D   K+ RW+E
Sbjct  144  D---KIPRWRE  151



>ref|XP_006380156.1| hypothetical protein POPTR_0008s22420g, partial [Populus trichocarpa]
 gb|ERP57953.1| hypothetical protein POPTR_0008s22420g, partial [Populus trichocarpa]
Length=174

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT ++F D+LY +L  +G+ TF+DD  LE+G+ IS  LL+AIQ+S+F + +FS
Sbjct  17   FLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFSVIVFS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + Y  S WCL EL  I+E  +  + Q V+P+   V+PS+V+NQ G  + +F +  E++ K
Sbjct  77   RNYTSSTWCLNELVKIVECMKQGR-QTVIPVFYDVDPSEVRNQTGRLQQAFADH-EEVFK  134

Query  581  DDEEKVRRWK  610
            D+ EKV+ W+
Sbjct  135  DNIEKVQTWR  144



>dbj|BAD12594.1| N protein [Nicotiana tabacum]
Length=1128

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF  +LY  L  KGI+TF+DD RLE G  I   L KAI+ES+F I +FS
Sbjct  7    FLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFS  66

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL EL  IME +   K Q V+PI   V+PS V+NQK SF  +F+E   K  K
Sbjct  67   ENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHETKY-K  124

Query  581  DDEEKVRRWK  610
            DD E ++RW+
Sbjct  125  DDVEGIQRWR  134



>ref|XP_006441871.1| hypothetical protein CICLE_v10024379mg [Citrus clementina]
 gb|ESR55111.1| hypothetical protein CICLE_v10024379mg [Citrus clementina]
Length=1094

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 91/131 (69%), Gaps = 1/131 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L+ KGI  F+DD  LE+G+ ISP L KAI+ESK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLYSALDEKGIIVFRDDKELERGESISPGLFKAIEESKISIVVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S WCL+EL  I+E +    +QMV PI   VEP+ V+ Q  +F+++F +  E++  
Sbjct  82   RSYAFSTWCLDELVHILECKNTNNQQMVYPIFYDVEPAVVRKQTETFQEAFAQ-YEEVFS  140

Query  581  DDEEKVRRWKE  613
            ++ EKV++W++
Sbjct  141  ENIEKVQKWRD  151



>ref|XP_010103475.1| TMV resistance protein N [Morus notabilis]
 gb|EXB96017.1| TMV resistance protein N [Morus notabilis]
Length=166

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            F+SFRG DT   FI +L+ +L RK I+ F D++ L+ GD ISP+LLKAI+ESK  + I S
Sbjct  22   FISFRGVDTRFNFISHLHSALSRKKIKAFIDENDLKTGDEISPTLLKAIKESKLCLIILS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCLEELA I++ ++  ++  V+P+   VEPSDV+ Q+GS+  +F +L E+   
Sbjct  82   EDYASSRWCLEELANILQCKKTDEQSEVLPVFHNVEPSDVRKQQGSYAVAFAKLKERF--  139

Query  581  DDEEKVRRWKE  613
             ++EK+  W++
Sbjct  140  -EDEKLLAWRD  149



>ref|XP_010644028.1| PREDICTED: uncharacterized protein LOC100261885 [Vitis vinifera]
Length=2956

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F D+LY +L   GIRTF+DD+ L +G+ I+P LLKAI+ES+  I +FS
Sbjct  17   FLSFRGEDTRRNFTDHLYKALIHSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCLEEL  IM+ +E  ++ +V+PI  +V+PS+V+NQ   + ++F    +   +
Sbjct  77   ETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEE  136

Query  581  DDEEKVRRWK  610
            + +EK+R+WK
Sbjct  137  ERKEKIRKWK  146



>gb|AAW28561.2| TMV resistance protein N, putative [Solanum demissum]
Length=645

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = +2

Query  215  MFFLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAI  394
            + FLSFRG DT +TF  +LY  L+ +GI TF+DD RLE GD I   LL+AI+ES+  + +
Sbjct  20   VVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVALIV  79

Query  395  FSKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKI  574
            FSK YA SKWCL EL  IME ++    Q V+PI   V+PS V+NQ  SF  +F E   K 
Sbjct  80   FSKNYATSKWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAEHELKY  139

