BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS129E05

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       256   1e-77   Nicotiana tomentosiformis
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       256   3e-77   Nicotiana sylvestris
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       248   3e-74   Solanum tuberosum [potatoes]
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       247   5e-74   Solanum lycopersicum
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       243   1e-72   Solanum tuberosum [potatoes]
gb|AFU61111.1|  F-box protein                                           237   3e-70   Capsicum annuum
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       234   5e-69   Nicotiana tomentosiformis
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       232   2e-68   Solanum lycopersicum
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       228   5e-67   Nicotiana sylvestris
emb|CDP10419.1|  unnamed protein product                                222   1e-64   Coffea canephora [robusta coffee]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       194   3e-54   Sesamum indicum [beniseed]
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         187   8e-52   Jatropha curcas
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       185   9e-51   Nelumbo nucifera [Indian lotus]
ref|XP_002524506.1|  grr1, plant, putative                              184   2e-50   Ricinus communis
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       182   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       181   2e-49   Populus euphratica
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       181   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       180   3e-49   
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg                180   4e-49   Erythranthe guttata [common monkey flower]
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             179   5e-49   Phaseolus vulgaris [French bean]
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       179   1e-48   Vitis vinifera
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       176   7e-48   Pyrus x bretschneideri [bai li]
ref|XP_010086585.1|  hypothetical protein L484_002248                   176   1e-47   Morus notabilis
gb|KJB54023.1|  hypothetical protein B456_009G017100                    175   2e-47   Gossypium raimondii
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       174   4e-47   Populus euphratica
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       174   8e-47   
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      173   1e-46   Gossypium arboreum [tree cotton]
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             173   1e-46   
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      171   4e-46   Gossypium arboreum [tree cotton]
gb|KJB55011.1|  hypothetical protein B456_009G058000                    171   4e-46   Gossypium raimondii
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       167   1e-44   Eucalyptus grandis [rose gum]
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       167   1e-44   
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             166   5e-44   
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         165   6e-44   Jatropha curcas
emb|CBI28209.3|  unnamed protein product                                164   7e-44   Vitis vinifera
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     164   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       164   2e-43   Eucalyptus grandis [rose gum]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    163   3e-43   Gossypium raimondii
ref|XP_002515516.1|  grr1, plant, putative                              162   9e-43   Ricinus communis
ref|XP_007011864.1|  EIN3-binding F box protein 1                       161   2e-42   
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       159   6e-42   Cicer arietinum [garbanzo]
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   1e-41   Glycine max [soybeans]
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       157   4e-41   Vitis vinifera
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       158   4e-41   
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             157   4e-41   
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    157   5e-41   
emb|CAN83761.1|  hypothetical protein VITISV_043743                     157   8e-41   Vitis vinifera
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   9e-41   Fragaria vesca subsp. vesca
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   1e-40   Cucumis sativus [cucumbers]
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    155   2e-40   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    155   2e-40   
gb|AFT92041.1|  EIN3 binding F-box 1                                    155   2e-40   Malus domestica [apple tree]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             155   2e-40   Prunus persica
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       154   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             154   4e-40   
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             154   4e-40   Phaseolus vulgaris [French bean]
emb|CBI21043.3|  unnamed protein product                                153   1e-39   Vitis vinifera
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   1e-39   Cucumis melo [Oriental melon]
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   2e-39   Sesamum indicum [beniseed]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       152   2e-39   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       152   2e-39   Pyrus x bretschneideri [bai li]
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      152   3e-39   Gossypium arboreum [tree cotton]
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     152   4e-39   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    152   4e-39   Eucalyptus grandis [rose gum]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  151   5e-39   Cucumis sativus [cucumbers]
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       152   5e-39   
gb|KJB82811.1|  hypothetical protein B456_013G215000                    151   6e-39   Gossypium raimondii
gb|KJB65824.1|  hypothetical protein B456_010G114900                    151   6e-39   Gossypium raimondii
gb|KJB65823.1|  hypothetical protein B456_010G114900                    151   7e-39   Gossypium raimondii
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                      150   9e-39   Gossypium arboreum [tree cotton]
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   150   1e-38   Citrus sinensis [apfelsine]
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    150   1e-38   Prunus mume [ume]
gb|KJB07737.1|  hypothetical protein B456_001G042600                    149   3e-38   Gossypium raimondii
emb|CAN82790.1|  hypothetical protein VITISV_030601                     150   3e-38   Vitis vinifera
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             149   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       149   4e-38   Glycine max [soybeans]
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             149   4e-38   Citrus clementina [clementine]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    149   6e-38   
ref|XP_002308665.2|  grr1 family protein                                148   9e-38   
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       148   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   1e-37   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   1e-37   Populus euphratica
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             147   2e-37   Phaseolus vulgaris [French bean]
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    147   3e-37   
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       146   4e-37   Glycine max [soybeans]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    146   5e-37   
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       145   6e-37   
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       146   6e-37   Nicotiana tomentosiformis
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    145   7e-37   Glycine max [soybeans]
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            145   1e-36   Nicotiana sylvestris
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                145   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       144   2e-36   Citrus sinensis [apfelsine]
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       144   2e-36   
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            144   3e-36   Sesamum indicum [beniseed]
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like       143   8e-36   Elaeis guineensis
ref|XP_003588766.1|  Ein3-binding f-box protein                         142   1e-35   Medicago truncatula
gb|KHN33913.1|  EIN3-binding F-box protein 1                            141   2e-35   Glycine soja [wild soybean]
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   5e-35   Cicer arietinum [garbanzo]
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   6e-35   Elaeis guineensis
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   8e-35   Solanum tuberosum [potatoes]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       140   9e-35   Phoenix dactylifera
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       138   3e-34   Fragaria vesca subsp. vesca
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like       136   2e-33   Phoenix dactylifera
gb|AES91540.2|  EIN3-binding F-box-like protein                         135   3e-33   Medicago truncatula
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   4e-33   
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          135   4e-33   Amborella trichopoda
ref|XP_003609343.1|  Ein3-binding f-box protein                         135   1e-32   
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like       132   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            131   1e-31   Camelina sativa [gold-of-pleasure]
ref|NP_565597.1|  EIN3-binding F-box protein 1                          131   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    130   1e-31   Glycine max [soybeans]
gb|KHN07078.1|  EIN3-binding F-box protein 1                            130   2e-31   Glycine soja [wild soybean]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like       131   2e-31   
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like       130   3e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like       130   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       130   3e-31   
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   1e-30   Populus euphratica
dbj|BAH20224.1|  AT2G25490                                              128   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63879.1|  f-box family protein                                    129   1e-30   Genlisea aurea
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            128   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            128   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   1e-30   Cucumis sativus [cucumbers]
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            127   3e-30   Cucumis melo [Oriental melon]
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             126   5e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            126   5e-30   Tarenaya hassleriana [spider flower]
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             127   5e-30   Phaseolus vulgaris [French bean]
gb|KEH32121.1|  EIN3-binding F-box-like protein                         127   5e-30   Medicago truncatula
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003609344.1|  Ein3-binding f-box protein                         127   6e-30   
gb|KEH32122.1|  EIN3-binding F-box-like protein                         126   8e-30   Medicago truncatula
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   9e-30   Tarenaya hassleriana [spider flower]
ref|XP_002880682.1|  ein3-binding F box protein 1                       125   9e-30   
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       125   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       125   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002874252.1|  ein3-binding F box protein 2                       124   2e-29   
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             125   2e-29   Capsella rubella
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             124   4e-29   Capsella rubella
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    124   5e-29   Arabis alpina [alpine rockcress]
gb|KJB07621.1|  hypothetical protein B456_001G033400                    123   6e-29   Gossypium raimondii
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                122   2e-28   Erythranthe guttata [common monkey flower]
ref|NP_197917.1|  EIN3-binding F-box protein 2                          120   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g             119   1e-27   Phaseolus vulgaris [French bean]
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       119   3e-27   Brassica rapa
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       118   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            117   9e-27   Camelina sativa [gold-of-pleasure]
gb|ACB59221.1|  F-box protein                                           117   1e-26   Brassica oleracea
ref|XP_003603398.1|  Ein3-binding f-box protein                         116   2e-26   
emb|CDY19807.1|  BnaA09g04600D                                          116   2e-26   Brassica napus [oilseed rape]
gb|AES73649.2|  EIN3-binding F-box-like protein                         116   2e-26   Medicago truncatula
emb|CDX87090.1|  BnaC09g04050D                                          115   3e-26   
gb|AEK81539.1|  EIN3 binding F-box 1                                    115   4e-26   Dianthus caryophyllus [carnation]
gb|EPS63568.1|  ein3-binding f-box protein 3                            115   6e-26   Genlisea aurea
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   7e-26   Cucumis melo [Oriental melon]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like       115   7e-26   Cucumis sativus [cucumbers]
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like       114   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       112   6e-25   Tarenaya hassleriana [spider flower]
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             110   5e-24   Eutrema salsugineum [saltwater cress]
emb|CDY35358.1|  BnaA04g14890D                                          108   2e-23   Brassica napus [oilseed rape]
gb|ABK25485.1|  unknown                                                 107   3e-23   Picea sitchensis
emb|CDX76980.1|  BnaC04g37750D                                          107   3e-23   
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like       106   6e-23   Tarenaya hassleriana [spider flower]
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2            106   9e-23   Brassica rapa
emb|CDX88173.1|  BnaA06g27640D                                          106   9e-23   
ref|NP_001237471.1|  grr1 protein                                       103   8e-22   
emb|CDX80503.1|  BnaC07g29410D                                          103   8e-22   
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1            102   1e-21   Brassica rapa
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.8    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like     97.8    8e-20   Brachypodium distachyon [annual false brome]
dbj|BAJ88579.1|  predicted protein                                    93.6    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like     92.0    7e-18   
gb|EMT19526.1|  hypothetical protein F775_07091                       92.4    8e-18   
dbj|BAD15849.1|  putative F-box protein                               91.3    1e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84905.1|  hypothetical protein OsI_06273                        89.7    4e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1        87.0    4e-16   
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1          83.6    6e-15   Brachypodium distachyon [annual false brome]
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like     81.6    2e-14   Setaria italica
dbj|BAD35544.1|  putative F-box protein Fbl2                          76.3    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01599.1|  hypothetical protein OsI_23635                        76.6    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870        76.3    1e-12   Sorghum bicolor [broomcorn]
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                  73.2    2e-11   
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...  72.4    2e-11   
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                  72.4    3e-11   
ref|XP_002986021.1|  hypothetical protein SELMODRAFT_123441           71.2    6e-11   
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like     71.2    7e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861           69.7    2e-10   
ref|XP_002974778.1|  hypothetical protein SELMODRAFT_442539           67.8    7e-10   Selaginella moellendorffii
ref|NP_001147557.1|  LOC100281166                                     67.4    1e-09   Zea mays [maize]
ref|XP_006849175.1|  hypothetical protein AMTR_s00027p00189050        66.6    2e-09   
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like     66.2    2e-09   Setaria italica
ref|XP_001775242.1|  predicted protein                                65.9    3e-09   
gb|AFZ84555.1|  f-box transcription factor                            63.2    1e-08   Populus alba [abele]
gb|AFZ84556.1|  f-box transcription factor                            63.2    1e-08   Populus tremula [European aspen]
gb|AEX34712.2|  f-box transcription factor                            63.2    1e-08   Populus balsamifera [balsam poplar]
gb|AEX34715.2|  f-box transcription factor                            63.2    1e-08   Populus nigra [black poplar]
gb|AFZ84554.1|  f-box transcription factor                            63.2    1e-08   Populus maximowiczii
gb|AEX34714.2|  f-box transcription factor                            63.2    1e-08   Populus laurifolia
gb|AEX34713.2|  f-box transcription factor                            63.2    1e-08   Populus deltoides
gb|AFZ84553.1|  f-box transcription factor                            63.2    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     63.9    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.8    4e-08   Oryza brachyantha
ref|XP_002963689.1|  hypothetical protein SELMODRAFT_62165            62.4    4e-08   
ref|XP_001783097.1|  predicted protein                                58.2    1e-06   
ref|XP_009414462.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.8    6e-06   
ref|XP_010908612.1|  PREDICTED: EIN3-binding F-box protein 1-like     54.3    2e-05   Elaeis guineensis
emb|CDP13516.1|  unnamed protein product                              53.5    4e-05   Coffea canephora [robusta coffee]
emb|CDP13515.1|  unnamed protein product                              48.9    3e-04   Coffea canephora [robusta coffee]



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 142/163 (87%), Gaps = 5/163 (3%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            MPTLVNYSGDD+F +G SLCSADLGLMLSLGHA VYCP RK+ARI+GPFVVE + K PSI
Sbjct  1    MPTLVNYSGDDEFYSGGSLCSADLGLMLSLGHAQVYCPLRKKARISGPFVVEERTKNPSI  60

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E LPDECLFEIFRRL GGRERS+AACVSKRWLML S+VRNSEI   +SH D+S+A+  NG
Sbjct  61   EILPDECLFEIFRRLQGGRERSAAACVSKRWLMLSSNVRNSEI---QSHTDISVAN--NG  115

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             S+D +M  ADED+EVECDGYL+R +EGKKATD+RLAAIAVGT
Sbjct  116  DSSDGKMVSADEDVEVECDGYLTRCLEGKKATDIRLAAIAVGT  158



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 140/163 (86%), Gaps = 6/163 (4%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            MPTLVNYSGDD+F +G SLCSADLGLMLSLGHA VYCP RKRARI+GPF++E + K PSI
Sbjct  1    MPTLVNYSGDDEFYSGGSLCSADLGLMLSLGHAQVYCPLRKRARISGPFIIEERTKNPSI  60

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E LPDECLFEIFRRL GGR+RS+AACVSKRWLML S+VR+SEI     H DLS+AD  NG
Sbjct  61   EILPDECLFEIFRRLQGGRQRSAAACVSKRWLMLSSNVRSSEI----CHTDLSVAD--NG  114

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             S+D +M  ADED+EVECDGYL+R +EGKKATD+RLAAIAVGT
Sbjct  115  TSSDAKMVSADEDVEVECDGYLTRCLEGKKATDIRLAAIAVGT  157



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 133/163 (82%), Gaps = 10/163 (6%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            MPTLVNYSGDD+F +G S CSADLGLMLSLGHADVYCP RKRARI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGSFCSADLGLMLSLGHADVYCPPRKRARISGPFVVEDRSKDPSL  60

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E LPDECLFEI RRL GGRER +AACVSKRWL ++SSVRNSEI RSKS+ +L        
Sbjct  61   EILPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVRNSEICRSKSYNNL--------  112

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              ND  M   DEDLEVECDGYL+R VEGKKATDVRLAAIAVGT
Sbjct  113  --NDAIMISKDEDLEVECDGYLTRCVEGKKATDVRLAAIAVGT  153



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 133/163 (82%), Gaps = 10/163 (6%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            MPTLVNYSGDD+F +G S CSADLGLMLSLGHADVYCP RKRARI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGSFCSADLGLMLSLGHADVYCPPRKRARISGPFVVEDRSKDPSL  60

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E LPDECLFEI RRL GGRER +AACVSKRWL ++SSV+NSEI RSKS+ +L        
Sbjct  61   EVLPDECLFEILRRLPGGRERGAAACVSKRWLTVLSSVKNSEICRSKSYNNL--------  112

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              ND  M   DEDLEVECDGYL+R VEGKKATD+RLAAIAVGT
Sbjct  113  --NDAIMISKDEDLEVECDGYLTRCVEGKKATDIRLAAIAVGT  153



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 140/163 (86%), Gaps = 7/163 (4%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            M TLVNYSGD++F +G SLCSADLGLML+LGHAD+YCP  KRARI+GPFVVE + K PSI
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSADLGLMLALGHADIYCPVSKRARISGPFVVEERTKNPSI  60

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E LP+ECLFEIFRRL GGRERS+AACVSKRWLML+S++R+S+I     H +LS A   NG
Sbjct  61   EVLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI----RHTNLSAA---NG  113

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            AS+D +M+ ADEDLEVECDGYL+R +EGKKATD+RL+A+AVGT
Sbjct  114  ASDDTKMASADEDLEVECDGYLTRCLEGKKATDIRLSAMAVGT  156



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 132/163 (81%), Gaps = 10/163 (6%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            MP LVNYSGDD+  +G S CSADLGLMLSLGHA+VYCP RKR+RI+GPFVVE + K PS+
Sbjct  1    MPALVNYSGDDELYSGGSFCSADLGLMLSLGHAEVYCPPRKRSRISGPFVVEDRSKGPSL  60

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            + LPDECLFEI RRL GGRER +A+C+SKRWLML+SSVR+SEI RSKS+ +L        
Sbjct  61   DDLPDECLFEILRRLPGGRERGAASCLSKRWLMLLSSVRSSEICRSKSYTNL--------  112

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              ND  M   DEDLEVECDGYL+R VEGKKATDVRLAAIAVGT
Sbjct  113  --NDSTMISKDEDLEVECDGYLTRCVEGKKATDVRLAAIAVGT  153



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   234 bits (596),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 128/163 (79%), Gaps = 11/163 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            MPTLVNYSGDD+F +G   CSA+           VYCP RKR RI+GPFVVE + K PS+
Sbjct  1    MPTLVNYSGDDEFYSGGPFCSAE-----------VYCPPRKRVRISGPFVVEDRSKDPSL  49

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E LPDECLFEI RRL GGRERS+AACVSKRWLML+SSVRNSEI RSKS  +LS  ++VNG
Sbjct  50   EILPDECLFEILRRLPGGRERSAAACVSKRWLMLLSSVRNSEICRSKSQNNLSSVEEVNG  109

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             SND  M   DEDLEVECDGYL+R VEGKKATDVRLAAIAVGT
Sbjct  110  DSNDTTMIYKDEDLEVECDGYLTRCVEGKKATDVRLAAIAVGT  152



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 139/163 (85%), Gaps = 8/163 (5%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            M TLVNYSGD++F +G SLCSADLGL+L+LGHAD+YCP  KRARI+GPF+VE + K PSI
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSADLGLILALGHADIYCPVSKRARISGPFIVEERTKNPSI  60

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E LP+ECLFEIFRRL GGRERS+AACVSKRWLML+S++R+S+I     H +LS A   NG
Sbjct  61   ELLPNECLFEIFRRLEGGRERSAAACVSKRWLMLLSNMRSSDI----RHTNLSAA---NG  113

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            AS+D +M+ +DED +VECDGYL+R +EGKKATD+RL+A+AVGT
Sbjct  114  ASDDTKMASSDED-QVECDGYLTRCLEGKKATDIRLSAMAVGT  155



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 126/163 (77%), Gaps = 11/163 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEVQEKKPSI  329
            MPTLVN+SGDD+F +G   CSA+           VYCP RKR RI+ PFVVE + K PS+
Sbjct  1    MPTLVNHSGDDEFYSGGPFCSAE-----------VYCPPRKRVRISSPFVVEDRSKDPSL  49

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E LPDECLFEI RRLSGGRERS+AACVSK WLML+SSVR SEI RSKSH +LS  ++V G
Sbjct  50   EILPDECLFEILRRLSGGRERSAAACVSKHWLMLLSSVRTSEICRSKSHNNLSSVEEVKG  109

