BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS128H10

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248008.1|  PREDICTED: phosphoglucan, water dikinase, ch...  81.3    2e-14   Solanum lycopersicum
ref|XP_009777858.1|  PREDICTED: phosphoglucan, water dikinase, ch...  79.0    1e-13   Nicotiana sylvestris
ref|XP_009599199.1|  PREDICTED: phosphoglucan, water dikinase, ch...  73.2    9e-12   Nicotiana tomentosiformis
emb|CBI39424.3|  unnamed protein product                              70.5    7e-11   Vitis vinifera
ref|XP_002265211.1|  PREDICTED: phosphoglucan, water dikinase, ch...  70.5    8e-11   Vitis vinifera
gb|EYU23932.1|  hypothetical protein MIMGU_mgv1a000391mg              67.8    7e-10   Erythranthe guttata [common monkey flower]
ref|XP_006358813.1|  PREDICTED: phosphoglucan, water dikinase, ch...  67.4    8e-10   Solanum tuberosum [potatoes]
ref|XP_006358812.1|  PREDICTED: phosphoglucan, water dikinase, ch...  67.4    8e-10   Solanum tuberosum [potatoes]
ref|NP_001274870.1|  glucan/water dikinase                            67.4    8e-10   Solanum tuberosum [potatoes]
ref|XP_002518612.1|  chloroplast alpha-glucan water dikinase, put...  65.9    3e-09   Ricinus communis
ref|XP_011000022.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...  65.5    3e-09   Populus euphratica
ref|XP_011074900.1|  PREDICTED: phosphoglucan, water dikinase, ch...  65.5    4e-09   Sesamum indicum [beniseed]
ref|XP_002301739.2|  hypothetical protein POPTR_0002s23550g           64.3    8e-09   
ref|XP_002320442.2|  hypothetical protein POPTR_0014s14510g           63.9    1e-08   
ref|XP_011042749.1|  PREDICTED: phosphoglucan, water dikinase, ch...  63.2    2e-08   Populus euphratica
ref|XP_010493900.1|  PREDICTED: phosphoglucan, water dikinase, ch...  60.1    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010493901.1|  PREDICTED: phosphoglucan, water dikinase, ch...  60.1    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010546803.1|  PREDICTED: phosphoglucan, water dikinase, ch...  59.7    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_010546804.1|  PREDICTED: phosphoglucan, water dikinase, ch...  59.7    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_010454990.1|  PREDICTED: phosphoglucan, water dikinase, ch...  59.3    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010454991.1|  PREDICTED: phosphoglucan, water dikinase, ch...  58.5    5e-07   Camelina sativa [gold-of-pleasure]
emb|CDP10310.1|  unnamed protein product                              58.9    5e-07   Coffea canephora [robusta coffee]
ref|XP_002872212.1|  hypothetical protein ARALYDRAFT_489476           57.8    9e-07   
ref|XP_010673296.1|  PREDICTED: phosphoglucan, water dikinase, ch...  57.8    9e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008393849.1|  PREDICTED: phosphoglucan, water dikinase, ch...  57.4    1e-06   
ref|XP_008393850.1|  PREDICTED: phosphoglucan, water dikinase, ch...  57.4    1e-06   
gb|AAC26245.1|  contains similarity glycosyl hydrolases               57.0    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551754.1|  PREDICTED: phosphoglucan, water dikinase, ch...  57.4    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_009371116.1|  PREDICTED: phosphoglucan, water dikinase, ch...  56.6    2e-06   Pyrus x bretschneideri [bai li]
ref|NP_001119280.1|  phosphoglucan, water dikinase                    56.6    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198009.3|  phosphoglucan, water dikinase                       56.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952076.1|  PREDICTED: phosphoglucan, water dikinase, ch...  56.2    3e-06   Setaria italica
ref|XP_009371117.1|  PREDICTED: phosphoglucan, water dikinase, ch...  56.2    3e-06   Pyrus x bretschneideri [bai li]
ref|XP_006663965.1|  PREDICTED: phosphoglucan, water dikinase, ch...  55.8    4e-06   Oryza brachyantha
ref|XP_006394878.1|  hypothetical protein EUTSA_v10003634mg           55.5    5e-06   
ref|NP_001066613.1|  Os12g0297500                                     55.5    5e-06   
gb|ABG21981.1|  chloroplast alpha-glucan water dikinase isoform 3...  55.1    7e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KJB37917.1|  hypothetical protein B456_006G226300                  55.1    8e-06   Gossypium raimondii