Query  575  GKDDE--EKVRRWK  610
              D E  +KV+RW+
Sbjct  140  KDDVEGMQKVQRWR  153



>ref|XP_006421209.1| hypothetical protein CICLE_v100041742mg, partial [Citrus clementina]
 gb|ESR34449.1| hypothetical protein CICLE_v100041742mg, partial [Citrus clementina]
Length=162

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D    FI +L  +L RK I TF DD +L +G+ ISPSLL AI+ SK  I IFS
Sbjct  19   FLSFRGKDVRHNFISHLNAALCRKKIVTFIDD-KLNRGNEISPSLLSAIEGSKISIVIFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  I+E  +N   Q+VVP+   V+PSDV+NQ G+F DSF +L E+  K
Sbjct  78   KWYASSRWCLNELVKILE-SKNKYGQIVVPVFYLVDPSDVRNQTGTFGDSFSKLEERF-K  135

Query  581  DDEEKVRRWK  610
            +  + ++ W+
Sbjct  136  EKIDMLQTWR  145



>ref|XP_008342629.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=603

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 82/130 (63%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT + F D+LY +LE  GI TF+DDD +E G  I   L  AIQES+  + +FS
Sbjct  20   FLSFRGADTRKGFADHLYSALELAGIHTFRDDDEIEGGANIEQELQTAIQESRVSVIVFS  79

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCL ELA IMER +      VVP+   VEPSDV+ Q GSF DSF    ++  K
Sbjct  80   TDYASSTWCLNELAIIMERTKT-DGHKVVPVFYDVEPSDVRKQTGSFADSFTXHEZRF-K  137

Query  581  DDEEKVRRWK  610
            D  +KV  W+
Sbjct  138  DKXDKVEEWR  147



>gb|AAD25968.1|AF093641_2 flax rust resistance protein [Linum usitatissimum]
Length=1294

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT E F D+LY SL R  I TF+DDD L KG  I P+LL+AI +SK  + I S
Sbjct  64   FLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIIS  123

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
             GYA SKWCL ELA I+ RQE    ++++PI   V+PSDV++Q G ++ +F++   K   
Sbjct  124  SGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKF--  181

Query  581  DDEEKVRRWKE  613
             D + ++ WK+
Sbjct  182  -DGQTIQNWKD  191



>sp|Q40392.1|TMVRN_NICGU RecName: Full=TMV resistance protein N [Nicotiana glutinosa]
 gb|AAA50763.1| N [Nicotiana glutinosa]
Length=1144

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF  +LY  L  KGI+TF+DD RLE G  I   L KAI+ES+F I +FS
Sbjct  15   FLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFS  74

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL EL  IME +   K Q V+PI   V+PS V+NQK SF  +F+E   K  K
Sbjct  75   ENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHETKY-K  132

Query  581  DDEEKVRRWK  610
            DD E ++RW+
Sbjct  133  DDVEGIQRWR  142



>ref|XP_006371055.1| hypothetical protein POPTR_0019s03015g [Populus trichocarpa]
 gb|ERP48852.1| hypothetical protein POPTR_0019s03015g [Populus trichocarpa]
Length=512

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 93/131 (71%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF+D+LY +L + GI TF+DDD L +G+ IS  LL+AI+ESK  I +FS
Sbjct  18   FLSFRGEDTRKTFVDHLYTALVQAGIHTFRDDDELPRGEEISEHLLEAIRESKISIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +     Q+V+PI   ++PSDV+ Q GSF ++F +  E+  +
Sbjct  78   KGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEEE--R  135

Query  581  DDEEKVRRWKE  613
             +E+ V+ W++
Sbjct  136  FEEKLVKEWRK  146



>gb|KEH25115.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1366

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT  +F  +LY +L+  GI+ F+DD+ L++GDCIS SL  AI++S+  I +FS
Sbjct  320  FLSFRGEDTRSSFTSHLYAALKNFGIKVFRDDNELQRGDCISTSLSHAIEQSRISIIVFS  379

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  IM+ Q  +  Q+VVP+  +V+PS+V+NQKG F  +F+ L+ +I  
Sbjct  380  KNYADSRWCLNELEKIMKCQRTIG-QVVVPVFYHVDPSEVRNQKGEFGRAFESLLNRI-L  437