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             SND  M   DEDLEVECDGYL+R VEGKKATDVRLAAIAVGT
Sbjct  110  NSNDTTMISKDEDLEVECDGYLTRCVEGKKATDVRLAAIAVGT  152



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 132/167 (79%), Gaps = 6/167 (4%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVEV----QEK  317
            MP LVNY GDDDF  G S+CSAD GL+LS+  ADVYCP RKR+R++ P+ V+     +E+
Sbjct  1    MPALVNYGGDDDFYTGRSICSADSGLVLSI--ADVYCPPRKRSRVSAPYAVDSRLFNKER  58

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
             PSIE LPDECLFEIFRRL G +ERS++ACVSKRWLML+SSVRNSE  RS S Q+     
Sbjct  59   NPSIETLPDECLFEIFRRLPGAQERSASACVSKRWLMLLSSVRNSEFCRSNSPQEQLATK  118

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +V    +DVEM+ AD D+E++C+GYL+RS+EGKKATDVRLAAIAVGT
Sbjct  119  EVKKTESDVEMNSADGDMEIQCNGYLTRSLEGKKATDVRLAAIAVGT  165



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 123/168 (73%), Gaps = 13/168 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQE  314
            MP LVN  GDDDF + G SLCS D G++ S+  H ++YCP RKR+RI+GP++V     ++
Sbjct  1    MPALVNIRGDDDFYSEGGSLCSGDSGVVFSISSHVEIYCPPRKRSRISGPYIVSRNLFED  60

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            K+PSI+ LPDECLFEIFRRL GGRERS++ACVSKRWL ++SSVR+SE  RSK  Q     
Sbjct  61   KRPSIDVLPDECLFEIFRRLPGGRERSASACVSKRWLTVLSSVRSSEFNRSKIPQGQPKT  120

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              +  A N+ E        ++ECDGYL+R VEGKKATDVRLAAIAVGT
Sbjct  121  ISIEKAVNNTE--------DIECDGYLTRCVEGKKATDVRLAAIAVGT  160



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 124/170 (73%), Gaps = 13/170 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----QE  314
            MPTLVNYSGDD+F AG SLC+  +  + S+G   D+Y P  KRAR + PF+       Q 
Sbjct  1    MPTLVNYSGDDEFYAGGSLCTNSM--LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFEQN  58

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            K+PSI+ LPDECLFEIFRR+ GG+ERSS ACVSKRWL+L+SS++ +EI  SK+     +A
Sbjct  59   KQPSIDVLPDECLFEIFRRIPGGKERSSCACVSKRWLLLLSSIKRAEICESKTL----VA  114

Query  495  DK--VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            D       SNDVEM  +DE+ ++E DGYL+RS+EGKKATD RLAAIAVGT
Sbjct  115  DNEVTVSVSNDVEMISSDENGKIESDGYLTRSLEGKKATDTRLAAIAVGT  164



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 126/184 (68%), Gaps = 21/184 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            M TLVNY+GD+DF +G SL +   D  L+LSLG H DVYCP RKR+RIT PFV       
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF-----RSKS  473
            Q+K+ SIE LPDECLFEIFRRL GG+ERS  ACVSKRWL L+SS+R +E++     +   
Sbjct  61   QKKQSSIEVLPDECLFEIFRRLPGGQERSICACVSKRWLFLLSSIRRTEVYGIETTQPAK  120

Query  474  HQDLSIADKVNGASNDVEMSPAD---------EDLEVECDGYLSRSVEGKKATDVRLAAI  626
            H+   ++DK +  S  V+  PA          EDLEVE +GY +RS+ GKKATD+RLAAI
Sbjct  121  HEGELVSDKTDEFSKLVKEEPASVSSDVASVGEDLEVESEGYFTRSLGGKKATDIRLAAI  180

Query  627  AVGT  638
            AVGT
Sbjct  181  AVGT  184



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 121/171 (71%), Gaps = 18/171 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            MP LVNYSGDD+F +G SLC+   DLG   S+G H D Y P  KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q K+PSI+ LPDECLFEIFRR+ GG+ERS+ ACVSKRWL L+SS+R +E+          
Sbjct  61   QNKQPSIDVLPDECLFEIFRRIPGGKERSACACVSKRWLTLLSSIRRAELCN--------  112

Query  489  IADKVNGASNDVEM-SPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              +++    NDVEM S  DE+ E+E DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  113  --ERIVPGCNDVEMASSCDENGEIESDGYLTRSLEGKKATDMRLAAIAVGT  161



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 129/186 (69%), Gaps = 23/186 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            MPTLVNY+GD+DF +G SL +   D  L+LSLG H DVYCP RKR+RI+ PFV       
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ---  479
            Q+K+ SIE LPDECLFEIFRRL GG+ERS+ A VSKRWL+L+SS+R +EI  SK+ Q   
Sbjct  61   QQKQSSIEVLPDECLFEIFRRLPGGQERSACASVSKRWLVLLSSIRRTEICTSKTTQSAK  120

Query  480  -----------DLSIADKVNG--ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLA  620
                       + S  DK +    SN+  ++  D DLE+E +G+L+R +EGKKATD+RLA
Sbjct  121  PEAGLVPDMGDESSKLDKEDSLPVSNENGVASVDVDLELESEGHLTRCLEGKKATDIRLA  180

Query  621  AIAVGT  638
            AIAVGT
Sbjct  181  AIAVGT  186



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 122/172 (71%), Gaps = 13/172 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            MP LVNYSGDD+  +G S    S+DLG + S+G   DVY P+ KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q  +PSIE LPDECLFEIFRR+  G+ERSS ACVSK+WLML+SS+R +E   S +  +  
Sbjct  61   QNTRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCNSSAAAE--  118

Query  489  IADKVNGAS--NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              +K  GA   NDVEM   +E+ EVE DGYL+RS+EGKKATDVRLAAIAVGT
Sbjct  119  --EKGTGAPVRNDVEMVSCEENREVESDGYLTRSLEGKKATDVRLAAIAVGT  168



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 119/170 (70%), Gaps = 17/170 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            MP LVNY GDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  F        
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q KKPSI+ LPDECLFEIFRRL+GG+ERSS A VSK+WLML+SS+R  ++ ++       
Sbjct  61   QVKKPSIDDLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSIRKVDLCKNP------  114

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +AD     S+D EM+  DED E E DG+L+R +EGKKATD+RLAAIAVGT
Sbjct  115  VADN----SDDTEMTNGDEDREQENDGFLTRCLEGKKATDIRLAAIAVGT  160



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 119/170 (70%), Gaps = 17/170 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            MP LVNYSGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  F        
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q KKPSI+ LPDECLFEIFRRL+GG+ERSS A VSK+WLML+SSVR  ++ ++       
Sbjct  61   QVKKPSIDVLPDECLFEIFRRLNGGKERSSCASVSKKWLMLLSSVRKVDLCKNP------  114

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +AD     S+  EM+  DED E E DG+L+R +EGKKATD+RLAAI+VGT
Sbjct  115  VADN----SDXTEMTNGDEDXEQENDGFLTRCLEGKKATDIRLAAISVGT  160



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 114/169 (67%), Gaps = 26/169 (15%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQ----E  314
            MP LVNY GDDDF +  S CS D GL+ S+G HA+VYCP RKR+RI GP  +       +
Sbjct  1    MPALVNYRGDDDFNSIRSSCSGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADD  60

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            K PSI+ LPDECLFEIF  LS GRERS++ACVSKRWL ++SSVR SE  R K        
Sbjct  61   KTPSIDTLPDECLFEIFTHLSNGRERSTSACVSKRWLSVLSSVRCSEFHRIK--------  112

Query  495  DKVNGASNDVEMSPADEDLEVE-CDGYLSRSVEGKKATDVRLAAIAVGT  638
                        +P + D+E+E CDGYL+R VEGKKATD+RLAAIAVGT
Sbjct  113  ------------TPQESDIEMESCDGYLTRCVEGKKATDIRLAAIAVGT  149



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 120/171 (70%), Gaps = 15/171 (9%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHA--DVYCPSRKRARITGPFVVEV---  308
            MP LVNYSGDD+   G+S      DLG M +LG +    YC   KRARI  P + E    
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  309  -QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  485
             +++KP+IE LP+ECLFEIFRRLS G+ERSS +CVSKRWLMLMS +  +EI++S++  + 
Sbjct  61   RKDQKPAIEVLPNECLFEIFRRLSSGKERSSCSCVSKRWLMLMSRICKAEIYKSENLTEG  120

Query  486  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            S       AS DVEM+  DEDL +E DGYLSR +EGKKATDVRLAAIAVGT
Sbjct  121  S-------ASCDVEMASVDEDLVIEDDGYLSRCLEGKKATDVRLAAIAVGT  164



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 123/175 (70%), Gaps = 13/175 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ---  311
            M TLVNYSGDDDF  G S  +   D GL++S+G   DVYCP RKR+RIT P++       
Sbjct  3    MSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLE  62

Query  312  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
             EK+PSI+ LPDECLFEI RRL GG+ERSS A VSKRWLML+SS+R +EI   KS Q L+
Sbjct  63   LEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLN  122

Query  489  IADKVNG-----ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             + K++        +D+EM  A ED E+  DGYL+R +EGKKATD+ LAAIAVGT
Sbjct  123  ESSKLDKELTIPVPDDIEMISA-EDRELGSDGYLTRCLEGKKATDISLAAIAVGT  176



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 114/170 (67%), Gaps = 17/170 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            MP LVN SGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  +        
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q K PSI  LPDECLFEIFRRL GG+ERSS A VSK+WLML+SS+R  ++ +S       
Sbjct  61   QVKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLLSSIRKVDLCKSP------  114

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            + D     SND EM   DED E E DG+L+R +EGKKATD+RLAAIAVGT
Sbjct  115  VVDN----SNDAEMITGDEDQEQENDGFLTRCLEGKKATDIRLAAIAVGT  160



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 117/168 (70%), Gaps = 18/168 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVE----VQEK  317
            MPTLVNYSGDD+F +G S     +       H D+YCP  KRARI+ PF +E     Q +
Sbjct  1    MPTLVNYSGDDEFYSGGSCSPYSIA-----SHVDLYCPPSKRARISAPFALEGSFFEQAE  55

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            KPSI+ LPDECLFEI R + GG+ER S+ACVSKRWLMLMSS+R +E+  SKS  +L    
Sbjct  56   KPSIDVLPDECLFEILRHVQGGKERISSACVSKRWLMLMSSIRRTEM-PSKSENELV---  111

Query  498  KVNGASNDVEMSPADEDLEVEC-DGYLSRSVEGKKATDVRLAAIAVGT  638
                +S DVEM   D+D E+   DGYL+RS+EGKKATD+RLAAI++GT
Sbjct  112  ----SSGDVEMVAFDQDQELNGDDGYLTRSLEGKKATDIRLAAISIGT  155



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 116/170 (68%), Gaps = 17/170 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFV---VEV-  308
            MP LVNYSGDDDF  G S    S DLG + S+    DVYCP RKR RI+ PF     EV 
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q K+PSI+ LPDECL EIF+R+SGG+ERSS ACVSK WLML++S+R  E   SK      
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSK-----V  115

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            + + V   S DVEM  ++ED     DGYL+R +EGKKATD+RLAA+AVGT
Sbjct  116  VKENVGSNSGDVEMILSEED-----DGYLTRCLEGKKATDMRLAAVAVGT  160



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 123/172 (72%), Gaps = 12/172 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVVEV----  308
            MPTLVNYSGDD+  +G S  +  +DLG + S+  + DVY P+ KRARI+ PF+ E     
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--SHQD  482
            Q K+PSIE LPDECLFEIFRR+  G+ERSS A VSK+WLML+SS+R SE   S   + ++
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCYSNPVAEEE  120

Query  483  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
               A  V    NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  121  KETAAPV---CNDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  169



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 114/170 (67%), Gaps = 17/170 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            MP LVNYSGDDDF  G S  S   DLG +LS+G H DVYCP  KRARI+  +        
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q K PSI  LPDECLFEIFRRL GG+ERSS A VSK+WLML+SS+   ++ +      + 
Sbjct  61   QIKNPSINVLPDECLFEIFRRLKGGKERSSCASVSKKWLMLISSIWKVDLCK------IP  114

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            + D     S+D EM   DED E E DG+L+R +EGKKATD+RLAAIAVGT
Sbjct  115  VVDN----SDDAEMITGDEDQEQENDGFLTRCLEGKKATDIRLAAIAVGT  160



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 115/170 (68%), Gaps = 17/170 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFV---VEV-  308
            MP LVNYSGDDDF  G S    S DLG + S+    DVYCP RKR RI+ PF     EV 
Sbjct  1    MPALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q K+PSI+ LPDECL EIF+R+SGG+ERSS ACVSK WLML++S+R  E   SK      
Sbjct  61   QNKQPSIDVLPDECLVEIFKRISGGKERSSCACVSKHWLMLLTSIRKGEYESSK-----V  115

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            + +     S DVEM  ++ED     DGYL+R +EGKKATD+RLAA+AVGT
Sbjct  116  VKENFGSNSGDVEMILSEED-----DGYLTRCLEGKKATDMRLAAVAVGT  160



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 122/172 (71%), Gaps = 12/172 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVVEV----  308
            MPTLVNYSGDD+  +G S  +  +DLG + S+  + DVY P+ KRARI+ PF+ E     
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--SHQD  482
            Q  +PSIE LPDECLFEIFRR+  G+ERSS A VSK+WLML+SS+R SE   S   + ++
Sbjct  61   QNMRPSIEVLPDECLFEIFRRVPEGKERSSCASVSKKWLMLLSSIRRSEFCNSNPVAEEE  120

Query  483  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
               A  V    NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  121  KETAAPV---CNDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  169



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 120/173 (69%), Gaps = 17/173 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  311
            M  L ++SG DDF  G S+     +  L LSLG H DVY PSRKR+RI+ PFV      +
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  312  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            +KKPSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL ++S++R+ EI  +K+ Q L +
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSDEISDNKTTQALDL  120

Query  492  ----ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                 DK  G  +DVE    DED+     GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  NYESTDKKGGDVSDVE----DEDVA---GGYLSRSLEGKKATDVRLAAIAVGT  166



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 122/173 (71%), Gaps = 17/173 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  311
            M  L ++SG DDF  G S+ +   +  L LSLG H DVY PSRKR+RI+ PFV      +
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  312  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            +KKPSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL ++S++R++EI  +K+ Q L +
Sbjct  61   QKKPSIEVLPDECLFEIFRRLPGGQERSSCACVSKRWLTIVSNIRSNEISDNKTTQALDL  120

Query  492  ----ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                 DK  G  ++VE    DED+     GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  NYESTDKKGGDVSEVE----DEDVA---GGYLSRSLEGKKATDVRLAAIAVGT  166



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 113/170 (66%), Gaps = 7/170 (4%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLGHA-DVYCPSRKRARITGPFVV---EVQ  311
            MPTLVNY G+D F  G SLC  S DL  + S+G + D+Y P  KRARI GP+ V   E +
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYE  60

Query  312  EKKPS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
             ++PS I  LPDECLFEIFRRL GGRERS+ ACVSK WL L+SS+R +EI          
Sbjct  61   GERPSSIGELPDECLFEIFRRLPGGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKE  120

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              +    +S DV+M   D    +E DGYL+R +EGKKATDVRLAA+AVGT
Sbjct  121  DEEMKTSSSGDVQMVSCDVSGGLEEDGYLTRCLEGKKATDVRLAAVAVGT  170



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 112/167 (67%), Gaps = 17/167 (10%)
 Frame = +3

Query  159  LVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QEK  317
             +  SGDDDF +G S    S DLG + S+    DVYCP RKRARI  PF+       Q K
Sbjct  51   FIGISGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFGETEFEQNK  110

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            +PSI+ LP+ECLFEIF+RL GGRERSS ACVSK WLML++S+R SE   SK      + +
Sbjct  111  QPSIDVLPEECLFEIFKRLPGGRERSSCACVSKHWLMLLTSIRKSEYESSK-----VVKE  165

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              +  S DVEM  +DED     DGYL+R +EGKKATD+RLAA+AVGT
Sbjct  166  NTDLVSEDVEMISSDED-----DGYLTRCLEGKKATDMRLAAVAVGT  207



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 112/170 (66%), Gaps = 32/170 (19%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            MP LVNYSGDD+  +G SL   S+DLG + S+G   DVY P+ KRARI+ PF+       
Sbjct  1    MPALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q K+PSIE LPDECLFEIFRR+  G+ERSS ACVSK+WLML+SS+R +E   SK+     
Sbjct  61   QNKRPSIEVLPDECLFEIFRRVPEGKERSSCACVSKKWLMLLSSIRRNEFCSSKNR----  116

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                                 EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  117  ---------------------EVESDGYLTRSLEGKKATDMRLAAIAVGT  145



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 117/170 (69%), Gaps = 16/170 (9%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            M  L  ++GDDDF  G  + +   +  L+LSLG H DVY PSRKR+RI+ PFV+      
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL L+S++   E+   K+ Q L+
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLALLSNMSRDELCSKKTTQLLN  120

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             + + NG +         EDLE+E DGYLSRS+EGKKATD+ LAAIAVGT
Sbjct  121  ESAEKNGEA---------EDLEIEDDGYLSRSLEGKKATDIGLAAIAVGT  161



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 110/170 (65%), Gaps = 31/170 (18%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ---  311
            M TLVNYSGDDDF  G S  +   D GL++S+G   DVYCP RKR+RIT P++       
Sbjct  3    MSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLE  62

Query  312  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
             EK+PSI+ LPDECLFEI RRL GG+ERSS A VSKRWLML+SS+R +EI   KS Q L 
Sbjct  63   LEKRPSIDVLPDECLFEILRRLPGGQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSL-  121

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                     ND              DGYL+R +EGKKATD+ LAAIAVGT
Sbjct  122  ---------ND--------------DGYLTRCLEGKKATDISLAAIAVGT  148



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 108/167 (65%), Gaps = 4/167 (2%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEKK  320
            MPTLVNY G+D F  G SLC++ + L       D+Y P  KRARI GP+ V   E + + 
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEGEH  60

Query  321  PS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            PS I  LPDECLFEIFRRL  GRERS+ ACVSK WL L+SS+R +EI            +
Sbjct  61   PSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKEDEE  120

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                +S DVEM  +D    +E DGYL+R +EGKKATDVRLAA+AVGT
Sbjct  121  MKTSSSVDVEMVSSDVSGGLEGDGYLTRCLEGKKATDVRLAAVAVGT  167



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 108/167 (65%), Gaps = 4/167 (2%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEKK  320
            MPTLVNY G+D F  G SLC++ + L       D+Y P  KRARI GP+ V   E + + 
Sbjct  1    MPTLVNYGGEDQFFGGGSLCTSSIDLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEGEH  60

Query  321  PS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            PS I  LPDECLFEIFRRL  GRERS+ ACVSK WL L+SS+R +EI            +
Sbjct  61   PSSIGELPDECLFEIFRRLPSGRERSACACVSKHWLFLLSSMRRNEISGGAEKSAKEDEE  120