gb|EEE53074.1|  hypothetical protein OsJ_35828                        55.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KJB37918.1|  hypothetical protein B456_006G226300                  54.3    1e-05   Gossypium raimondii
ref|XP_004497421.1|  PREDICTED: phosphoglucan, water dikinase, ch...  53.9    2e-05   
ref|XP_004296959.2|  PREDICTED: phosphoglucan, water dikinase, ch...  53.5    2e-05   Fragaria vesca subsp. vesca
ref|XP_010244064.1|  PREDICTED: phosphoglucan, water dikinase, ch...  53.5    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010069404.1|  PREDICTED: phosphoglucan, water dikinase, ch...  53.5    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010907528.1|  PREDICTED: phosphoglucan, water dikinase, ch...  53.1    3e-05   
ref|XP_007034117.1|  Catalytics,carbohydrate kinases,phosphoglucan    53.1    3e-05   
ref|XP_006286926.1|  hypothetical protein CARUB_v10000070mg           53.1    3e-05   Capsella rubella
ref|XP_004497422.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.4    5e-05   Cicer arietinum [garbanzo]
ref|XP_010424348.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    6e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009416602.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    7e-05   
ref|XP_007142602.1|  hypothetical protein PHAVU_007G001400g           52.0    7e-05   Phaseolus vulgaris [French bean]
gb|KHN37254.1|  Phosphoglucan, water dikinase, chloroplastic          52.0    7e-05   Glycine soja [wild soybean]
gb|KFK26410.1|  hypothetical protein AALP_AA8G245000                  51.6    8e-05   Arabis alpina [alpine rockcress]
ref|XP_006493516.1|  PREDICTED: phosphoglucan, water dikinase, ch...  51.6    1e-04   Citrus sinensis [apfelsine]
ref|XP_010107197.1|  Phosphoglucan, water dikinase                    51.2    1e-04   
ref|XP_006421075.1|  hypothetical protein CICLE_v10004968mg           50.8    1e-04   
gb|KDO57834.1|  hypothetical protein CISIN_1g015140mg                 50.8    1e-04   Citrus sinensis [apfelsine]
ref|XP_006421076.1|  hypothetical protein CICLE_v10004968mg           50.4    1e-04   
ref|XP_006421074.1|  hypothetical protein CICLE_v10004968mg           50.4    2e-04   
gb|AAU93516.1|  chloroplast alpha-glucan water dikinase isoform 3     50.8    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KHF99077.1|  Phosphoglucan, water dikinase, chloroplastic -lik...  50.8    2e-04   Gossypium arboreum [tree cotton]
gb|KJB71921.1|  hypothetical protein B456_011G147600                  50.8    2e-04   Gossypium raimondii
gb|KJB71923.1|  hypothetical protein B456_011G147600                  50.8    2e-04   Gossypium raimondii
gb|KJB71922.1|  hypothetical protein B456_011G147600                  50.8    2e-04   Gossypium raimondii
ref|XP_008454006.1|  PREDICTED: phosphoglucan, water dikinase, ch...  50.1    3e-04   Cucumis melo [Oriental melon]
emb|CDY65142.1|  BnaC02g48400D                                        50.1    3e-04   Brassica napus [oilseed rape]
ref|XP_006589801.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...  49.7    4e-04   
emb|CDY05529.1|  BnaA02g31620D                                        49.7    4e-04   
ref|XP_006845104.1|  hypothetical protein AMTR_s00005p00168970        49.7    4e-04   Amborella trichopoda
ref|XP_009129923.1|  PREDICTED: phosphoglucan, water dikinase, ch...  49.7    4e-04   Brassica rapa
gb|KEH27294.1|  phosphoglucan, water dikinase                         49.3    5e-04   Medicago truncatula
ref|XP_008222722.1|  PREDICTED: phosphoglucan, water dikinase, ch...  49.3    6e-04   Prunus mume [ume]
ref|XP_002453659.1|  hypothetical protein SORBIDRAFT_04g010020        48.9    6e-04   Sorghum bicolor [broomcorn]
gb|EEC69133.1|  hypothetical protein OsI_38056                        48.9    7e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004152111.1|  PREDICTED: phosphoglucan, water dikinase, ch...  48.9    7e-04   
gb|KDP32558.1|  hypothetical protein JCGZ_13108                       48.5    8e-04   Jatropha curcas
ref|XP_010228078.1|  PREDICTED: phosphoglucan, water dikinase, ch...  48.5    8e-04   Brachypodium distachyon [annual false brome]
gb|KGN53052.1|  hypothetical protein Csa_4G012480                     48.5    8e-04   Cucumis sativus [cucumbers]