Query  581  DDEEKVRRWKE  613
            ++ E    WKE
Sbjct  438  NEVELALNWKE  448


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 70/118 (59%), Gaps = 1/118 (1%)
 Frame = +2

Query  218  FFLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIF  397
             FL+F   D   +F  +L  +L++  I  F  D+ L++GD IS SL  AI ESK  I +F
Sbjct  66   LFLNFSEEDALSSFTSHLLAALQKFRITVFTYDNVLQRGDHISTSLSSAIGESKIFIIVF  125

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEK  571
            SK YA S+ CL+EL  I+     + E +VVP+  +V P++V+ QKG F  SF+  + K
Sbjct  126  SKNYANSRRCLDELEIIVNCGRTIGE-VVVPVFYHVAPTEVRYQKGEFGISFQSFLNK  182



>gb|AAA91022.1| L6 [Linum usitatissimum]
Length=1294

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 87/131 (66%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT E F D+LY SL R  I TF+DDD L KG  I P+LL+AI +SK  + I S
Sbjct  64   FLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIIS  123

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
             GYA SKWCL ELA I+ RQE    ++++PI   V+PSDV++Q G ++ +F++   K   
Sbjct  124  SGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKF--  181

Query  581  DDEEKVRRWKE  613
             D + ++ WK+
Sbjct  182  -DGQTIQNWKD  191



>ref|XP_009779694.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1155

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF  +LY  L  +GI+TF+DD RLE G  I   L KAI+ES+F I IFS
Sbjct  14   FLSFRGEDTRKTFTSHLYEVLNDRGIKTFQDDKRLEYGATIPEELCKAIEESQFAIVIFS  73

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S+WCL EL  IME +   + Q V+PI   V+PS ++NQK SF  +F+E   K  K
Sbjct  74   KNYATSRWCLNELVEIMECKTQFR-QTVIPIFYDVDPSHIRNQKESFAKAFEEHETKY-K  131

Query  581  DDEEKVRRWK  610
            DD E ++RW+
Sbjct  132  DDVEGIKRWR  141



>gb|KDP27330.1| hypothetical protein JCGZ_20262 [Jatropha curcas]
Length=209

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 93/129 (72%), Gaps = 3/129 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT   F  +L  +L+RK I+TF DDD L++G+ ISP+L++AI+ESK ++ IFS
Sbjct  18   FLSFRGIDTRPNFTSHLKAALQRKYIKTFIDDD-LKRGEEISPALMEAIEESKAVVVIFS  76

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+EL  IM+   ++  ++V+PI  YV+PS+V+NQ G F D F +L E+  K
Sbjct  77   KKYASSHWCLDELVKIMKCMRSMG-RIVLPIFYYVDPSEVRNQSGDFGDEFLKLKERF-K  134

Query  581  DDEEKVRRW  607
             + ++++RW
Sbjct  135  GEVKRIQRW  143



>ref|XP_007214070.1| hypothetical protein PRUPE_ppa017636mg, partial [Prunus persica]
 gb|EMJ15269.1| hypothetical protein PRUPE_ppa017636mg, partial [Prunus persica]
Length=149

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF D+LY +L + G RTF+DDD +E+G+ I P L KAI+ S+  + +FS
Sbjct  13   FLSFRGQDTRKTFTDHLYANLVKAGFRTFRDDDEVERGEGIKPELQKAIKYSRTSVIVFS  72

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSF  553
            K YA S+WCL EL  I+ER     + +V+P+   V+PSDV+NQ GS   +F
Sbjct  73   KNYASSRWCLNELVMILERLS--ADHVVLPVFYDVDPSDVRNQTGSLAKAF  121



>ref|XP_008240874.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Prunus mume]
Length=819

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 91/134 (68%), Gaps = 6/134 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F DYLY +L +KGI TF+DD++L+ G+ IS +LLKAI+ES+  + I S
Sbjct  22   FLSFRGLDTRKGFTDYLYNTLMQKGIHTFRDDEQLDSGEPISTALLKAIEESQISVVILS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA S WCL+ELAT++E   N K ++++P+   V PS+V+ Q G   + FKE   +  K
Sbjct  82   KNYATSTWCLDELATVVELAANTKTRLILPVFYDVTPSEVREQTG---EHFKEAFAQHDK  138