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                +S DVEM  +D    +E DGYL+R +EGKKATDVRLAA+AVGT
Sbjct  121  MKTSSSVDVEMVSSDVSGGLEGDGYLTRCLEGKKATDVRLAAVAVGT  167



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 112/170 (66%), Gaps = 25/170 (15%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            MP LVNY GDDDF +G S    S DLG + S+    DVY P RKRARIT PFVV      
Sbjct  1    MPALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q K+ SI+ LPDECLFEIF+RL GGRERSS ACVSK WLML+ S+R  E   SK+ ++  
Sbjct  61   QSKQASIDVLPDECLFEIFKRLPGGRERSSCACVSKHWLMLLISIRKGEYESSKAVKE--  118

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                    + D   S +DED     DGYL+R +EGKKATD+RLAA+AVGT
Sbjct  119  --------NTD---SVSDED-----DGYLTRCLEGKKATDMRLAAVAVGT  152



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 115/170 (68%), Gaps = 13/170 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ---  311
            M  L  ++GDDDF  G S+ +   +LGL LSLGH  DVY PSRKR+RI  PFV   +   
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  312  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
             +K+ SIE LPDECLFEIFRRL G  ERS+ A VSKRWL L+S++   E+   K+ Q L 
Sbjct  61   KKKQASIEVLPDECLFEIFRRLPG-EERSACAGVSKRWLGLLSNLSRDELCSKKTTQLLD  119

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             + K N     VE+    ED E+E DGYLSRS+EGKKATD+RLAAIAVGT
Sbjct  120  ESAKKN-----VEVKSEAEDQEIEGDGYLSRSLEGKKATDIRLAAIAVGT  164



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 123/202 (61%), Gaps = 24/202 (12%)
 Frame = +3

Query  87   FAAKSNLFCSLFGGFF*KETAMPTLVNY------------SGDDDFLAGSSLCS--ADLG  224
            F    +LF +LFGGF   E     L  +             G DDF  G S+     +  
Sbjct  15   FFLVGSLFFALFGGFLGGEQCRFDLPGFFELYLCQSSFLSVGSDDFCPGGSIYPNPKESS  74

Query  225  LMLSLGH-ADVYCPSRKRARITGPFVV---EVQEKKPSIEALPDECLFEIFRRLSGGRER  392
              LSLGH  DVY P RK++RI+ PFV      ++KKPSI+ LPDECLFEIFRRL GG+ER
Sbjct  75   HFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKKPSIDVLPDECLFEIFRRLPGGQER  134

Query  393  SSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGY  572
            S+ ACVSKRWL L+S++R  EI    + Q L++ D+       V     DED +VE DGY
Sbjct  135  SACACVSKRWLTLVSNIRKDEI----TTQALNLKDESTDKKGGV--VSEDEDQDVEGDGY  188

Query  573  LSRSVEGKKATDVRLAAIAVGT  638
            LSRS+EGKKATDVRLAAIAVGT
Sbjct  189  LSRSLEGKKATDVRLAAIAVGT  210



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 111/169 (66%), Gaps = 22/169 (13%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLG--LMLSLGHADVYCPSRKRARITGPF----VVEVQ  311
            MP LVN SGDD+   G S+   DLG  L     + DVYC   KRARI+ PF    V   Q
Sbjct  1    MPALVNSSGDDEMYPGGSM---DLGGCLYTISSNVDVYCSPTKRARISAPFTFGAVEHKQ  57

Query  312  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            + KPS+E LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++  SEI R+ S  + S+
Sbjct  58   DHKPSVEILPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTISKSEIERTNSSVEESV  117

Query  492  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +   N           DED  VE DGYLSR +EG+KATDVRLAAIAVGT
Sbjct  118  SSDEN-----------DED--VEGDGYLSRCLEGRKATDVRLAAIAVGT  153



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 112/171 (65%), Gaps = 15/171 (9%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHA--DVYCPSRKRARITG----PFVVE  305
            MPTLVNYSGDD+   G S C    DLG + + G    + Y    KRARI       F+  
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPSKRARINALDAFEFLGR  60

Query  306  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  485
             Q++KP+I+ LPDECLFE+FR LS G+ERSS A VSKRWLMLMSS+  +EI +S    + 
Sbjct  61   EQDQKPTIDVLPDECLFEVFRWLSSGKERSSCAYVSKRWLMLMSSICKAEIHKSDKMIEG  120

Query  486  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            S       AS  VEM+  DED  +E +GYL+R +EGKKAT+VRLAAIAVGT
Sbjct  121  S-------ASGYVEMASVDEDQGIEDNGYLTRCLEGKKATNVRLAAIAVGT  164



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 116/178 (65%), Gaps = 17/178 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            M  L +Y+G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+++ SI+ LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +K+   L 
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKTTGFLK  120

Query  489  IADKVNGASNDV----------EMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
              + +   + D           E++P   DLE+E DGYLSR +EGKKATDVRLAAIAV
Sbjct  121  PKETLISRNTDESSEAKKKGGDEVTPEAVDLEIESDGYLSRCLEGKKATDVRLAAIAV  178



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 96/210 (46%), Positives = 123/210 (59%), Gaps = 33/210 (16%)
 Frame = +3

Query  27   SGLWIWNANLGRNPNLGCVDFAAKSNLF--CSLFGGFF*KETAMPTLVNYSGDDDFLAGS  200
            S + +++  L R    GC  F+    LF  CS           MP LVNY GDD F  GS
Sbjct  60   SSVLVFHLFLLRLVFFGCCFFSPARVLFSDCSPSA-----SATMPALVNYRGDDLFSIGS  114

Query  201  SLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EKKPSIEALPDECLFEIFR  368
                          H D YCP RKRAR++  F     E + E +PSI+ LPDECL+EIFR
Sbjct  115  --------------HVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLYEIFR  160

Query  369  RLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADED  548
            RL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     + V   S+ VEM   DED
Sbjct  161  RLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----EVVASVSDHVEMVSCDED  216

Query  549  LEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                 DGYL+R ++GKKATD+RLAAIAVGT
Sbjct  217  ----GDGYLTRCLDGKKATDLRLAAIAVGT  242



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 108/167 (65%), Gaps = 26/167 (16%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EK  317
            MP LVNY GDD F  GS              H D YCP RKRAR++  F     E + E 
Sbjct  1    MPALVNYRGDDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFEFEN  46

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     +
Sbjct  47   QPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----E  102

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             V   S+ VEM   DED     DGYL+R ++GKKATD+RLAAIAVGT
Sbjct  103  VVASVSDHVEMVSCDED----GDGYLTRCLDGKKATDLRLAAIAVGT  145



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 110/170 (65%), Gaps = 24/170 (14%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQ  311
            M  L  +SG +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  312  EK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
             K   SIE LPDECLFEIFRRLSGG+ERS+ A VSKRWLML+S++ + E+          
Sbjct  61   SKANVSIEILPDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHEL----------  110

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                    S DV  S   ED+E+E DGYLSRS+EGKKATD+RLAAI+VGT
Sbjct  111  -------KSEDVVASKEVEDIEIESDGYLSRSLEGKKATDLRLAAISVGT  153



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 108/151 (72%), Gaps = 11/151 (7%)
 Frame = +3

Query  216  DLGLMLSLGHA-DVYCPSRKRARITGPFVVEVQ----EKKPSIEALPDECLFEIFRRLSG  380
            D GL++S+G   DVYCP RKR+RIT P++        EK+PSI+ LPDECLFEI RRL G
Sbjct  2    DSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLFEILRRLPG  61

Query  381  GRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG-----ASNDVEMSPADE  545
            G+ERSS A VSKRWLML+SS+R +EI   KS Q L+ + K++        +D+EM  A E
Sbjct  62   GQERSSCARVSKRWLMLLSSIRRTEICPRKSSQSLNESSKLDKELTIPVPDDIEMISA-E  120

Query  546  DLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            D E+  DGYL+R +EGKKATD+ LAAIAVGT
Sbjct  121  DRELGSDGYLTRCLEGKKATDISLAAIAVGT  151



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 118/170 (69%), Gaps = 24/170 (14%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSA---DLGLMLSLGHADVYCPSRKRARITGPFVVE----V  308
            MPTLVNYSGDD+F +G S  S+   DLG +LS+G ++ Y PS KRARI+  F +      
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPMDLGCLLSVG-SNAYPPS-KRARISSQFDIRGSSFE  58

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            QEKK SIE LP+ECLFEIFRRL GG+ER + A VSK+WLML+SS+R SE           
Sbjct  59   QEKKASIEVLPEECLFEIFRRLHGGKERITCASVSKKWLMLLSSIRPSE-----------  107

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
               K    S+D EM+  DED + E DG+L+RS+EGKKATDVRLAAIAVGT
Sbjct  108  ---KEIPKSDDTEMTTGDED-QKETDGFLTRSLEGKKATDVRLAAIAVGT  153



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 112/175 (64%), Gaps = 12/175 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGL---MLSLGHADVYCPSRKRARITGPFVVE----V  308
            MP LVNY GDD++  G S  S+ + L   + +  H D+Y    KRARI  P V       
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            QE  PSIEALPDECLFEIFR L   RERSS A VSKRWLML+S++R +EI +S+S     
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRSTCISQ  120

Query  489  IADKVN-----GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            + +  N       S+++ +   DED E E +G+L+R +EGKKATDVRLAAIAVGT
Sbjct  121  MVESSNVEQQKTESDEISVVNCDEDQEDESNGFLTRCLEGKKATDVRLAAIAVGT  175



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 110/167 (66%), Gaps = 12/167 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  317
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +V+G           ED EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGT  159



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 110/167 (66%), Gaps = 12/167 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  317
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +V+G           ED EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGT  159



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 110/167 (66%), Gaps = 12/167 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  317
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +V+G           ED EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  EVSGNK--------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGT  159



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 115/170 (68%), Gaps = 17/170 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  311
            M  L+ ++G+DDF  G S+ +   +  L LS G HADV+   RKR+RI+GPFV      +
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  312  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            +KKP SI+ LPDECLFEIF+RL GG ERS+ ACVSKRWL L+S++   E   + ++  L+
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKRWLTLLSNIHRDEFCSNTTNLLLN  120

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              D+V G          ++D EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  PQDEVTG----------NKDQEVESCGYLSRSLEGKKATDVRLAAIAVGT  160



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 111/168 (66%), Gaps = 13/168 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE---VQE  314
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      ++
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            K+ SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     
Sbjct  61   KEVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQSFKSQ  120

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            D+V+G           ED EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  DEVSGNK--------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGT  160



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 104/145 (72%), Gaps = 7/145 (5%)
 Frame = +3

Query  216  DLGLMLSLGHADVYCPSRKRARITGPFVVEV----QEKKPSIEALPDECLFEIFRRLSGG  383
            DLG +LS+G   VY P  KRAR    F  E     Q +KPSIE LPDECLFEIFRRL GG
Sbjct  2    DLGCLLSIGS--VYYPPSKRARKDSQFAFEGSDFEQVRKPSIEVLPDECLFEIFRRLDGG  59

Query  384  RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVEC  563
            +ERSS ACVSK+WLML+SS+R  ++ +S +   +    K++  S+D EM+  +ED E+E 
Sbjct  60   KERSSCACVSKKWLMLLSSIRKVDLCKSPAADKVIQPLKLDN-SDDTEMTTGEEDQELEN  118

Query  564  DGYLSRSVEGKKATDVRLAAIAVGT  638
            DGYL+R +EGKKATD+RLAAIAVGT
Sbjct  119  DGYLTRCLEGKKATDIRLAAIAVGT  143



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 108/168 (64%), Gaps = 20/168 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSL--GHADVYCPSRKRAR-ITGPFVVEVQE  314
            MP LVNYSGDD+   G S C +  +LG + S    + D+Y P  KR+R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSRSILEAIEGEQHY  60

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            ++P IE LPDECLFEIFRRL  G+ERS  ACVSKRWLMLMSS+   EI R+ S  +    
Sbjct  61   QEPGIEVLPDECLFEIFRRLPSGKERSLCACVSKRWLMLMSSICKDEIERTTSAAE----  116

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                       +SP DE+ ++ECDGYL+R ++GKKATDVRLAAIAVGT
Sbjct  117  ----------TVSP-DENQDIECDGYLTRCLDGKKATDVRLAAIAVGT  153



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 107/168 (64%), Gaps = 29/168 (17%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            M  L +Y+G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+++ SI+ LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI          
Sbjct  61   QKEQVSIDVLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEIC---------  111

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
                         M+P   DLE+E DGYLSR +EGKKATDVRLAAIAV
Sbjct  112  -------------MTPEAVDLEIESDGYLSRCLEGKKATDVRLAAIAV  146



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 111/174 (64%), Gaps = 14/174 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGL---MLSLGHADVYCPSRKRARITGPFVVE----V  308
            MP LVNY GDD++  G S  S+ + L   + +  H D+Y    KRARI  P V       
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            QE  PSIEALPDECLFEIFR L   RERSS A VSKRWLML+S++R +EI +S+S     
Sbjct  61   QECTPSIEALPDECLFEIFRHLHSARERSSCAGVSKRWLMLLSTIRKAEICKSRST---C  117

Query  489  IADKVNGAS----NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            I+  V  ++      + +   DED E E +G+L+R +EGKKATDVRLAAIAVGT
Sbjct  118  ISQTVECSNVEQQKTISVVNCDEDQEDESNGFLTRCLEGKKATDVRLAAIAVGT  171



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 112/182 (62%), Gaps = 19/182 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEK  317
            M  + ++ GD DF  G  L     + GL L LG H DVY P RKR+RI+ PFVV  V ++
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVVSGVAKQ  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIF------------  461
            +PSIE LPDECLFE+FRRL GG ERS+ ACVSKRWLML+SS+   EI             
Sbjct  61   QPSIEILPDECLFEVFRRLPGGHERSACACVSKRWLMLLSSIYRDEICTTVTTHFVEPEN  120

Query  462  RSKSHQDLSIADKVNGASNDVE--MSPADEDL-EVECDGYLSRSVEGKKATDVRLAAIAV  632
            RS+S +    A        D    + P DE+  E +  GYLSR +EGKKA+DVRLAAI+V
Sbjct  121  RSESQKADEFAQPKEKGEFDCPNGIKPEDEEFQEADSHGYLSRCLEGKKASDVRLAAISV  180

Query  633  GT  638
            GT
Sbjct  181  GT  182



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 111/167 (66%), Gaps = 12/167 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ--EK  317
            M  L+ +SG DDF  G    +  + GL LSLGH ADV  P RKR+RI+ PFV      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFEK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            + SI+ LPDECLFEIF+R+ GG ERS+ ACVS+RWL ++S++   E   + ++      D
Sbjct  61   EVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSNPTNLSFKSQD  120

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +V+G ++        ED EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  EVSGNNS--------EDQEVENCGYLSRSLEGKKATDVRLAAIAVGT  159



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 111/167 (66%), Gaps = 12/167 (7%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQ--EK  317
            M  L+ +SG DDF  G    +  + GL LSLGH ADV  P RKR+RI+ PFV      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFEK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            + SI+ LPDECLFEIF+R+ GG ERS+ ACVS+RWL ++S++   E   + ++      D
Sbjct  61   EVSIDVLPDECLFEIFKRIPGGEERSACACVSRRWLNVLSNINTDEFSSNPTNLSFKSQD  120

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +V+G ++        ED EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  EVSGNNS--------EDQEVENCGYLSRSLEGKKATDVRLAAIAVGT  159



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 113/171 (66%), Gaps = 14/171 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  317
            M  L  +SG DDF  G S+  +     +    + DVY P  KR R++ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFFYPNQDVYFPPCKRCRVSSPFVFAGGKFEQK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ--DLSI  491
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +K+ Q  DL  
Sbjct  61   KPSIEILPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEIDDNKTTQASDLEY  120

Query  492  --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
               DK  G S++      D D +VE DGYLSRS++GKKATDVRLA+IAVGT
Sbjct  121  ESTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDVRLASIAVGT  165



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 114/170 (67%), Gaps = 11/170 (6%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            M  +  ++GD DF  G SL     +  L LSLG H D+Y P+ KR+RI+ PFV       
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+KK SI+ LPDECLFEIFRRL  G+ERS+ ACVSKRWLML+S++R  E+  +K+   L 
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKTTLPLK  120

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              D  N   N+ E+S  DE   ++ DGYL+R +EGKKATDVRLAAIAVGT
Sbjct  121  RED--NPGENE-EIS-GDEPPAIKDDGYLTRVLEGKKATDVRLAAIAVGT  166



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 114/170 (67%), Gaps = 11/170 (6%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            M  +  ++GD DF  G SL     +  L LSLG H D+Y P+ KR+RI+ PFV       
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+KK SI+ LPDECLFEIFRRL  G+ERS+ ACVSKRWLML+S++R  E+  +K+   L 
Sbjct  61   QKKKASIDVLPDECLFEIFRRLPTGQERSACACVSKRWLMLLSNIRGDELSCNKTTLPLK  120

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              D  N   N+ E+S  DE   ++ DGYL+R +EGKKATDVRLAAIAVGT
Sbjct  121  RED--NPGENE-EIS-GDEPPAIKDDGYLTRVLEGKKATDVRLAAIAVGT  166



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 113/170 (66%), Gaps = 24/170 (14%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQ  311
            M  L  +SG +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  312  EK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
             K   SIE LPDECLFEIFRRLS G+ERS+ A VSKRWLML+S++ + E+   KS  ++ 
Sbjct  61   SKANVSIEILPDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHEL---KSEDEV-  116

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                   AS +V      ED+E+E DGYLSRS+EGKKATD+RLAAI+VGT
Sbjct  117  -------ASKEV------EDIEIESDGYLSRSLEGKKATDLRLAAISVGT  153



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 111/176 (63%), Gaps = 16/176 (9%)
 Frame = +3

Query  129  FF*KETAMPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV  299
            FF +     +LV+   +DDF  G  + S   D  L LSLG H DVY PSRKR+RI+ PFV
Sbjct  43   FFKQYPCRRSLVSPVSNDDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFV  102

Query  300  VE----VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS  467
                   ++KK SI+ LPDECLFEIFRRL    ERS++ACVSKRWLML+S++R  E+   
Sbjct  103  FSEERLQKKKKASIDVLPDECLFEIFRRLPA-EERSASACVSKRWLMLLSNIRQEELCSE  161

Query  468  KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG  635
            K+   L   D +             ED E+E  GYLSRS+EGKKATDVRLAAIAVG
Sbjct  162  KTSASLKSEDDI--------AEEKGEDQEIETQGYLSRSLEGKKATDVRLAAIAVG  209



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 106/169 (63%), Gaps = 22/169 (13%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVV---EVQ  311
            M  L ++SG D+F  G S+     +  L  SLGH  DVY P  KR+RI+ P V     V+
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERVE  60

Query  312  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            +K PSIE LPDECLFEIFRRL GG+ERSS ACVSKRWL L+S++   EI     +    +
Sbjct  61   KKNPSIEILPDECLFEIFRRLPGGQERSSCACVSKRWLTLVSNIHRDEI---NDNNKGGV  117

Query  492  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              KV             ED +VE DGYLSR +EGKKATDVRLAAIAVGT
Sbjct  118  VSKV-------------EDQDVEGDGYLSRVLEGKKATDVRLAAIAVGT  153



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 112/171 (65%), Gaps = 14/171 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  317
            M  L  +SG DDF  G S+  +     +    + DVY P  KR RI+ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQDVYFPPCKRYRISAPFVFAGGKFEQK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI--  491
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +++ Q   +  
Sbjct  61   KPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQASDLEH  120

Query  492  --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
               DK  G S++      D D +VE DGYLSRS++GKKATD+RLA+IAVGT
Sbjct  121  ENTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDIRLASIAVGT  165



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 112/171 (65%), Gaps = 14/171 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC-SADLGLMLSLGHADVYCPSRKRARITGPFVV---EVQEK  317
            M  L  +SG DDF  G S+  +     +    + DVY P  KR RI+ PFV    + ++K
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQDVYFPPCKRYRISAPFVFAGGKFEQK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI--  491
            KPSIE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++R  EI  +++ Q   +  
Sbjct  61   KPSIEVLPDECLFEIFRRLPGGQERSTCACVSKRWLTLVSNIRRDEISDNQTPQASDLEH  120

Query  492  --ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
               DK  G S++      D D +VE DGYLSRS++GKKATD+RLA+IAVGT
Sbjct  121  ENTDKKGGVSSE------DVDSDVEGDGYLSRSLDGKKATDIRLASIAVGT  165



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 109/168 (65%), Gaps = 17/168 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  314
            MP LVNYSGDDDF    +  S +LG + S+   ADVY P  KR RI+ PF+       Q 
Sbjct  1    MPALVNYSGDDDFFIRKN--SIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQN  58

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            K+PSI  LP EC+FEIF+RL  GRERS  ACVSKRWL L+SS+R  E +RS +     + 
Sbjct  59   KQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGE-YRSSN----VVK  113

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            + ++  S  +E   ++E+      GYL+R +EGKKATDVRLAA+AVGT
Sbjct  114  ENIDSVSYAIETISSNEN-----GGYLTRCLEGKKATDVRLAAVAVGT  156



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 107/167 (64%), Gaps = 27/167 (16%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFV---VEVQ-EK  317
            MP LVNY  DD F  GS              H D YCP RKRAR++  F     E + E 
Sbjct  1    MPALVNYR-DDLFSIGS--------------HVDAYCPPRKRARLSAQFASGETEFEFEN  45

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            +PSI+ LPDECL+EIFRRL  G+ERS AACVSK+WLM+++S+R +EI +S+  +     +
Sbjct  46   QPSIDVLPDECLYEIFRRLPSGKERSFAACVSKKWLMMLTSIRKAEICKSEKLEK----E  101

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             V   S+ VEM   DED     DGYL+R ++GKKATD+RLAAIAVGT
Sbjct  102  VVASVSDHVEMVSCDED----GDGYLTRCLDGKKATDLRLAAIAVGT  144



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 111/170 (65%), Gaps = 17/170 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQ  311
            M  L+   G+DDF  G S+ +   +  L LSLG HADV+   RKR+RI+G FV      +
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  312  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            +KKP SI+ LPDECLFEIF+RL GG ERS+ ACVSK WL L+S++   E   + +   L+
Sbjct  61   QKKPVSIDVLPDECLFEIFKRLPGGEERSACACVSKHWLTLLSNIHRDEFCSNTNDLSLN  120

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              D+V G          ++D EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  PQDEVTG----------NKDQEVESCGYLSRSLEGKKATDVRLAAIAVGT  160



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 107/168 (64%), Gaps = 17/168 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----QE  314
            MP LVNYSGDD+F    +  S +LG + S+   ADVY P  KR RI+ PF+       Q 
Sbjct  1    MPALVNYSGDDEFFIRKN--SIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQN  58

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            K+PSI  LP EC+FEIF+RL  GRERS  ACVSKRWL L+SS+R  E   SK      + 
Sbjct  59   KQPSINDLPGECIFEIFKRLPSGRERSLCACVSKRWLRLLSSIRKGEYGSSK-----VVK  113

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            + ++  S  +E   ++E+      GYL+R +EGKKATDVRLAA+AVGT
Sbjct  114  ENIDSVSYAIETISSNEN-----GGYLTRCLEGKKATDVRLAAVAVGT  156



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 111/170 (65%), Gaps = 17/170 (10%)
 Frame = +3

Query  174  GDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----VQEKKPSIE  332
            G+D F  G S+ S   D  L LSLG H DVY P RKR+RI+ PFVV      Q+++ SI+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  333  ALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGA  512
             LPDECLFEI RRL  G+E+S+ ACVSKRWLML+SS++  EI  +K+   L   + +   
Sbjct  169  VLPDECLFEILRRLPEGQEKSACACVSKRWLMLLSSIQRDEICSNKTTGFLKPKETLISR  228

Query  513  SNDV----------EMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
            + D           E++P   DLE+E DGYLSR +EGKKATDVRLAAIAV
Sbjct  229  NTDESSEAKKKGGDEVTPEAVDLEIESDGYLSRCLEGKKATDVRLAAIAV  278



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 109/170 (64%), Gaps = 18/170 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E           
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDE-----------  109

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +  +   A  + E+    ED E+E DG LSRS+EGKKATD+RLAAIAVGT
Sbjct  110  LCSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDIRLAAIAVGT  159



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 106/168 (63%), Gaps = 20/168 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLG-LMLSLG-HADVYCPSRKRAR-ITGPFVVEVQE  314
            MP LVNYSGDD+   G S C    +LG L  ++G + DVY P  KR R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPRSIFEAIEREQYY  60

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            ++P IE LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++   EI R+ S       
Sbjct  61   QEPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTICKDEIERATSVD-----  115

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                      E   +DE+ ++E DGYL+R ++GKKATDVRLAAIAVGT
Sbjct  116  ----------ETVSSDENQDIEDDGYLTRCLDGKKATDVRLAAIAVGT  153



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 107/169 (63%), Gaps = 17/169 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  311
            M  L   SG DDF  G  +     + GL+L LG + D+Y  +RKR+RI+ PFV      +
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERFE  60

Query  312  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            +K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL L+S++   EI   K       
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACACVSKRWLSLLSNIHRDEIRSLKPE-----  115

Query  492  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                  A   VE+    ED +VE DGYLSRS+EGKKATD+RLAAIAVGT
Sbjct  116  ------AEKKVELVSDAEDPDVERDGYLSRSLEGKKATDIRLAAIAVGT  158



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 105/160 (66%), Gaps = 24/160 (15%)
 Frame = +3

Query  180  DDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQEK-KPSIEAL  338
            +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+ K   SIE L
Sbjct  61   EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEIL  120

Query  339  PDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASN  518
            PDECLFEIFRRLSGG+ERS+ A VSKRWLML+S++ + E+                  S 
Sbjct  121  PDECLFEIFRRLSGGKERSACATVSKRWLMLLSNISSHEL-----------------KSE  163

Query  519  DVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            DV  S   ED+E+E DGYLSRS+EGKKATD+RLAAI+VGT
Sbjct  164  DVVASKEVEDIEIESDGYLSRSLEGKKATDLRLAAISVGT  203



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 108/170 (64%), Gaps = 18/170 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  308
            M  +  ++G++DF  G  + +   +  L LS+G   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+K+ SIE LPDECLFEIFRRL GG ER + ACVSKRWL L+S++   E           
Sbjct  61   QKKQASIEFLPDECLFEIFRRLPGGDERGACACVSKRWLSLLSNICKDE-----------  109

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +  +   A  + ++    ED E+E DGYLSRS+EGKKATD+RLAAIAVGT
Sbjct  110  LCSQNESAKKNTQVKSEVEDEEIEGDGYLSRSLEGKKATDIRLAAIAVGT  159



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 107/161 (66%), Gaps = 13/161 (8%)
 Frame = +3

Query  171  SGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE---VQEKKPSIEA  335
            +G DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      ++K+ SI  
Sbjct  12   AGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKKEVSINV  71

Query  336  LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  515
            LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D+V+G  
Sbjct  72   LPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNIDRDEFSSNTTNQSFKSQDEVSGNK  131

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                     ED EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  132  --------AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGT  164



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 108/170 (64%), Gaps = 18/170 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E           
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDE-----------  109

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +  +   A  + E+    ED E+E DG LSRS+EGKKATD+RLAAI VGT
Sbjct  110  LCSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDIRLAAIVVGT  159



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 108/170 (64%), Gaps = 18/170 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            M  +  ++G++DF  G  + +   +  L LSLG   DVY PSRKR+RI+ PFV       
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+K+ SIE LPDECLFEIFRRL GG ERS+ ACVSKRWL+L+SS+   E           
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGEERSACACVSKRWLILLSSICRDE-----------  109

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +  +   A  + E+    ED E+E DG LSRS+EGKKATD+RLAAI VGT
Sbjct  110  LCSQNRSAVKNTEVKSKIEDEEIEGDGCLSRSLEGKKATDIRLAAIVVGT  159



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 108/170 (64%), Gaps = 20/170 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            M  ++ +SG DDF  G SL +   +    L LG   DVY P RKR+R+  PFV +     
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q++K SIE+LPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+   EI   K+    S
Sbjct  61   QKQKTSIESLPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKDEICVIKN----S  116

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             A+ +    +DVE            +GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  117  SAENIKKDGDDVEFGG---------EGYLSRSLEGKKATDVRLAAIAVGT  157



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = +3

Query  180  DDFLAGSSLCSA-DLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEKKPSIEALPDE  347
            DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK+ SI  LPDE
Sbjct  59   DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEKEVSINVLPDE  118

Query  348  CLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVE  527
            CLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D+V+G      
Sbjct  119  CLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQDEVSGNK----  174

Query  528  MSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                 ED EVE  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  175  ----AEDQEVEGCGYLSRSLEGKKATDVRLAAIAVGT  207



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 106/168 (63%), Gaps = 20/168 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLG-LMLSLG-HADVYCPSRKRAR-ITGPFVVEVQE  314
            MP LVNYSGDD+   G S C    +LG L  ++G + D+Y P  KR R I      E   
Sbjct  1    MPALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPRSIFEAIEREQYY  60

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            + P IE LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMS++                 
Sbjct  61   QDPGIEVLPDECLFEIFRRLPSGKERSSCACVSKRWLMLMSTI---------------CK  105

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            D++ G ++  E   +DE+ +++ DGYL+R ++GKKATDVRLAAIAVGT
Sbjct  106  DEIEGTTSVAETVSSDENQDIDDDGYLTRCLDGKKATDVRLAAIAVGT  153



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 118/196 (60%), Gaps = 25/196 (13%)
 Frame = +3

Query  102  NLFCSLFGGFF*KET---AMPT----------LVNYSGDDDFLAGSSLCSA-DLGLMLSL  239
            +LF +LF GFF  +     +P           L +    DDF  G    +  + GL+LSL
Sbjct  20   SLFFALFRGFFGGKLCTFGLPEVFELHPCQSYLASPVSKDDFCPGGIYTNPKEAGLLLSL  79

Query  240  GH-ADVYCPSRKRARITGPFVVE--VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACV  410
            GH ADV  P RKR+RI+ PF+      EK+ SI  LPDECLFEIF+R+ GG ERS+ ACV
Sbjct  80   GHHADVLFPPRKRSRISAPFIFSGGYFEKEVSINVLPDECLFEIFKRIPGGEERSACACV  139

Query  411  SKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVE  590
            SKRWL ++S++   E   + ++Q     D+V+G           ED EVE  GYLSRS+E
Sbjct  140  SKRWLNVLSNINRDEFSSNTTNQSFKSQDEVSGNK--------AEDQEVEGCGYLSRSLE  191

Query  591  GKKATDVRLAAIAVGT  638
            GKKATDVRLAAIAVGT
Sbjct  192  GKKATDVRLAAIAVGT  207



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 112/170 (66%), Gaps = 20/170 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLG-HADVYCPSRKRARITGPFVVEV----  308
            M  ++ ++G +DF +G S+  +  +  L LSLG H DVY P  KR+RI+ PFV       
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+++ +IE LPDECLFEIFRRL GG+ERS+ ACVSKRWL L+S++  +E    KS     
Sbjct  61   QKRQDTIEVLPDECLFEIFRRLPGGQERSACACVSKRWLNLLSNICPNERSSGKSQ----  116

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                     N+++ +   E++  E DG+LSRS+EGKKATD+RLAAIAVGT
Sbjct  117  ---------NNLDPTCGGEEVSSEDDGFLSRSLEGKKATDIRLAAIAVGT  157



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 117/183 (64%), Gaps = 21/183 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLGH-ADVYCPSRKRARITGPFV-VEVQEK  317
            M  + N+SGD+ F  G +L  +  +  L LSLGH  DVY P  KR+RIT P +  E Q+K
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFTEKQKK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK-----SHQD  482
             PSI+ LPDECLFE+FRR+S G+ERS+ ACVSKRWLML+SS+R  E   SK       ++
Sbjct  61   LPSIDVLPDECLFEVFRRVSDGKERSACACVSKRWLMLLSSIRGDETVVSKPSPSSETEE  120

Query  483  LSI-------ADKVNGAS----NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIA  629
             SI        D +        N VE++   E  ++E +G+LSR ++GKKATDVRLAAIA
Sbjct  121  RSIRSAPIKPVDCIKKGEVVEPNGVEVADV-ETQDIEGEGHLSRCLDGKKATDVRLAAIA  179

Query  630  VGT  638
            VGT
Sbjct  180  VGT  182



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 107/172 (62%), Gaps = 24/172 (14%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVE----V  308
            M  ++ +SG DDF    S+ +   +    LSLG   DVY P RKR+R+  PFV +     
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q++K SIEALPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+  SEI  +K      
Sbjct  61   QKQKTSIEALPDECLFEIFRRLPAGEDRSACACVSKRWLMLLSSICKSEISVNK------  114

Query  489  IADKVNGASNDVEMSPADE--DLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                     N    +P  E  D+E    GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  115  ---------NTTVENPEKEGDDVEFGGKGYLSRSLEGKKATDVRLAAIAVGT  157



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 115/183 (63%), Gaps = 21/183 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLGH-ADVYCPSRKRARITGPFV-VEVQEK  317
            M  + N+SGDD F  G +L  +  +  L LSLGH  DVY P  KR+R+T P +  E Q+K
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFTEKQKK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK---------  470
             PSI+ LPDECLFE+ RR+S G+ERS+ ACVSKRWLML+SS+R  E   SK         
Sbjct  61   LPSIDVLPDECLFEVLRRVSDGKERSACACVSKRWLMLLSSIRGYETVVSKPSPSSETEE  120

Query  471  -SHQDLSI--ADKVNGAS----NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIA  629
             S Q   +   D +        N VE++   E  ++E +G+LSR ++GKKATDVRLAAIA
Sbjct  121  RSIQSAPVKPVDSIKKGEVVDPNGVEVADI-ETQDIEGEGHLSRCLDGKKATDVRLAAIA  179

Query  630  VGT  638
            VGT
Sbjct  180  VGT  182



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 111/173 (64%), Gaps = 10/173 (6%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-  317
            M  +V++SGD+ F   + L     +    LSLG H +VY   RKR+RIT PF+V  + K 
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSGEPKQ  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL-SIA  494
            KPSIE LPDECLFE+FRRL GG+ERS+ A VSKRWLML+SS+   EI  +K    + S  
Sbjct  61   KPSIEILPDECLFEVFRRLEGGQERSACASVSKRWLMLLSSICKDEICTTKEEPKIGSDL  120

Query  495  DKVNGASNDVEMSPADEDLEVECD-----GYLSRSVEGKKATDVRLAAIAVGT  638
             K + ++   E      DL  EC      GYLSRS+EGKKA+DVRLAAI+VGT
Sbjct  121  PKADDSTKKAEEKGEFIDLTEECQETDSHGYLSRSLEGKKASDVRLAAISVGT  173



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 106/169 (63%), Gaps = 17/169 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV---EVQ  311
            M  L   SG DDF  G  +     + GL+L LG + DVY  +RKR+RI+ PFV      +
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERFE  60

Query  312  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            +K+ SIE LPDECLFEIFRRL GG ERS+ A VSKRWL L+S++   EI   K   +   
Sbjct  61   QKQVSIEVLPDECLFEIFRRLDGGEERSACASVSKRWLSLLSNIHRDEIRSLKPESE---  117

Query  492  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                      VE+    ED +VE DGYLSRS+EGKKATD+RLAAIAVGT
Sbjct  118  --------KKVELVSDAEDPDVERDGYLSRSLEGKKATDIRLAAIAVGT  158



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 108/160 (68%), Gaps = 24/160 (15%)
 Frame = +3

Query  180  DDFLAGSSLCS--ADLGLMLSL-GHADVYCPSRKRARITGPFVV---EVQEK-KPSIEAL  338
            +DF  G S+     D  L LSL  H DVY P RKR+RIT PFV    EV+ K   SIE L
Sbjct  2    EDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEIL  61

Query  339  PDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASN  518
            PDECLFEIFRRLS G+ERS+ A VSKRWLML+S++ + E+   KS  ++        AS 
Sbjct  62   PDECLFEIFRRLSDGKERSACATVSKRWLMLLSNISSHEL---KSEDEV--------ASK  110

Query  519  DVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +V      ED+E+E DGYLSRS+EGKKATD+RLAAI+VGT
Sbjct  111  EV------EDIEIESDGYLSRSLEGKKATDLRLAAISVGT  144



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 104/153 (68%), Gaps = 15/153 (10%)
 Frame = +3

Query  225  LMLSLG-HADVYCPSRKRARITGPFVVEVQ-EKKPSIEALPDECLFEIFRRLSGGRERSS  398
            L L LG H DVY   RKR+RI+ PFVV  + E++PSI+ LPDECLFE+FRRL GG+ERS+
Sbjct  27   LFLPLGNHVDVYFLPRKRSRISAPFVVSGEPEQQPSIDVLPDECLFEVFRRLPGGQERSA  86

Query  399  AACVSKRWLMLMSSVRNSEIFRSKSHQDL--------SIAD---KVNGASNDVE--MSPA  539
             ACVSKRWLMLMSS+   EI  SK+ Q +        ++A    K    SND+    S  
Sbjct  87   CACVSKRWLMLMSSIARDEICNSKTTQFVEPEIRSSPAVAHDSAKPKEKSNDMNGIKSED  146

Query  540  DEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +E  E +  GYLSR +EGKKATDVRLAAIAVGT
Sbjct  147  EECQENDSHGYLSRCLEGKKATDVRLAAIAVGT  179



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 112/174 (64%), Gaps = 14/174 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV-------  299
            MP LVNY G DD  +   L S   D   +LSL  + DV+CP RKR+R+T PF+       
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  300  -VEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  473
              E Q+++P SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+SS+R SE+   K+
Sbjct  61   GAEKQKQQPCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEMAAYKN  120