Query  581  DDE---EKVRRWKE  613
            D E    KV RWKE
Sbjct  139  DFEGEPGKVTRWKE  152



>ref|XP_006377180.1| hypothetical protein POPTR_0011s016702g, partial [Populus trichocarpa]
 gb|ERP54977.1| hypothetical protein POPTR_0011s016702g, partial [Populus trichocarpa]
Length=131

 Score =   118 bits (295),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F D+LY +L   G  TF+DDD + +G  I   L KAI++SK  I +FS
Sbjct  22   FLSFRGEDTRKNFTDHLYKALVHAGFHTFRDDDEIRRGKNIRLELQKAIKQSKIAIIVFS  81

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSF  553
            K YA SKWCL+EL  IMER+ N  E +V P+  +V+PS+V+NQ  SF  +F
Sbjct  82   KNYAWSKWCLDELVKIMERKRN-AECIVFPVFYHVDPSEVRNQTASFAAAF  131



>ref|XP_010041655.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=160

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D    F+ +LY +L++ GI T+ D++ L+KG+ ISP+L+KAI+ES+  I +FS
Sbjct  16   FLSFRGPDVRNHFLGHLYTALDQTGIYTYIDNEELKKGEQISPALMKAIEESRIAIVVFS  75

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S WCLEE+A +ME R E  ++ MV P+   VEP +V+ Q+ S+ ++  +   K G
Sbjct  76   EDYASSPWCLEEVAKVMECRGE--RKLMVFPVFYKVEPREVRGQRQSYAEAMAKHEVKFG  133

Query  578  KDDEEKVRRWKE  613
            KD  EKV+RW++
Sbjct  134  KDS-EKVKRWRK  144



>gb|KDO39545.1| hypothetical protein CISIN_1g0463142mg, partial [Citrus sinensis]
Length=525

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 91/131 (69%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT E F  +LY +L  K I+TF D+D L +GD ISP+L+KAI+ SK  + IFS
Sbjct  13   FLSFRGEDTRENFTSHLYAALCGKKIKTFIDED-LNRGDEISPALMKAIEGSKISVIIFS  71

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            K YA SKWCL EL  I+ + +NLK Q V+PI  +V PSDV+ Q G+F + F +L ++  K
Sbjct  72   KDYASSKWCLNELVKIL-KCKNLKGQTVIPIYYHVSPSDVRKQTGTFGEGFVKLEQQF-K  129

Query  581  DDEEKVRRWKE  613
            +  E VR+W++
Sbjct  130  EKAETVRKWRD  140



>gb|KDO40701.1| hypothetical protein CISIN_1g0007801mg, partial [Citrus sinensis]
Length=528

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSL-ERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIF  397
            FL+FRG DT  +F  +LY +L ERK IRTF DD+ L +GD ISP+LL AIQ SK  + IF
Sbjct  14   FLNFRGEDTRTSFTCHLYDNLYERKKIRTFIDDEGLRRGDEISPALLNAIQGSKISVVIF  73

Query  398  SKGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            SK YA SKWCL EL  I+E ++ +K Q+++P+   V PSDV++Q G+F D F EL ++  
Sbjct  74   SKDYASSKWCLHELLKILECKK-MKGQIIIPVFYGVSPSDVRHQNGTFGDGFDELKKQF-  131

Query  578  KDDEEKVRRWKE  613
            +D  E V +W++
Sbjct  132  QDKPEMVLKWRD  143



>ref|XP_010056818.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG D    FI +LY +L + GI TF+D + L+KGD ISP L+KAI+ES   I +FS
Sbjct  14   FLSFRGVDLRNNFIGHLYQALHQIGIYTFRDSEELKKGDQISPVLMKAIEESYIAIIVFS  73

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
              YA S WCLEE+A I+E +E  K  +V+P+   V+P +V+  + S++ +  +   K GK
Sbjct  74   MNYASSMWCLEEVAKIIECKEQ-KNLIVLPVFYKVDPREVRGVRKSYQRALAKHESKFGK  132

Query  581  DDEEKVRRWKE  613
            D  EKV+RWKE
Sbjct  133  DS-EKVKRWKE  142



>ref|XP_008231763.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=562

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT   F D+L  +L  KGI TF DDD L +G+ ISP+L+KAI+ES+  + +FS
Sbjct  52   FLSFRGADTRTNFTDHLRNALVGKGIHTFIDDDELRRGEEISPALVKAIEESRISVIVFS  111