Query  474  HQDLSIADKVNGASNDVEMS-PADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
            +   S  + +     D+  +   DE+ E E  GYL+R ++ K ATDVRLAAIAV
Sbjct  121  NGT-SGCETLKKPLPDLNSAMSTDEEEEFESTGYLTRKLKAKDATDVRLAAIAV  173



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 107/168 (64%), Gaps = 17/168 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE----VQE  314
            M  +  +SGD+    G      +    LSLG   DVY P +KR+R++ PFV +     Q+
Sbjct  1    MSQVFGFSGDNFCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFEQK  60

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            +K SIE+LPDECLFEIFRRL  G ERS++ACVSKRWLML+S++  SEI  +KS       
Sbjct  61   QKTSIESLPDECLFEIFRRLPVGEERSASACVSKRWLMLLSNICKSEICSNKST------  114

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                 +SND      D + E   +GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  115  -----SSNDENKMECDSE-EFGGEGYLSRSLEGKKATDVRLAAIAVGT  156



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 108/170 (64%), Gaps = 20/170 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQE  314
            M  ++ +SG DDF    S+ +   +    L LG   DVY P RKR+R+  PFV   E  E
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  315  KKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            +KP  S+EALPDECLFEIFRRL  G +RS+ ACVSKRWLML+SS+  +EI  +K+    +
Sbjct  61   QKPKTSVEALPDECLFEIFRRLPSGEDRSACACVSKRWLMLLSSICKNEICVNKN----A  116

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              + +    +DVE            +GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  117  TVETIEKEGDDVEFGG---------EGYLSRSLEGKKATDVRLAAIAVGT  157



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 108/169 (64%), Gaps = 21/169 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS-ADLGLMLSLGH-ADVYCPSRKRARITGPFVVE----VQ  311
            M  +  +SGD+   +GS   +  +     SLGH  D Y P +KR+R++ PFV +     Q
Sbjct  1    MSQVFGFSGDNFCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFTQ  60

Query  312  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            ++K SIE+LPDECLFEIFRRL  G ERSS ACVSKRWLML+S++  SEI  +KS  +   
Sbjct  61   KQKTSIESLPDECLFEIFRRLPVGEERSSCACVSKRWLMLLSNICKSEICSNKSDDE---  117

Query  492  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             +K+ G S            E   +GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  118  -NKMEGVSE-----------EFGGEGYLSRSLEGKKATDVRLAAIAVGT  154



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 110/174 (63%), Gaps = 14/174 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  320
            MP LVNY G DD  +   L S   D   +LSL  + DV+CP RKR+R+T PF+ +  EK+
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  321  P---------SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKS  473
                      SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+S++R SE+   K+
Sbjct  61   GAEKQKQQSCSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSTIRASEMAAHKN  120

Query  474  HQDLSIADKVNGASNDVEMS-PADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
            +   S  + +     D+  +   DE+ E E  GYL+R ++ K ATDVRLAAIAV
Sbjct  121  NCT-SGCETLKKPLPDLNSAMSTDEEEEFESTGYLTRKLKAKDATDVRLAAIAV  173



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 115/183 (63%), Gaps = 21/183 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSA--DLGLMLSLG-HADVYCPSRKRARITGPFV-VEVQEK  317
            M  + N+SGDD F  G ++  +  +  L LSLG H DVY P  KR+R+  PFV  E ++K
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTEKKQK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
              SI+ LPDECLFE+ RRLS G+ERS++ACVSKRWLML+SS+   E   S  +  L   +
Sbjct  61   LSSIDVLPDECLFEVLRRLSDGKERSASACVSKRWLMLLSSIHGDETVISDLNPSLETEE  120

Query  498  K-VNGA---------------SNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIA  629
            + +  A               SN  E++ A E  ++E +G+LSR ++GKKATDVRLAAIA
Sbjct  121  RSIQTALVKPVDCVKKGEVLDSNGAEVADA-ESQDIEGEGHLSRCLDGKKATDVRLAAIA  179

Query  630  VGT  638
            VGT
Sbjct  180  VGT  182



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 110/181 (61%), Gaps = 31/181 (17%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARITGPFVVEVQEK-  317
            MP LV Y G DD      L S  +   L L  A   DV+CP RKR+R+T PFV +  EK 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  318  --KP-----SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  476
              KP     SI+ LPDECLFEI RRL G RERS++ACVSKRWLML+SS+R SEI      
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRRLPGSRERSNSACVSKRWLMLLSSIRASEI------  114

Query  477  QDLSIADKVNGASN-DVEMSP---------ADEDLEVECDGYLSRSVEGKKATDVRLAAI  626
                 A+K NG+SN D+  +P          DE+ E E  GYL+R ++ K+ATDVRLAA+
Sbjct  115  ----AANKKNGSSNGDLLKNPLPDLNDAVSTDEEEEPEKAGYLTRYLKAKEATDVRLAAM  170

Query  627  A  629
            A
Sbjct  171  A  171



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 102/170 (60%), Gaps = 19/170 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  308
            M  L  ++G DDF  G S+     + G  LSLG   D+Y P  KR+R + PFV       
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q K+ SI+ LP+ECLFEIF+RL GG ERS+ ACVSK+WL L+S++   E     ++  + 
Sbjct  61   QNKQVSIDVLPEECLFEIFKRLPGGEERSACACVSKKWLSLLSNIHRDEFCNKNTNLSVK  120

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              D+              ED E+E  GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  121  SQDETT------------EDQEIESCGYLSRSLEGKKATDVRLAAIAVGT  158



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 110/181 (61%), Gaps = 31/181 (17%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA---DVYCPSRKRARITGPFVVEVQE--  314
            MP LV Y G DD      L S  +   L L  A   DV+CP RKR+R+T PF+ +  E  
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  315  -KKP-----SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  476
             +KP     SI+ LPDECLFEI R L G RERS++ACVSKRWLML+SS+R SEI      
Sbjct  61   AEKPKQKLCSIDVLPDECLFEILRWLPGSRERSNSACVSKRWLMLLSSIRASEI------  114

Query  477  QDLSIADKVNGASN-DVEMSP---------ADEDLEVECDGYLSRSVEGKKATDVRLAAI  626
                 A+K NG+SN D+  +P         ADE+ E E  GYL+R ++ K+ATDVRLAA+
Sbjct  115  ----AANKKNGSSNGDLLKNPLPDLNDAVSADEEEEPEKAGYLTRYLKAKEATDVRLAAM  170

Query  627  A  629
            A
Sbjct  171  A  171



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 100/172 (58%), Gaps = 34/172 (20%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV--------E  305
            MP  VN SG+D+   G        G  +S  + DV+C   KR RI+ PF           
Sbjct  1    MPGRVNQSGNDELHPGCR------GYTIS-SNVDVHCSPTKRTRISAPFTFGPLPRALEH  53

Query  306  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  485
             Q+ KPSIE+LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+R  EI         
Sbjct  54   GQDLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI---------  104

Query  486  SIADKVNGASNDVEMSPADEDLE-VECDGYLSRSVEGKKATDVRLAAIAVGT  638
                      + VE   +DE  E  +  G+L+R +EG+KATDVRLAAIAVGT
Sbjct  105  ---------DSGVETISSDESEEDAKGGGWLTRRLEGRKATDVRLAAIAVGT  147



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 96/156 (62%), Gaps = 12/156 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSA-DLGLMLSLGH-ADVYCPSRKRARITGPFVVE--VQEK  317
            M  L+ +SG DDF  G    +  + GL+LSLGH ADV  P RKR+RI+ PF+      EK
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFEK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            + SI  LPDECLFEIF+R+ GG ERS+ ACVSKRWL ++S++   E   + ++Q     D
Sbjct  61   EVSINVLPDECLFEIFKRIPGGEERSACACVSKRWLNVLSNINRDEFSSNTTNQSFKSQD  120

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKAT  605
            +V+G           ED EVE  GYLSRS+E K+  
Sbjct  121  EVSGNK--------AEDQEVEGCGYLSRSLERKEGN  148



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 111/170 (65%), Gaps = 18/170 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADL---GLMLSLG-HADVYCPSRKRARITGPFVVEVQ--  311
            M TLV YSGDD    G  L S+ L    L LSL  + DVYCP RKR+R+T PFV+     
Sbjct  1    MSTLVKYSGDDRH--GGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNT  58

Query  312  --EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR-SKSHQD  482
              ++KPS++ LPDECLFEI RR++  R+RS+ ACVSK WLML S+++  E+   SK    
Sbjct  59   NFQRKPSLDNLPDECLFEILRRVNTSRDRSACACVSKHWLMLQSTIKRVEVVADSKLTCS  118

Query  483  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
             ++A++ + AS ++E +        + +GYLSRS+ G KATDVRLAAIAV
Sbjct  119  DALANQEDVASFEIEENG-------DSNGYLSRSLRGNKATDVRLAAIAV  161



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 100/172 (58%), Gaps = 34/172 (20%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV--------E  305
            MP  VN SG+D+   G        G  +S  + DV+C   KR RI+ PF           
Sbjct  1    MPGRVNQSGNDELHPGCR------GYTIS-SNVDVHCSPTKRTRISAPFTFGPLPRALEH  53

Query  306  VQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  485
             Q+ KPSIE+LPDECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+R  EI         
Sbjct  54   GQDLKPSIESLPDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSIRKDEI---------  104

Query  486  SIADKVNGASNDVEMSPADEDLE-VECDGYLSRSVEGKKATDVRLAAIAVGT  638
                      + VE   +DE  E  +  G+L+R +EG+KATDVRLAAIAVGT
Sbjct  105  ---------DSGVETISSDESEEDAKGGGWLTRRLEGRKATDVRLAAIAVGT  147



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 106/172 (62%), Gaps = 14/172 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARITGPFVVEVQEK-  317
            M  LVN  G+DD   G  L S  +   L L    + DVYCP RKR R+T P +    EK 
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  318  -----KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  482
                 + SI+ LP+ECLFEI RRL G +ERS++ACVSKRWLML+SS+R+SE+ + K    
Sbjct  61   ADEKLQRSIDTLPEECLFEILRRLPGDKERSNSACVSKRWLMLLSSIRSSELAQKKPS--  118

Query  483  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                + V     D+    A ++ E E +GYL+R ++ ++ATD+RLA+IA+GT
Sbjct  119  ---VESVKKPVPDLNKDCALDEHESENNGYLTRRLDAEEATDIRLASIALGT  167



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 103/167 (62%), Gaps = 24/167 (14%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  320
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P V    E+K
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEEK  60

Query  321  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            P SI+ LPDECLFEIFRRL G +ERSS A VSK WL L+SS+R  E+             
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSSCAFVSKHWLTLVSSIRQKEL-------------  107

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                   DV  S   ED + +C+G LSRS++GKKATDVRLAAIAVGT
Sbjct  108  -------DVVPSNKSEDGDDDCEGCLSRSLDGKKATDVRLAAIAVGT  147



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 105/167 (63%), Gaps = 26/167 (16%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  320
            M  + +++G++DF    ++     D  L+LSLG  ADVY P  KR+R+  P +    EKK
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKK  60

Query  321  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            P SI+ LPDECLFEIFRRLSG +ERS+ A VSK+WL L+SS+R  EI             
Sbjct  61   PVSIDVLPDECLFEIFRRLSGPQERSACAFVSKQWLTLVSSIRQKEI-------------  107

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                   DV  S   ED + +C+G LSRS++GKKATDVRLAAIAVGT
Sbjct  108  -------DVP-SKITEDGD-DCEGCLSRSLDGKKATDVRLAAIAVGT  145



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 107/170 (63%), Gaps = 27/170 (16%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQE  314
            M  + +++G+DDF  G  +     +  L LSLG   DVY P +KR+R + PF +  E  E
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  315  KKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            +KP  SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +E +         
Sbjct  61   QKPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNETY---------  111

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                    SN+   S  +E+ E+  +GYLSRS+EGKKATDVRLAAIA+GT
Sbjct  112  --------SNE---STGNENQEISDEGYLSRSLEGKKATDVRLAAIAIGT  150



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 102/169 (60%), Gaps = 29/169 (17%)
 Frame = +3

Query  159  LVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV------EVQ  311
            ++ +SG+DDF  G  +     +  L LSLG   DVY P +KR+R + PF +      + Q
Sbjct  1    MLGFSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQ  60

Query  312  EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            + K SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI           
Sbjct  61   KPKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYG-------  113

Query  492  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                         S  +E+ E+  +GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  114  -------------STGNENQEISDEGYLSRSLEGKKATDVRLAAIAVGT  149



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 109/176 (62%), Gaps = 31/176 (18%)
 Frame = +3

Query  174  GDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFV-------VEVQEKKP  323
            G DD  +   L S   D   +LS+  + DV+ P RKR+RIT PF+        E Q+++P
Sbjct  21   GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  324  -SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  500
             SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+SS+R SE+           A K
Sbjct  81   CSIDVLPDECLFEILRRLPGNKERSNSACVSKRWLMLLSSIRASEM----------AAHK  130

Query  501  VNGASN---------DVEMSPA-DEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             NGAS+         D+  S + DE+ E E  GYL+R ++ K ATDVRLAA+AVGT
Sbjct  131  KNGASSGETLKKPLPDLNTSASTDEEKEFESTGYLARKLKAKDATDVRLAAMAVGT  186



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 95/167 (57%), Gaps = 43/167 (26%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV----EVQEK  317
            MPTL+NYSG D+     S                 + PS KRARI  PFV+      QEK
Sbjct  1    MPTLINYSGKDELYNERS-----------------FYPSCKRARINAPFVLWGQESEQEK  43

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            + SI  LPDECLFEIFR L G +ERS+ ACVSK WL L+SS+R +E+             
Sbjct  44   RSSINVLPDECLFEIFRHLPG-QERSNCACVSKHWLTLLSSIRRAEMC------------  90

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                   D++     +D EV  DG L+RSVEGKKATDVRLAAIAVGT
Sbjct  91   -------DIDTVMVSDDKEV--DGCLTRSVEGKKATDVRLAAIAVGT  128



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 105/176 (60%), Gaps = 24/176 (14%)
 Frame = +3

Query  150  MPTLVNYSGDDDF---LAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPF-------  296
            M  LVNY G DD      GSS         LS G + DVYCP RKRAR+  P        
Sbjct  1    MAALVNYGGGDDLCPLFPGSSR-------FLSPGRNVDVYCPPRKRARVIAPLGFSFRGR  53

Query  297  -VVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  470
              V  ++++P SI+ LPDECLFEI RRL G +ERSS ACVSKRWLML+ S+R+SE+    
Sbjct  54   EEVAAEKQQPRSIDTLPDECLFEILRRLPGEKERSSCACVSKRWLMLLISIRSSELAARM  113

Query  471  SHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
               D S+  ++   S  V      E+ E E +GYL+R ++ ++ATD+RLA+IA G+
Sbjct  114  KTTDESVKTRMPDLSKGV----CAEEKECENNGYLTRRLDAEEATDIRLASIAFGS  165



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 109/181 (60%), Gaps = 21/181 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSL-GHADVYCPSRKRARITGPFVV-EVQEKKP  323
            M  + N+SGD       S    +  L LSL  H DVY P  KR+R+  PFV  E + K  
Sbjct  1    MSKVFNFSGDHGGTVYPS--PKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSEKKHKLS  58

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK-  500
            SI+ LPDECLFE+ RRLS G++RS++ACVSKRWLML+SS+R  E   S  +  L   ++ 
Sbjct  59   SIDVLPDECLFEVLRRLSDGKDRSASACVSKRWLMLLSSIRGDETVISNPNPSLETEERS  118

Query  501  VNGA---------------SNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG  635
            +  A               SN  E++ A E  ++E +G+LSR ++GKKATDVRLAAIAVG
Sbjct  119  IQTALVKSVDCVKKGEVVDSNAAEVAEA-ESQDIEGEGHLSRCLDGKKATDVRLAAIAVG  177

Query  636  T  638
            T
Sbjct  178  T  178



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 109/170 (64%), Gaps = 18/170 (11%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV----  308
            M  +  ++G++DF  G  + +   +  L LS+G   DVY PSRKR+RI+ PFV       
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+K+ SIE LPDECLFEIFRRL GG ER + ACVSK WL L+S++   E+      Q+ S
Sbjct  61   QKKQASIEVLPDECLFEIFRRLPGGNERGACACVSKHWLSLLSNICKDEL----CCQNES  116

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             A K+       ++    ED EVE DGYLSRS+EGKKATD+RLAAI VGT
Sbjct  117  -AKKI------TQVKSEVEDEEVEGDGYLSRSLEGKKATDIRLAAIVVGT  159



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 93/143 (65%), Gaps = 24/143 (17%)
 Frame = +3

Query  216  DLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRE  389
            D  L+LSLG  ADVY P  KR+R+  P +    EKKP SI+ LPDECLFEIFRRLSG +E
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIFSAFEKKPVSIDVLPDECLFEIFRRLSGPQE  60

Query  390  RSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDG  569
            RS+ A VSK+WL L+SS+R  EI                    DV  S   ED + +C+G
Sbjct  61   RSACAFVSKQWLTLVSSIRQKEI--------------------DVP-SKITEDGD-DCEG  98

Query  570  YLSRSVEGKKATDVRLAAIAVGT  638
             LSRS++GKKATDVRLAAIAVGT
Sbjct  99   CLSRSLDGKKATDVRLAAIAVGT  121



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 93/146 (64%), Gaps = 14/146 (10%)
 Frame = +3

Query  243  HADVYCPSRKRARITGPFVVEVQEKK-PSIEALPDECLFEIFRRLSGGRERSSAACVSKR  419
            H + Y   RKR RI+ PFV   + K  PSIE LPDECLFEIFRRL G +E+S  ACVSKR
Sbjct  47   HFESYSLQRKRCRISAPFVAGREVKLLPSIEILPDECLFEIFRRLHGNKEKSVCACVSKR  106

Query  420  WLMLMSSVRNSEIFRSKS--HQDLSIADKVN--------GASNDVEMSPADEDLEV---E  560
            WLML+SS+R  E + ++S  H +  I    N        G    V+ S + E+ EV   +
Sbjct  107  WLMLLSSIRKDESYTTESVGHLEPEIGFNSNVADYSPTVGEKYGVDCSSSVEEPEVGEND  166

Query  561  CDGYLSRSVEGKKATDVRLAAIAVGT  638
            C G+LSR + GKKATDVRLA+IA+GT
Sbjct  167  CHGFLSRYLGGKKATDVRLASIAIGT  192



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 105/167 (63%), Gaps = 22/167 (13%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEV-QEK  317
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P V    +EK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAFEEK  60

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            + SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+            D
Sbjct  61   QVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL------------D  108

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             V+  SN        ED + +C+G LSRS++GKKATDVRLAAIAVGT
Sbjct  109  VVSSNSNK------SEDGDDDCEGCLSRSLDGKKATDVRLAAIAVGT  149



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 110/171 (64%), Gaps = 31/171 (18%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG---HADVYCPSRKRARITGPFV-----  299
            M  + ++SG+++F  G S+ S   + G  LSLG   H DVY P+ KRARI+ P V     
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  300  VEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  479
            +E Q+K+ S++ LPDECL+EI RRL G +ERSS A VSKRWLML+SS+ ++++       
Sbjct  60   LE-QKKQVSLDVLPDECLYEILRRLPGDQERSSCASVSKRWLMLLSSIPSADL-------  111

Query  480  DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
                        N  E+  A+E  E+E DG+L+RS+EGKKATDVRLAAIAV
Sbjct  112  -----------CNKFEVV-AEEGDEIESDGFLTRSLEGKKATDVRLAAIAV  150



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 78/162 (48%), Positives = 101/162 (62%), Gaps = 24/162 (15%)
 Frame = +3

Query  180  DDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV--EVQEKKPSIEALPD  344
            +DF  G+ +     D  L LSLG   DVY P RKR+R++ PFV   E+ +K+ SIE LPD
Sbjct  13   EDFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVPSGEILKKEASIEVLPD  72

Query  345  ECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDV  524
            ECLFEIF+RL     RS  ACVSKRWLML+SS+  +E +               GAS ++
Sbjct  73   ECLFEIFKRLPERETRSLCACVSKRWLMLLSSISGNEFY---------------GASENL  117

Query  525  E----MSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +    ++   ED +   +G LSR++EGKKATDVRLAAIAVGT
Sbjct  118  KPKNVVTENLEDNQTTNEGCLSRNLEGKKATDVRLAAIAVGT  159



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 112/174 (64%), Gaps = 17/174 (10%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAG---SSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEV---  308
            M  LV Y G+DD   G   S+L   D  L+LSLG  ADVY P  KR R+T P +      
Sbjct  1    MAALVKYGGNDDICPGPFYSNL--TDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEK  58

Query  309  ---QEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSH  476
               +EK+P SI+ LPDECLFEI RRL G +ERS++ACVSK WLML+SS+R+SE+      
Sbjct  59   VIDEEKQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKHWLMLVSSIRSSELAACNKA  118

Query  477  QDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             D S+ +     +NDV +    ++ E E +GYL+R ++ ++ATD+RLA+IA+GT
Sbjct  119  CDESVKNPSLFLNNDVIV----DEQESENNGYLTRCLDAEEATDIRLASIALGT  168



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   127 bits (319),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 72/145 (50%), Positives = 94/145 (65%), Gaps = 15/145 (10%)
 Frame = +3

Query  216  DLGLMLSLG-HADVYCPSRKRARITGPFVVE---VQEKKPSIEALPDECLFEIFRRLSGG  383
            D  L LSLG H DVY P RKR+R++ P+V     +++K+ SIE LPDECLFEIF+RL   
Sbjct  26   DTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGEILKKKEASIEVLPDECLFEIFKRLPDR  85

Query  384  RERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVEC  563
              RS  ACVSKRWLML+SS+  +E + +  +    I            ++   ED ++  
Sbjct  86   ETRSLCACVSKRWLMLLSSISGNEFYSASENLKPKIV-----------VTENLEDNQITN  134

Query  564  DGYLSRSVEGKKATDVRLAAIAVGT  638
            +G LSR++EGKKATDVRLAAIAVGT
Sbjct  135  EGCLSRNLEGKKATDVRLAAIAVGT  159



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 99/165 (60%), Gaps = 35/165 (21%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFV-VEVQEKKP  323
            M  +  +SGD+DF  G S+        LS G    VY P+RKR RI  P V +  ++K+ 
Sbjct  1    MSGIFRFSGDEDFFPGGSM-------HLSPGSCPGVYFPARKRLRIAAPSVQIGFEQKQT  53

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL L+SS+  SE+  ++S QD       
Sbjct  54   SIEVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEV--NESVQD-------  104

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                             VE +G+LSRS+EGKKATD+RL+AI+VGT
Sbjct  105  -----------------VEGEGFLSRSLEGKKATDLRLSAISVGT  132



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 99/165 (60%), Gaps = 32/165 (19%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-KP  323
            M  L  +SGD+ +  G S+C       LS G +  VY P+RKR+RI+ P +    E+ + 
Sbjct  1    MSGLFRFSGDEGYFPGGSMC-------LSPGSNIGVYYPARKRSRISAPSLFSGFERNQA  53

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SIE LPDECLFEIFRRL  G+ERS  ACVSK+WL L+S++R  E   SK           
Sbjct  54   SIEVLPDECLFEIFRRLPSGQERSVCACVSKQWLGLLSNIRREEASGSK-----------  102

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                        DE  EVE +G+LSRS+EGKK TD++LAAI+VGT
Sbjct  103  ------------DEFQEVEDEGHLSRSLEGKKVTDLKLAAISVGT  135



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 105/170 (62%), Gaps = 21/170 (12%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHADVYCPSRKRARITGPFVVEVQ----  311
            M  + ++SG+DDF  G  +     +  L LSLG +  Y P +KR+R++  F +  +    
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVDYFPLQKRSRVSVSFDINREWFDE  60

Query  312  -EKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
             ++K SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +E+          
Sbjct  61   PKQKTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEVCS--------  112

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                 NG++ D  +   D+D     +GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  113  -----NGSTGDSNVG-GDDDQGFSNEGYLSRSLEGKKATDVRLAAIAVGT  156



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 99/163 (61%), Gaps = 25/163 (15%)
 Frame = +3

Query  162  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  329
            VN S D +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  5    VNQSSDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  60

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  61   EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  109

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             S+D      D D + E DGYL+R +EG+KATDVRLAAIAVGT
Sbjct  110  VSSD------DSDEDAEGDGYLTRRLEGRKATDVRLAAIAVGT  146



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 109/172 (63%), Gaps = 13/172 (8%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARIT------GPFVV  302
            M  LVN +G+DD   G  L S  +   L L    + D YCP  KR RIT      G    
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  303  EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  482
            + +++  SI+ LPDECLFEI RRL G +ERS++ACVSKRWLML+ S+R+SE+   K H++
Sbjct  61   DEKQQPRSIDTLPDECLFEILRRLPGDKERSNSACVSKRWLMLLCSIRSSELADRKKHRN  120

Query  483  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             S+   +   + DV    ++++ E E +G+L+R ++ ++ATD+RLA+IA+GT
Sbjct  121  ESVKKPLPDLNKDV----SEDEQESENNGFLTRRLDAEEATDIRLASIALGT  168



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 99/163 (61%), Gaps = 25/163 (15%)
 Frame = +3

Query  162  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  329
            VN S D +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  56   VNQSSDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  111

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  112  EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  160

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             S+D      D D + E DGYL+R +EG+KATDVRLAAIAVGT
Sbjct  161  VSSD------DSDEDAEGDGYLTRRLEGRKATDVRLAAIAVGT  197



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score =   126 bits (317),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 100/163 (61%), Gaps = 25/163 (15%)
 Frame = +3

Query  162  VNYSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPF----VVEVQEKKPSI  329
            +++ GD +   G S+ +   G + ++G  DV+C   KR RI+ PF    +   Q+ KP+I
Sbjct  1    MDFPGDVELYPGGSMDTG--GRVYAIG--DVHCSPTKRPRISVPFSFGALEHEQDLKPTI  56

Query  330  EALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNG  509
            E L DECLFEIFRRL  G+ERSS ACVSKRWLMLMSS+   +           I   V  
Sbjct  57   EVLLDECLFEIFRRLPSGKERSSGACVSKRWLMLMSSICKDD-----------IESGVET  105

Query  510  ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
             S+D      D D + E DGYL+R +EG+KATDVRLAAIAVGT
Sbjct  106  VSSD------DSDEDAEGDGYLTRRLEGRKATDVRLAAIAVGT  142



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 18/133 (14%)
 Frame = +3

Query  249  DVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWL  425
            DVY P RK++R++ P V    E++P SI+ LPDECLFEIFRR+ G +ER + A VSKRWL
Sbjct  37   DVYFPPRKKSRVSAPLVARAFEQEPVSIDVLPDECLFEIFRRMPGAQERCACASVSKRWL  96

Query  426  MLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVE--MSPADEDLEVECDGYLSRSVEGKK  599
             L+SS+          HQ     D++   SN V+   S  D + +VE +GYLSRS+EGKK
Sbjct  97   NLLSSI----------HQ-----DELEVISNKVKDGASKGDGEDDVESNGYLSRSLEGKK  141

Query  600  ATDVRLAAIAVGT  638
            ATDVRLAAIAVGT
Sbjct  142  ATDVRLAAIAVGT  154



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   125 bits (315),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 102/167 (61%), Gaps = 26/167 (16%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  320
            M  + +++G++DF    ++     D  L+LSLG   DVY P  KR+R+  P V    EKK
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSGFEKK  60

Query  321  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            P SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+             
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLKLVSSIRQKEL-------------  107

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              +  SN  E    D D   +C+G LSRS++GKKATDVRLAAIAVGT
Sbjct  108  --DVPSNKTE----DGD---DCEGCLSRSLDGKKATDVRLAAIAVGT  145



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 99/165 (60%), Gaps = 32/165 (19%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRARITGPFVVE-VQEKKP  323
            M  L  +SGD+DF  G SL        LS G   DVY P+ KR+RI  P +    ++ + 
Sbjct  1    MSGLFRFSGDEDFFPGGSL-------YLSPGSQIDVYYPAHKRSRIAAPAIFSGFEQNQV  53

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SI+ LPDECLFEIFR L  G+ERS+ ACVSKRWL L+S++R  E+  S+           
Sbjct  54   SIDVLPDECLFEIFRCLPSGQERSACACVSKRWLGLLSNIRGEEVSGSE-----------  102

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                        D+  +V+ +G+LSRS+EGKKATD++LAAI+VGT
Sbjct  103  ------------DKSQKVDDEGHLSRSLEGKKATDLKLAAISVGT  135



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 101/168 (60%), Gaps = 25/168 (15%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVV-EVQEK  317
            M  + +++G+++F    ++     D  L+LSLG + DVY P  KR+R+  P  V    EK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAFEK  60

Query  318  KP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            KP S + LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+            
Sbjct  61   KPVSFDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL------------  108

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                    DV  S   ED   +C+G LSRS++GKKATDVRLAAIAVGT
Sbjct  109  --------DVVPSNTSEDGGDDCEGCLSRSLDGKKATDVRLAAIAVGT  148



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 96/165 (58%), Gaps = 34/165 (21%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  323
            M  +  +SGD+DF  G S       + LS G    VY P+RKR RI  P V    +EK+ 
Sbjct  1    MSGIFRFSGDEDFFLGGS------SMYLSPGSCPGVYFPARKRLRIAAPSVFSGFEEKQT  54

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SI+ LPDECLFEI RRL  G ERS+ ACVSK WL L+SS+  SE+  ++S QD       
Sbjct  55   SIDVLPDECLFEILRRLPSGEERSACACVSKHWLNLLSSISRSEV--NESVQD-------  105

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                             VE +G+LSR +EGKKATD+RLAAIAVGT
Sbjct  106  -----------------VEGEGFLSRRLEGKKATDLRLAAIAVGT  133



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 102/167 (61%), Gaps = 26/167 (16%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEKK  320
            M  + +++G+++F    ++     D  L+LSLG   DVY P  KR+R+  P V    EKK
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSFEKK  60

Query  321  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            P SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L+SS+R  E+             
Sbjct  61   PVSIDVLPDECLFEIFRRLPGPQERSACAFVSKHWLTLVSSIRQKEL-------------  107

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                   DV  S   ED + +C+G LSRS++GKKATDVRLAAIAVGT
Sbjct  108  -------DVT-SNKTEDCD-DCEGCLSRSLDGKKATDVRLAAIAVGT  145



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 109/174 (63%), Gaps = 16/174 (9%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG---HADVYCPSRKRARITGPFV------V  302
            M  LVN  G DD   G SL S  +   L L    + DVYC SRKR R+T P        V
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  303  EVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-FRSKSH  476
              ++++P SI++LPDECLFEI RRL G +ERS++A VSKRWLML+SS+R+SE+  R KSH
Sbjct  61   AYKKQQPRSIDSLPDECLFEILRRLPGDKERSNSARVSKRWLMLLSSIRSSELGARKKSH  120

Query  477  QDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                  +       D+  +   ++ E E +GYL+R ++ ++ATD+RLA+IA+GT
Sbjct  121  -----VESGKKFLPDLNKNVLLDEQESENNGYLTRRLDAEEATDIRLASIALGT  169



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 96/165 (58%), Gaps = 35/165 (21%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  323
            M  +  +SGD+DF  G S+        LS G    VY P+ KR RI  P V    ++K+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSM-------YLSPGSCPGVYFPAHKRLRIAAPSVFSGFEQKQT  53

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L+SS+  +E+       D S+ D  
Sbjct  54   SIDVLPDECLFEILRRLPSGQERSACACVSKHWLNLLSSISRNEV-------DESVQD--  104

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                             VE +G+LSRS+EGKKATD+RLAAIAVGT
Sbjct  105  -----------------VEGEGFLSRSLEGKKATDLRLAAIAVGT  132



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 102/167 (61%), Gaps = 25/167 (15%)
 Frame = +3

Query  150  MPTLVNYSGDDDFL--AGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGPFVVEVQEKK  320
            M  + ++SG++DF     +     D+ L+LSLG   D Y P  KR+R+  P      E+K
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAFEEK  60

Query  321  P-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            P SI+ LP+ECLFEIFRRLSG +ER++ A VS+ WL L++S+R SE+             
Sbjct  61   PVSIDVLPEECLFEIFRRLSGSQERTACASVSRHWLTLVTSIRQSEL-------------  107

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                   DV  S   ED E +C+G LSRS++GKKATDVRLAAIAVGT
Sbjct  108  -------DVVPSSKTEDGE-DCEGCLSRSLDGKKATDVRLAAIAVGT  146



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 13/135 (10%)
 Frame = +3

Query  249  DVYCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLM  428
            DVY P  KR+R T     + ++KKPSIE LPDECLFEIFR L GGRERSS ACVSKRWL+
Sbjct  2    DVYFPLSKRSR-TSASGEKFEQKKPSIEVLPDECLFEIFRWLRGGRERSSCACVSKRWLI  60

Query  429  LMSS-----VRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEG  593
            L+S+     +R++ I  + + +D S   KV G  ++VE +      +V+ DGY +R++EG
Sbjct  61   LVSNICKYEIRDNNIIHALNPKDESTNKKV-GIVSEVEHN------DVDSDGYFTRNLEG  113

Query  594  KKATDVRLAAIAVGT  638
            KKATD  LAAIAVGT
Sbjct  114  KKATDGGLAAIAVGT  128



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 101/158 (64%), Gaps = 16/158 (10%)
 Frame = +3

Query  183  DFLAGSSLC--SADLGLMLSLG-HADVYCPSRKRARITGPFVVEVQEK-KPSIEALPDEC  350
            DF    + C  S D  L  +LG   D+Y   RKR+RI+ PF+   + K + SIEALPDEC
Sbjct  6    DFSDVHTFCPNSKDSNLSFTLGSRVDMYFLQRKRSRISAPFIAGKKSKMQSSIEALPDEC  65

Query  351  LFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEM  530
            LFEI RRL  GRE ++ ACVSKRWLML+SS++  E+  S++ + +           +++ 
Sbjct  66   LFEILRRLPRGRETNACACVSKRWLMLLSSMKKDEMCTSETTRFV---------GPEIQS  116

Query  531  SP--ADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +P    ED +V   GYLSR +EGKKATDVRLAAIAVGT
Sbjct  117  NPPKPKEDDDVS-RGYLSRCLEGKKATDVRLAAIAVGT  153



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 96/165 (58%), Gaps = 33/165 (20%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP-FVVEVQEKKP  323
            M  +  +SGD+D L G S+        LS G    VY P+RKR R+    F    +EK+ 
Sbjct  1    MSGIFRFSGDEDCLLGGSM-------YLSPGSCPGVYYPARKRLRVAATSFYSGFEEKQT  53

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SI+ LP+ECLFEI RRL  G+ERS+ ACVSK WL L+SS+  SE+  S            
Sbjct  54   SIDVLPEECLFEILRRLPSGQERSACACVSKHWLNLLSSISRSEVNES------------  101

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
              +  DVE          E +G+LSRS+EGKKATD+RLAAIAVGT
Sbjct  102  --SVQDVE----------EGEGFLSRSLEGKKATDLRLAAIAVGT  134



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 104/171 (61%), Gaps = 22/171 (13%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCS--ADLGLMLSLGHADVYCPSRKRARITGPFVV-----EV  308
            M  + ++SG+DDF  G  +     +  L LSLG +  Y   +KR+R++  F +     + 
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVDYFSLQKRSRVSVSFDINREWFDE  60

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q+++ SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI  + S  D +
Sbjct  61   QKQEISIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKNEICSNGSTGDYN  120

Query  489  IADKVNGASNDVEMSPADEDLEVECDGY-LSRSVEGKKATDVRLAAIAVGT  638
            +                D+D     +GY LSRS+EGKKATDVRLAAIAVGT
Sbjct  121  VG--------------GDDDQGFSNEGYLLSRSLEGKKATDVRLAAIAVGT  157



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 92/165 (56%), Gaps = 38/165 (23%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP-FVVEVQEKKP  323
            M  + ++SGD++F  G S+        LS G  + VY P RKR R+  P       +K+ 
Sbjct  1    MSGIFSFSGDEEFFNGGSM-------YLSTGSCSGVYLPPRKRLRVAAPSLYSSFNQKQT  53

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESLQ-------------  100

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                            EVE +G+LSRS+EG KATD+RLAAI+VGT
Sbjct  101  ----------------EVESEGFLSRSLEGNKATDLRLAAISVGT  129



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 96/165 (58%), Gaps = 34/165 (21%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  323
            M  +  +SGD+DF  G S+ +      LS G    VY P+RKR RI    V    ++K+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHN------LSPGSCPGVYFPARKRLRIAATSVFSGFEQKQT  54

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+  S            
Sbjct  55   SIDVLPDECLFEILRRLPSGKERSACACVSKHWLHLLTSITRNEVVESV-----------  103

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                         +DLE E  G+LSRS++GKKATD+RLAA++VGT
Sbjct  104  -------------QDLEGE--GFLSRSLDGKKATDLRLAAVSVGT  133



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 96/165 (58%), Gaps = 34/165 (21%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVE-VQEKKP  323
            M  +  +SGD+DF  G S+ +      LS G    VY P+RKR RI    V    +EK+ 
Sbjct  1    MSGIFGFSGDEDFFLGGSMHN------LSPGSCPGVYFPARKRLRIAATSVFSGFEEKQT  54

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SI+ LPDECLFEI RRL  G+ERS+ ACVSK WL L++S+  +E+   +S QD       
Sbjct  55   SIDVLPDECLFEILRRLPSGKERSACACVSKHWLNLLTSITRNEVV--ESVQD-------  105

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                             VE +G+LSRS++G KATD+RLAA+AVGT
Sbjct  106  -----------------VEGEGFLSRSLDGVKATDLRLAAVAVGT  133



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 87/143 (61%), Gaps = 24/143 (17%)
 Frame = +3

Query  216  DLGLMLSL-GHADVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRE  389
            D  L+LSL    DVY P  KR R+  P +    EKKP SI+ LPDECLFEIFRRLSG +E
Sbjct  25   DASLLLSLISFGDVYFPPSKRQRVVLPTLFSAFEKKPVSIDVLPDECLFEIFRRLSGPQE  84