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA S+WCL+EL  I++ +++ K+Q+V+PI   V+PSDV+ Q  SF D+FK L+    K
Sbjct  112  EKYASSRWCLDELVKILQCKQS-KQQVVLPIFYKVDPSDVRKQTNSFGDAFKGLIRSEFK  170

Query  581  DDEEKVRRWKE  613
            DD++ ++ W++
Sbjct  171  DDKQ-IQGWRK  180



>ref|XP_010665198.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=702

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FL+FRG+DT   F D+LY  L +  +RTF+DD+ LE+GD I+P LLKAI++S+  I +FS
Sbjct  16   FLNFRGADTRYHFTDHLYSELRKNDVRTFRDDEELERGDVIAPGLLKAIEQSRISIVVFS  75

Query  401  KGYALSKWCLEELATIME-RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIG  577
            + YA S+WCL+EL  I+E R E  +EQ+V+P+  +V+PS V+ Q GS+ ++F +  +   
Sbjct  76   ENYAQSRWCLDELVKIIECRTE--REQIVLPVFYHVDPSHVRKQMGSYGEAFADHEKDAD  133

Query  578  KDDEEKVRRWK  610
                EK+++W+
Sbjct  134  LKKREKIQKWR  144



>gb|ABO20868.1| toll/interleukin 1 receptor domain containing protein [(Populus 
tomentosa x Populus bolleana) x Populus tomentosa]
Length=146

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 87/130 (67%), Gaps = 3/130 (2%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT +TF  +LY +L+  GIRTF DD+ L +G+ IS  LLKAI+ESK  I +FS
Sbjct  18   FLSFRGEDTRKTFTGHLYAALDDAGIRTFLDDNELPRGEEISEHLLKAIRESKISIVVFS  77

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            KGYA S+WCL EL  I++ +     Q+V+PI   ++PSDV+ Q G F ++F +  E    
Sbjct  78   KGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGCFAEAFDKHEECF--  135

Query  581  DDEEKVRRWK  610
             +E+ V+ W+
Sbjct  136  -EEKLVKEWR  144



>ref|XP_010050310.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=589

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 87/131 (66%), Gaps = 4/131 (3%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG+DT +TF D+LY  L   GIR FKDDD L +G+ I  +LL+AI+ SK  I I S
Sbjct  41   FLSFRGTDTRKTFADHLYNGLVNAGIRVFKDDDELSEGEKIGTNLLQAIKNSKISIPILS  100

Query  401  KGYALSKWCLEELATIMERQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEKIGK  580
            + YA SKWCL+EL  + E   + +  +V+PI  +VEP+DV+ QKGSF + F  L    GK
Sbjct  101  RNYASSKWCLQELVQMTECMMSAR-HIVLPIFYWVEPADVRYQKGSFGEVFSHLS---GK  156

Query  581  DDEEKVRRWKE  613
              EE + +WK+
Sbjct  157  YSEEDIAKWKQ  167



>ref|XP_010256441.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010256442.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nelumbo 
nucifera]
Length=1120

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 94/135 (70%), Gaps = 5/135 (4%)
 Frame = +2

Query  221  FLSFRGSDTCETFIDYLYGSLERKGIRTFKDDDRLEKGDCISPSLLKAIQESKFLIAIFS  400
            FLSFRG DT + F +YLY +L +KGI TF+DD  L++G+ ISP+LLKAI+ES+  I IFS
Sbjct  28   FLSFRGEDTRKNFTEYLYTALVKKGIHTFRDDKELQRGEEISPALLKAIEESRICIIIFS  87

Query  401  KGYALSKWCLEELATIME---RQENLKEQMVVPILCYVEPSDVQNQKGSFEDSFKELVEK  571
            K YA S+WCL+EL  I+E   ++  +   +V+P+   ++PSDV+ Q GSF ++F    ++
Sbjct  88   KNYASSRWCLDELCKILECRGKKRKIGRTIVMPVFYDIDPSDVRKQTGSFAEAFASHEKR  147

Query  572  IGKDDE--EKVRRWK  610
               + E  EKV+RW+
Sbjct  148  FEFNTEMMEKVKRWR  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090