Query  390  RSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDG  569
            RS+ A VSK+WL  +SS+R  EI         ++  K+          P D D    C+G
Sbjct  85   RSACAFVSKQWLTTVSSIRQKEI---------TVPSKI----------PEDGD---NCEG  122

Query  570  YLSRSVEGKKATDVRLAAIAVGT  638
             LSRS++GKK TDVRLAA AVGT
Sbjct  123  TLSRSLDGKKRTDVRLAANAVGT  145



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 99/171 (58%), Gaps = 25/171 (15%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHAD-VYCPSRKRARITGPFVVEVQ---  311
            M  +++++G DDF  G S  L   +  L LSLG  +  Y P +KR+R   PF    +   
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  312  EKKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  485
            + KP  SIE LPDECLFEI RRL  G++RS  A VSKRWL L+SS+  +EI         
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEI---------  111

Query  486  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                     SN    +   ++ E   +GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  112  --------CSNASSGNKDSDNQEFGDEGYLSRSLEGKKATDVRLAAIAVGT  154



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 93/165 (56%), Gaps = 38/165 (23%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP-FVVEVQEKKP  323
            M  + +++GD++F  G S+        LS G  + VY P RKR R++ P       +K+ 
Sbjct  1    MSGIFSFNGDEEFFNGGSM-------YLSPGSCSGVYLPPRKRLRVSTPSLYSSFNQKQT  53

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESLQ-------------  100

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                            EVE +G+LSRS+EG KATD+RLAAI+VGT
Sbjct  101  ----------------EVESEGFLSRSLEGNKATDLRLAAISVGT  129



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 101/171 (59%), Gaps = 25/171 (15%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSS--LCSADLGLMLSLGHAD-VYCPSRKRARITGPFVVEVQ---  311
            M  +++++G DDF  G S  L   +  L LSLG  +  Y P +KR+R   PF    +   
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  312  EKKP--SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDL  485
            + KP  SIE LPDECLFEI RRL  G++RS  A VSKRWL L+SS+  +EI         
Sbjct  61   DLKPETSIETLPDECLFEILRRLPEGQDRSLCASVSKRWLTLLSSISKNEI--------C  112

Query  486  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            S A   N  S++ E    DE       GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  113  SNASSGNKDSDNQEF--GDE-------GYLSRSLEGKKATDVRLAAIAVGT  154



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 91/165 (55%), Gaps = 38/165 (23%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGPFVVEV-QEKKP  323
            M  + ++SGD+DF  G ++        LS G    VY P RKR R+  P       +K+ 
Sbjct  1    MSGIFSFSGDEDFFNGGTM-------HLSPGSCPGVYLPPRKRLRVAAPSPYSAFNQKQT  53

Query  324  SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKV  503
            SIE LPDECLFEI RRL  G+ERS+ ACVSK WL  ++S++ +E  +             
Sbjct  54   SIEVLPDECLFEILRRLPSGKERSACACVSKHWLNTLTSIKANESVQ-------------  100

Query  504  NGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                            EVE +G+LSRS+EG KATD+RLAAI+VGT
Sbjct  101  ----------------EVESEGFLSRSLEGNKATDLRLAAISVGT  129



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 93/161 (58%), Gaps = 34/161 (21%)
 Frame = +3

Query  168  YSGDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVV----EVQEKKPSIEA  335
            +SG+D+   G S   +      ++ H DVY P  KR R+  PFV+      Q  + SI  
Sbjct  8    FSGEDELYGGRSSNPS------AMSHVDVYGPPNKRQRVNAPFVLWGSNPEQNTRSSINV  61

Query  336  LPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGAS  515
            LPDEC+FE+FRRL   +ERS+ ACVSK+WL +++ +R SE+  + S Q          +S
Sbjct  62   LPDECMFEVFRRLPP-QERSNCACVSKQWLTILTGIRRSEMSSTLSVQ----------SS  110

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            +DV             D  L+RSVEGKKATDVRLAAIAVGT
Sbjct  111  DDV-------------DSCLTRSVEGKKATDVRLAAIAVGT  138



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 81/130 (62%), Gaps = 22/130 (17%)
 Frame = +3

Query  252  VYCPSRKRARITGPFVVEVQEK-KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLM  428
            VY   RKR R+  PFV   + K  PSI+ALPDECLFEI RRL G  E+S+ ACVSKRWLM
Sbjct  1    VYSLQRKRCRVNAPFVASREFKLPPSIDALPDECLFEILRRLPGINEKSACACVSKRWLM  60

Query  429  LMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATD  608
            L+SS+   E + +++ ++              E SP          G+LSRSVEGK A+D
Sbjct  61   LLSSISRDESYTTEALREFE------------ESSP---------RGFLSRSVEGKNASD  99

Query  609  VRLAAIAVGT  638
            VRLAAIA+GT
Sbjct  100  VRLAAIAIGT  109



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 92/165 (56%), Gaps = 41/165 (25%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYC--PSRK-RARITGPFVVEVQEKK  320
            MPTL+NY+GDD+F   S     D    L +      C  P+++ RA +  PF     +  
Sbjct  1    MPTLLNYTGDDEFHPTSM---EDFPCFLPVSSRINVCFQPNKRVRANLKIPF--RRDDTN  55

Query  321  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  500
            PSI+ LPDECLFEIF+RL  G+ +SS ACVSKRWLML+SS+R                  
Sbjct  56   PSIDDLPDECLFEIFKRLYNGKSKSSCACVSKRWLMLLSSIR------------------  97

Query  501  VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG  635
                   VE        E E +GYL+R +EGKKATD+RLAAIA+G
Sbjct  98   -------VE--------ETENNGYLTRHLEGKKATDIRLAAIAIG  127



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 92/165 (56%), Gaps = 41/165 (25%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHADVYC--PSRK-RARITGPFVVEVQEKK  320
            MPTL+NY+GDD+F   S     D    L +      C  P+++ R  +  PF+ +  + K
Sbjct  1    MPTLLNYTGDDEFHPTSM---EDFPCFLPISSRINVCFQPNKRFRTNLKIPFLGD--DTK  55

Query  321  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  500
            PSI+ LPDECLFEIF+RL  G+ +SS ACVSKRWLML+SS+R                  
Sbjct  56   PSIDDLPDECLFEIFKRLDNGKSKSSCACVSKRWLMLLSSIRME----------------  99

Query  501  VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG  635
                             + E +GYL+R +EGKKATD+RLAAIA+G
Sbjct  100  -----------------KTENNGYLTRHLEGKKATDIRLAAIAIG  127



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 91/156 (58%), Gaps = 32/156 (21%)
 Frame = +3

Query  174  GDDDFLAGSSLCSADLGLMLSLGHADVYCPSRKRARITGPFVVE-VQEKKPSIEALPDEC  350
            GD+DF  G S+ +   G         VY P+RKR RI    V    ++K+ SI+ LPDEC
Sbjct  5    GDEDFFLGGSMHNLSPG-----SCPGVYFPARKRLRIAATSVFSGFEQKQTSIDVLPDEC  59

Query  351  LFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEM  530
            LFEI RRL  G+ERS+ ACVSK WL L++S+  +E+   +S QDL               
Sbjct  60   LFEILRRLPSGKERSACACVSKHWLNLLTSITRNEV--CESVQDL---------------  102

Query  531  SPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                     E +G+LSRS++GKKATD+RLAA+AVGT
Sbjct  103  ---------EGEGFLSRSLDGKKATDLRLAAVAVGT  129



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 84/131 (64%), Gaps = 15/131 (11%)
 Frame = +3

Query  249  DVYCPSRKRARITGPFVVEVQEKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWL  425
            D Y P  KR R++ P    V E+ P SI+ LPDECLFE+FRRL G +ERS  A VSKRWL
Sbjct  37   DAYFPPCKRTRVSAPTAFSVFEQDPVSIDVLPDECLFEVFRRLPGAQERSVCASVSKRWL  96

Query  426  MLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKAT  605
             L+S +R  E+            D ++  + D  M   ++D++ +  GYLSRS+EGKKA+
Sbjct  97   NLLSGIRPDEL------------DDISKKAKDASMEDCEDDVDCD--GYLSRSLEGKKAS  142

Query  606  DVRLAAIAVGT  638
            DVRLAAIAVGT
Sbjct  143  DVRLAAIAVGT  153



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 102/170 (60%), Gaps = 28/170 (16%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLC----SADLGLMLSLGHADVYCPSRKRARI--TGPFVVEVQ  311
            M  + +++G++DF    ++      A+L L L+      Y P  KR+R+  T P +    
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  312  EKKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            E KP SI+ LPDECLFEIFRRL G +ERS+ A VSK WL L++S++ +EI          
Sbjct  61   EAKPVSIDVLPDECLFEIFRRLPGPQERSACASVSKHWLTLVTSIKQNEI----------  110

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                  GA    ++S   ED + +C+G LSRS++GKKATDVRLAAIAVGT
Sbjct  111  ------GA----DLSNKTEDGD-DCEGCLSRSLDGKKATDVRLAAIAVGT  149



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 99/169 (59%), Gaps = 33/169 (20%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGHADVYCPSRKRARITGP----FVVEVQE  314
            M  + +++G+ +F   GS+   A++ L L     D Y P  KR+R+       F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL----VDCYYPPCKRSRVVAAAPSLFSAFEEE  56

Query  315  KKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            +KP SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+           
Sbjct  57   EKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL-----------  105

Query  492  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                     DV +    ED   +C+G LSRS++GKKATDVRLAA+AVGT
Sbjct  106  ---------DVVVDNKTED---DCEGCLSRSLDGKKATDVRLAAVAVGT  142



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 99/208 (48%), Gaps = 47/208 (23%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLG-HADVYCPSRKRAR--ITGPF--VVEVQE  314
            MPTLV++ GD+DF         D  L LSL    +V CP RKR R  +T PF      QE
Sbjct  1    MPTLVSFRGDEDFGGPKFSGRVDTDLFLSLAPRMEVLCPPRKRLRGNVTIPFRETKPKQE  60

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK--------  470
            +K  I  LPDECLFEIFR L   R+RS +ACVSKRWLML SS+R SEI RSK        
Sbjct  61   QKDLISMLPDECLFEIFRCLPAARDRSVSACVSKRWLMLQSSMRRSEIKRSKPSPKTCGE  120

Query  471  ------SHQDLSIADKVNGASNDVE------------MSPADEDLEVECDGY--------  572
                  S Q     D  + + ++ E            + P   + +    G         
Sbjct  121  APNRDRSEQSKPSQDNASFSEDNFEEFFDDGFGELEHLEPESREFDAGWKGTTDKGTGEK  180

Query  573  --------LSRSVEGKKATDVRLAAIAV  632
                    LSR +EGKK TD  L+AI +
Sbjct  181  KPRWVIGDLSRCLEGKKVTDNTLSAIGL  208



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 97/168 (58%), Gaps = 31/168 (18%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGH-ADVYCPSRKRARITGP---FVVEVQE  314
            M  + +++G+ +F   GS+   A++   LSLG   D Y P  KR+R+      F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANI--FLSLGSLVDCYYPPCKRSRVVAAPSLFSAFEEE  58

Query  315  KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            K  SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+            
Sbjct  59   KPVSIDVLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL------------  106

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                    DV     D   E + +G LSRS++GKKATDVRLAAIAVGT
Sbjct  107  --------DV----VDHKTEDDSEGCLSRSLDGKKATDVRLAAIAVGT  142



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 93/172 (54%), Gaps = 38/172 (22%)
 Frame = +3

Query  150  MPTLVNYSGDDDFL-AGSSLCSADLGLMLSL---GHADVYCPSRKRARITGPFVVEVQEK  317
            MP L N  G  +F  A  S+C   L L  S     + DVY P  KRAR++        E 
Sbjct  1    MPALANCCGAGEFHNATGSICKTQLNLGKSRFVGNNVDVYYPPGKRARLS--------ES  52

Query  318  KP------SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  479
            +P      SIE LPDECLFEI RRL G +ER  ++CVS+RWL +++ +R SE        
Sbjct  53   EPEATDRSSIEILPDECLFEILRRLPGVKERCVSSCVSRRWLSVLTMIRLSEF-------  105

Query  480  DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG  635
                      A NDV+M P+D+D     DG   R +EGKKATD+ L+AIAVG
Sbjct  106  ---------SACNDVDMVPSDDDE----DGCRVRCLEGKKATDMTLSAIAVG  144



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 88/168 (52%), Gaps = 38/168 (23%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP---FVVEVQEK  317
            M  +   SGDD+F  G    S    + LS G    VY P+RKR R+T     F    +EK
Sbjct  1    MSGIFRVSGDDEFFTGGGGSS----MHLSPGSCPGVYLPARKRLRVTAAATSFYSSFEEK  56

Query  318  KPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            + SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+   E       +     
Sbjct  57   QASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRDESVEEVESE-----  111

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                                    G+LSRS+EG KATD+RLAAI+VGT
Sbjct  112  ------------------------GFLSRSLEGNKATDLRLAAISVGT  135



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 88/168 (52%), Gaps = 38/168 (23%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP---FVVEVQEK  317
            M  +   SGDD+F  G    S    + LS G    VY P+RKR R+T     F    +EK
Sbjct  1    MSGIFRVSGDDEFFTGGGGSS----MHLSPGSCPGVYLPARKRLRVTAAATSFYSSFEEK  56

Query  318  KPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIA  494
            + SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+   E       +     
Sbjct  57   QASIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSITRDESVEEVESE-----  111

Query  495  DKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                                    G+LSRS+EG KATD+RLAAI+VGT
Sbjct  112  ------------------------GFLSRSLEGNKATDLRLAAISVGT  135



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 71/110 (65%), Gaps = 20/110 (18%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            + ++ SIE+LPDECLFEI RRL  G++RS  A VSKRWLML+SS+  +EI          
Sbjct  104  RSQRTSIESLPDECLFEILRRLPAGQDRSVCASVSKRWLMLLSSICKTEIHSYG------  157

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                          S  +E+ E+  +GYLSRS+EGKKATDVRLAAIAVGT
Sbjct  158  --------------STGNENQEISDEGYLSRSLEGKKATDVRLAAIAVGT  193



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 90/170 (53%), Gaps = 42/170 (25%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLAGSSLCSADLGLMLSLGHA-DVYCPSRKRARITGP----FVVEVQE  314
            M  +   SGDD+F  G         + LS G    VY P+RKR R+       F    +E
Sbjct  1    MSGIFRISGDDEFFTG-----GGSSMHLSPGSCPGVYLPARKRLRVASAAATSFYSSFEE  55

Query  315  KKPSIEALPDECLFEIFRRL-SGGRERSSAACVSKRWLMLMSSV-RNSEIFRSKSHQDLS  488
            K+ SI+ LPDECLFEI RRL S GRERS+ ACVSK WL ++SS+ RN  +   +S     
Sbjct  56   KQTSIQVLPDECLFEILRRLPSSGRERSACACVSKHWLSVLSSIARNESVEEVES-----  110

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                                     +G+LSRS+EG KATD+RLAAI+VGT
Sbjct  111  -------------------------EGFLSRSLEGNKATDLRLAAISVGT  135



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 98/170 (58%), Gaps = 36/170 (21%)
 Frame = +3

Query  150  MPTLVNYSGDDDFLA-GSSLCSADLGLMLSLGHADVYCPSRKRARITGP----FVVEVQE  314
            M  + +++G+ +F   GS+   A++ L L     D Y P  KR+R+       F    +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL----VDCYYPPCKRSRVVAAAPSLFSAFEEE  56

Query  315  KKP-SIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSI  491
            +KP SI+ LPDECLFEIFRRL G +ER++ A VSK WL L++S+R SE+           
Sbjct  57   EKPVSIDLLPDECLFEIFRRLPGPQERTACAFVSKHWLTLVTSIRQSEL-----------  105

Query  492  ADKVNGASNDVEMSPADEDLEVECDGYLSRSVEG-KKATDVRLAAIAVGT  638
                     DV     D   E +C+G LSRS++G KKATDVRLAA+AVGT
Sbjct  106  ---------DV-----DNKTEDDCEGCLSRSLDGKKKATDVRLAAVAVGT  141



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 96/172 (56%), Gaps = 31/172 (18%)
 Frame = +3

Query  150  MPTLVNYSGDDDFL-AGSSLCSA--DLGLMLSLG-HADVYC-PSRKRARITGPFV-----  299
            MP L NY G  +   AG S+C    +LG +L  G +A VY  P  KRARI+   +     
Sbjct  1    MPALANYCGTGELHNAGGSICKTQLNLGKLLYTGDNAGVYYYPPNKRARISSSVLSVESE  60

Query  300  VEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQ  479
             EV E++ SIE LPDECLFEI RRL   +ER  + CVSKRWL +++S+R SE        
Sbjct  61   TEVSEQQ-SIEILPDECLFEILRRLPRVKERCLSLCVSKRWLNVLTSMRLSEF-------  112

Query  480  DLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG  635
                      A NDV+M  +++D     DG   R +EGKKATD+ L  +AVG
Sbjct  113  ---------SACNDVDMVLSEDDD----DGSRVRCLEGKKATDMTLFGLAVG  151



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 75/111 (68%), Gaps = 12/111 (11%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q  +PS++ALPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+ ++ +    S
Sbjct  66   QPPQPSLDALPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRASELGQATAAAPPS  125

Query  489  IADKVNG---ASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
            + D +N       D + SP D  +E        R +EGK+ATDVRLAA+AV
Sbjct  126  LPD-LNEEFVMEEDTDDSPVDPCVE--------RVLEGKEATDVRLAAMAV  167



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 15/112 (13%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI----FRSKSH  476
            Q  +PS++ LPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+      + S 
Sbjct  61   QPPQPSLDGLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRVSELGHAALAAPSL  120

Query  477  QDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
             DL+    +   ++D   SPAD  +E        R +EG +ATDVRLAA+AV
Sbjct  121  PDLNEEFVMEEGTDD---SPADPCVE--------RVLEGNEATDVRLAAMAV  161



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 74/138 (54%), Gaps = 28/138 (20%)
 Frame = +3

Query  225  LMLSLGHA-DVYCPSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSA  401
            L LS G   +V  P RKR  +T       Q   PSIE L DECLF++F+ L  G+ERS  
Sbjct  14   LFLSRGQNRNVNFPPRKRICVTTASKNFEQRNHPSIEILLDECLFKVFKHLPSGKERSVC  73

Query  402  ACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSR  581
            ACVSKRWL L+SS+R  +I  S            NG               +E  G L R
Sbjct  74   ACVSKRWLTLLSSIRKDKIPES------------NG---------------IEGKGSLVR  106

Query  582  SVEGKKATDVRLAAIAVG  635
            S+ G++ATDVRLAAIAVG
Sbjct  107  SLVGREATDVRLAAIAVG  124



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 71/109 (65%), Gaps = 9/109 (8%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEI-FRSKSHQDL  485
            Q  +PS++ LPDECLFE+ RRL GGRER+ +ACVS+RWL L++S+R SE+   + +   L
Sbjct  351  QPPQPSLDVLPDECLFEVLRRLPGGRERADSACVSRRWLALLASIRISELGHAAAAAPSL  410

Query  486  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
               ++      D + SPAD  +E        R +EG +ATDVRLAA+AV
Sbjct  411  PDLNEEFVMEEDTDDSPADPCVE--------RVLEGNEATDVRLAAMAV  451



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 72/117 (62%), Gaps = 16/117 (14%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS-------  467
            Q + PS++ALPDECLFE+ RRL GGRER ++ACVS+RWL L+ S+R SE+ ++       
Sbjct  62   QRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASELNQATAAAAAA  121

Query  468  --KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
               S  DL+    +     + E SP         D  + R +EGK+ATDVRLAA+AV
Sbjct  122  APPSLPDLNEEFVMEEDDEEEESSPV-------VDPCVERVLEGKEATDVRLAAMAV  171



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 72/117 (62%), Gaps = 15/117 (13%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRS-------  467
            Q + PS++ALPDECLFE+ RRL GGRER ++ACVS+RWL L+ S+R SE+ ++       
Sbjct  54   QRQPPSLDALPDECLFEVLRRLPGGRERGASACVSRRWLALLCSIRASELNQATAAAAAA  113

Query  468  --KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
               S  DL+    +     + + S    D  VE      R +EGK+ATDVRLAA+AV
Sbjct  114  APPSLPDLNEEFVMEEDDEEEKESSPVVDPCVE------RVLEGKEATDVRLAAMAV  164



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLS  488
            Q + PS++ALPDECLFEI RR+ G   R +AACVS+RWL L+ S+R SE  ++ +  D  
Sbjct  56   QRQLPSLDALPDECLFEILRRVPG--RRGAAACVSRRWLALLGSIRVSEFGQAAAAADTP  113

Query  489  IADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
                +N      E    ++  EV  D  + R +EGK+ATDVRLAA+AV
Sbjct  114  SLPDLNE-----EFVMEEDKEEVPADRCVDRVLEGKEATDVRLAAMAV  156



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 73/137 (53%), Gaps = 23/137 (17%)
 Frame = +3

Query  267  RKRARITG--PFVV------------EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAA  404
            RKRAR+T   P V             +   + PS++ALPDECLFEI RR+ G R R ++A
Sbjct  29   RKRARVTAVPPCVYAAVAAAAAAAKKQKLRETPSLDALPDECLFEILRRVQGARARGASA  88

Query  405  CVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASND-VEMSPADEDLEVECDGYLSR  581
            CVS+RWL L+  +R SEI R+++     +     G   D   +SP          G   R
Sbjct  89   CVSRRWLALLGGIRASEIKRAEAPAVPDLNQVFVGEDEDEAALSPR--------PGCSER  140

Query  582  SVEGKKATDVRLAAIAV  632
            S+EG+ ATDV L A AV
Sbjct  141  SLEGEGATDVALTAAAV  157



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (61%), Gaps = 6/109 (6%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE-IFRSKSHQDL  485
            + ++PS++ALPDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE +    +    
Sbjct  41   RREEPSLDALPDECLFEVLRRVRGARARCASACVSRRWLALLAGIRASEAVLAPPAPAVP  100

Query  486  SIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
             +  +  G  +D E    D D +        R++EGK+ATD RL A AV
Sbjct  101  DLNQEYLGGEDDDEADLMDHDGDAR-----ERTLEGKEATDARLTAAAV  144



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 2/104 (2%)
 Frame = +3

Query  321  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  500
            PS++ALPDECLFEI RR+ G R R ++A VS+RWL L+  +R+SEI R  +   +   ++
Sbjct  75   PSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEIKREPAAAAVPDLNQ  134

Query  501  VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
            V    ++ E    +  L   C     R +EG++ATDV L A+AV
Sbjct  135  VFVDEDEEEEDEFEVPLGGGCSS--ERCLEGREATDVGLMAVAV  176



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 2/104 (2%)
 Frame = +3

Query  321  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  500
            PS++ALPDECLFEI RR+ G R R ++A VS+RWL L+  +R+SEI R  +   +   ++
Sbjct  75   PSLDALPDECLFEILRRVKGARARCASAAVSRRWLALLGGIRSSEIKREPAAAAVPDLNQ  134

Query  501  VNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
            V    ++ E    +  L   C     R +EG++ATDV L A+AV
Sbjct  135  VFVDEDEEEEDEFEVPLGGGCSS--ERCLEGREATDVGLMAVAV  176



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 11/108 (10%)
 Frame = +3

Query  321  PSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADK  500
            PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ ++ +  D      
Sbjct  66   PSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAADTPSLPD  125

Query  501  VN----GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
            +N        D E SPAD      C   + R +EGK+ATDVRLAA+AV
Sbjct  126  LNEEFVMEEEDKEESPAD-----RC--AVDRVLEGKEATDVRLAAMAV  166



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 6/105 (6%)
 Frame = +3

Query  318  KPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIAD  497
            +PS++A+PDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE   + +   +   +
Sbjct  43   EPSLDAVPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASEAVLAPAAPAVPDLN  102

Query  498  KVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
            +    S D E    D D +        R++EG  ATD RL A AV
Sbjct  103  Q-EYLSEDDEADLMDHDGDAR-----ERTLEGMLATDARLTAAAV  141



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 72/115 (63%), Gaps = 18/115 (16%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR-------S  467
            Q   PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ +       +
Sbjct  59   QLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAAADT  118

Query  468  KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
             S  DL   ++      D E SPAD  ++        R +EGK+ATDVRLAA+AV
Sbjct  119  PSLPDL---NEEFVMEEDNEESPADRCVD--------RVLEGKEATDVRLAAMAV  162



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 72/115 (63%), Gaps = 18/115 (16%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFR-------S  467
            Q   PS++ALPDECLFEI RR+ GGR R ++ACVS+RWL L+ S+R SE+ +       +
Sbjct  162  QLPLPSLDALPDECLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELGQAAAAAADT  221

Query  468  KSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
             S  DL   ++      D E SPAD  ++        R +EGK+ATDVRLAA+AV
Sbjct  222  PSLPDL---NEEFVMEEDNEESPADRCVD--------RVLEGKEATDVRLAAMAV  265



>ref|XP_002986021.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
 gb|EFJ12840.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
Length=647

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 65/125 (52%), Gaps = 21/125 (17%)
 Frame = +3

Query  264  SRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSV  443
            S KR RI      EV     S++ +PDE L  IF  +   R+RSS A V +RWLML++ +
Sbjct  55   SCKRPRIDE----EVGSSCSSMDGIPDEILVVIFGSILSARDRSSCASVCRRWLMLLTHM  110

Query  444  RNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAA  623
               E+ R    +D   A + + A  D                 LSR +EGKKATDVRLAA
Sbjct  111  PRQELPREVCSEDSDDAKQPHWALGD-----------------LSRCLEGKKATDVRLAA  153

Query  624  IAVGT  638
            IAVGT
Sbjct  154  IAVGT  158



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 67/125 (54%), Gaps = 14/125 (11%)
 Frame = +3

Query  261  PSRKRARITGPFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSS  440
            P++KR+R     + +    +  I  LPDEC++EIFR L   R+R   A VSK+WL + + 
Sbjct  55   PNKKRSRHQETSISDKISTQDLISYLPDECIWEIFRYLPSTRDRCCCAAVSKKWLAIQAK  114

Query  441  VRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLA  620
            +R SE F+SK              S+++  S    D       + SR +EGKKA D RLA
Sbjct  115  MRISE-FKSKPK------------SSNIITSALGLDHHKGSQKF-SRCLEGKKANDTRLA  160

Query  621  AIAVG  635
            A+AVG
Sbjct  161  AMAVG  165



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 62/109 (57%), Gaps = 8/109 (7%)
 Frame = +3

Query  327  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  506
            ++ +PDE L  IF  +   R+RSS A V +RWLML++ +   E+ R    +D    D VN
Sbjct  1    MDGIPDEILVVIFGSILSARDRSSCASVCRRWLMLLTHMPRQELPREVCSEDSD--DAVN  58

Query  507  GASNDVEMSPADEDLEVECD-----GYLSRSVEGKKATDVRLAAIAVGT  638
                    +P +E   +E       G LSR +EGKKATDVRLAAIAVGT
Sbjct  59   QPCR-AGSAPQEEVWTLEKQPHWALGDLSRCLEGKKATDVRLAAIAVGT  106



>ref|XP_002974778.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
 gb|EFJ24298.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
Length=630

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 69/137 (50%), Gaps = 27/137 (20%)
 Frame = +3

Query  237  LGHADVY-CPSRKRARITGPFVVEVQEKKPS--IEALPDECLFEIFRRLSGGRERSSAAC  407
            +G+ ++Y  P R         V   ++ +P   I ALPDE L E+FR ++   +R + A 
Sbjct  54   IGNTEIYNAPKRFLPTPPPTAVPAAKKYQPKDLINALPDELLVEVFRYVAAPADRYACAS  113

Query  408  VSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSV  587
            V  RWLML S + +SEI      Q+LS+                DE         L RS+
Sbjct  114  VCTRWLMLQSHLHSSEI--KDDEQELSLGS-------------GDE---------LKRSL  149

Query  588  EGKKATDVRLAAIAVGT  638
            EGK+ATDVRLA +A+GT
Sbjct  150  EGKRATDVRLAVVALGT  166



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 59/101 (58%), Gaps = 14/101 (14%)
 Frame = +3

Query  327  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSE---IFRSKSHQDLSIAD  497
            ++ALPDECLFE+ RR+ G R R ++ACVS+RWL L++ +R SE      + +  DL    
Sbjct  46   LDALPDECLFEVLRRVQGTRARCASACVSRRWLALLAGIRASEAVLAPAAPAVPDL----  101

Query  498  KVNGASNDVEMSPADEDLEVECDG-YLSRSVEGKKATDVRL  617
                  N   +S  DE   ++ DG    R++EG +ATD RL
Sbjct  102  ------NQEYLSEDDEADLMDLDGDARERTLEGMEATDARL  136



>ref|XP_006849175.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
 gb|ERN10756.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
Length=620

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 59/113 (52%), Gaps = 7/113 (6%)
 Frame = +3

Query  303  EVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQD  482
            E  +    I  LPD+CL EIFR L    + S  A VSK+WL+L + +     F    H+ 
Sbjct  60   ETSDSTDLIGRLPDDCLTEIFRFLPVPLDHSLCAMVSKKWLLLQAQMHAFR-FTPTMHEP  118

Query  483  LSIADKVNGASNDVEMSPADEDLEV-ECDGYLSRSVEGKKATDVRLAAIAVGT  638
                  VN      ++       E+ E  GYL+R +EGKKATD RLAAIAVGT
Sbjct  119  -----TVNAMVTTYDVLEPWLSYELGERPGYLTRRLEGKKATDTRLAAIAVGT  166



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 67/110 (61%), Gaps = 7/110 (6%)
 Frame = +3

Query  309  QEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVR--NSEIFRSKSHQD  482
            Q   PS++ALPD CLFEI RR+ GGR R ++ACVS+RWL L+ S+R        + +   
Sbjct  61   QLPLPSLDALPDGCLFEILRRVPGGRGRGASACVSRRWLALLGSIRASELAQAAAAAADT  120

Query  483  LSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAV  632
             ++ D      N+  +   D+D E   D  + R +EGK+ATDVRLAA+AV
Sbjct  121  PALPDL-----NEEFVMEEDKDDETPADSCVERVLEGKEATDVRLAAMAV  165



>ref|XP_001775242.1| predicted protein [Physcomitrella patens]
 gb|EDQ59978.1| predicted protein [Physcomitrella patens]
Length=619

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 65/108 (60%), Gaps = 7/108 (6%)
 Frame = +3

Query  327  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  506
            I  LPDECL EIF  L   ++R +AA V  RWLML S ++  + F+ +S   L  A++V+
Sbjct  23   INDLPDECLQEIFGFLPKVQDRCAAAAVCMRWLMLQSRMQRGD-FKIESASMLGNANEVH  81

Query  507  GASNDVEMSPADEDLEVECD-----GYLSRSVEGKKATDVRLAAIAVG  635
               N++++   D +  V+       G LSR ++GK+ATDV LA +A+G
Sbjct  82   PCGNEIDIV-IDGEPRVQMQPQWVCGELSRILQGKEATDVMLALVAIG  128



>gb|AFZ84555.1| f-box transcription factor, partial [Populus alba]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  3    NDVEMVTCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  43



>gb|AFZ84556.1| f-box transcription factor, partial [Populus tremula]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  3    NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  43



>gb|AEX34712.2| f-box transcription factor, partial [Populus balsamifera]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  3    NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  43



>gb|AEX34715.2| f-box transcription factor, partial [Populus nigra]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  3    NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  43



>gb|AFZ84554.1| f-box transcription factor, partial [Populus maximowiczii]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  3    NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  43



>gb|AEX34714.2| f-box transcription factor, partial [Populus laurifolia]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  3    NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  43



>gb|AEX34713.2| f-box transcription factor, partial [Populus deltoides]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  3    NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  43



>gb|AFZ84553.1| f-box transcription factor, partial [Populus trichocarpa]
Length=285

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  516  NDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            NDVEM   +++ EVE DGYL+RS+EGKKATD+RLAAIAVGT
Sbjct  3    NDVEMVSCEDNGEVESDGYLTRSLEGKKATDMRLAAIAVGT  43



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 56/116 (48%), Gaps = 28/116 (24%)
 Frame = +3

Query  291  PFVVEVQEKKPSIEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSK  470
            P        K  I  LPDEC+ EIFR L   R+R S   VSKRWL L +++R SE+    
Sbjct  63   PVRKSTSSNKDLINTLPDECILEIFRFLPSSRDRCSCVTVSKRWLALQATMRISEL----  118

Query  471  SHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                     K +  S + ++S        EC       ++GK A D RLAAIAVGT
Sbjct  119  ---------KSDPKSRNNKIS--------EC-------LQGKNANDTRLAAIAVGT  150



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 16/79 (20%)
 Frame = +3

Query  264  SRKRARITG----PFVVEVQEK------------KPSIEALPDECLFEIFRRLSGGRERS  395
            SRKRAR+T      F   V+E+             PS++ALPDECLFEI RR+ G R R 
Sbjct  27   SRKRARVTAVPPCAFAEAVEEEVTAASKRQKRREAPSLDALPDECLFEILRRVKGARARC  86

Query  396  SAACVSKRWLMLMSSVRNS  452
            ++  VS+RWL L+ +  +S
Sbjct  87   ASGAVSRRWLALLGAFGDS  105



>ref|XP_002963689.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
 gb|EFJ35560.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
Length=542

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 55/104 (53%), Gaps = 24/104 (23%)
 Frame = +3

Query  327  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  506
            I ALP+E L E+FR ++   +R + A V  RWLML S + +SEI      Q+LS+     
Sbjct  1    INALPEELLVEVFRYVAAPADRYACASVCTRWLMLQSHLHSSEI--KDDEQELSLGS---  55

Query  507  GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
                       DE         L R +EGK+ATDVRLA +A+GT
Sbjct  56   ----------GDE---------LKRILEGKRATDVRLAVVALGT  80



>ref|XP_001783097.1| predicted protein [Physcomitrella patens]
 gb|EDQ52100.1| predicted protein [Physcomitrella patens]
Length=633

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 61/132 (46%), Gaps = 26/132 (20%)
 Frame = +3

Query  261  PSRKRARITGP-----FVVEVQE--KKPSIEALPDECLFEIFRRLSGGRERSSAACVSKR  419
            P  KR R +       F+V V E  +   I  LPDECL EIF  L    +R +AA V  R
Sbjct  26   PKTKRRRTSSKIEDSNFLVAVSELDQVDRINDLPDECLQEIFGFLPKVEDRCAAASVCMR  85

Query  420  WLMLMSSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKK  599
            WLML S +R           D  I   +       + +           G LSR++EG++
Sbjct  86   WLMLQSRMRRG---------DFKIQPNIVCKGGQPQWA----------SGELSRALEGRE  126

Query  600  ATDVRLAAIAVG  635
             TDV+LA +A+G
Sbjct  127  VTDVKLALVAIG  138



>ref|XP_009414462.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=615

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 52/103 (50%), Gaps = 25/103 (24%)
 Frame = +3

Query  327  IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLMSSVRNSEIFRSKSHQDLSIADKVN  506
            I+ LPDECL  IF  L   R+R   A VS++WL L +S+R SE                 
Sbjct  32   IDDLPDECLLLIFSLLPAPRDRCRCAAVSRKWLALQASMRRSEF----------------  75

Query  507  GASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVRLAAIAVG  635
              +N V +  A ++        +SR ++G +A D RLAA+A+G
Sbjct  76   -GANAVLLPEARQE--------MSRCIKGSEANDWRLAAMAIG  109



>ref|XP_010908612.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=569

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 67/127 (53%), Gaps = 27/127 (21%)
 Frame = +3

Query  258  CPSRKRARITGPFVVEVQEKKPS-IEALPDECLFEIFRRLSGGRERSSAACVSKRWLMLM  434
            C +R++ R+    V E   ++P  I+ LP+ECL  IFR L   R+R S A VSK+WL + 
Sbjct  3    CGNREK-RVRCGTVEESNAREPDFIDQLPEECLVLIFRFLPLIRDRCSCAAVSKKWLHVQ  61

Query  435  SSVRNSEIFRSKSHQDLSIADKVNGASNDVEMSPADEDLEVECDGYLSRSVEGKKATDVR  614
            + +R S+ +RS+                D   SP+ E         +SR ++ ++A D R
Sbjct  62   ARMRRSD-WRSE---------------QDEACSPSKE---------ISRCLDMEEANDTR  96

Query  615  LAAIAVG  635
            LAA+A+G
Sbjct  97   LAAMAIG  103



>emb|CDP13516.1| unnamed protein product [Coffea canephora]
Length=540

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  543  EDLEVECDGYLSRSVEGKKATDVRLAAIAVGT  638
            EDL++  DGYLSR +EGKKATDVRLAAIAVGT
Sbjct  22   EDLDIVEDGYLSRCLEGKKATDVRLAAIAVGT  53



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 64/131 (49%), Gaps = 15/131 (11%)
 Frame = +1

Query  76   VVLILLQNLIFFALSLGVSSEKKQ---------PCLLLLITVVMMT-SLLGAHCALQIWA  225
            +++  L +L  FAL  G+S  ++Q          CL  LI+VV  T SL G +  +    
Sbjct  10   LIVFFLVDLAVFALGRGLSGLRRQLGFDQLCSATCLKCLISVVTRTFSLGGRYTQIPRSQ  69

Query  226  SCYLLVMRMFTAPLESGRGLPA--HLLL---KFRKRNHPSKLFLMNASLRSLDVCLGAVK  390
             C+  +  M+       RGL +  H+ L        + P K F MNASLRS  VC+G  +
Sbjct  70   ICFYPLDLMWMCFFHLARGLVSMPHMFLVEKSLSGSSPPLKFFQMNASLRSSGVCMGVQR  129

Query  391  GVPPLVFPSAG  423
             VP LV+ +AG
Sbjct  130  KVPVLVYLNAG  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125