>ref|XP_004248008.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Solanum 
lycopersicum]
Length=1202

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +3

Query  267  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQV  446
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K S+ E ++L+  LDHQV
Sbjct  46   LTLLPATNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKSSS-EKVQLRFRLDHQV  100

Query  447  EYGEHIAIMGSTKELGSW  500
            EYGEHIA++GS KELGSW
Sbjct  101  EYGEHIAVLGSAKELGSW  118



>ref|XP_009777858.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
sylvestris]
Length=1200

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 54/120 (45%), Positives = 75/120 (63%), Gaps = 10/120 (8%)
 Frame = +3

Query  159  MDSLRALH-----NAKYAYPYRHIPSARRTSLGKL-KFSEPRLILEPQGIPGSIMNRPTR  320
            MDSL   H     NAK   P+  I S + T L +L + S    IL P+   G +M+   R
Sbjct  1    MDSLHFTHCYSTLNAKKRQPHNQI-SKQFTVLPQLSQTSVKNSILLPRKKLGFLMDYKGR  59

Query  321  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            G  +  + AVSSVETRE ++KGK  +++ E ++L++ L HQVE+GEHIA++GS KELGSW
Sbjct  60   G--TGIVRAVSSVETREKQQKGKNNKNS-EKVQLRVRLKHQVEFGEHIAVLGSAKELGSW  116



>ref|XP_009599199.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=1202

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 8/120 (7%)
 Frame = +3

Query  159  MDSLRALH-----NAKYAYPYRHIPSARRTSLGKLKFSEPR-LILEPQGIPGSIMNRPTR  320
            MDSL   +     NAK   P+ HI S + T L +L  +  +  IL P+     +M+   +
Sbjct  1    MDSLHFSYCYSTLNAKKKQPHNHI-SKKFTVLPQLSHTSVKNSILFPRKKLVFLMDCRIK  59

Query  321  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            G  +  + A SSVE RE ++KGK  +++ E ++L++ L HQVE+GEHIA++GS KELGSW
Sbjct  60   GRGTGIVRAASSVEIREKQQKGKNNKNS-EKVQLRVRLKHQVEFGEHIAVLGSAKELGSW  118



>emb|CBI39424.3| unnamed protein product [Vitis vinifera]
Length=1149

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 50/120 (42%), Positives = 66/120 (55%), Gaps = 21/120 (18%)
 Frame = +3

Query  159  MDSLRALH---NAKYAYPYR---HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTR  320
            MDSLR L    +A+Y Y  R     P   R++     F +PR+         S   R   
Sbjct  1    MDSLRVLQCSTSAQYQYHLRKQLEFPLQCRSN-----FLKPRI---------SHSFRNLG  46

Query  321  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
             L+ R +C VSSV TRE EKK +  R+    +KL I L HQV++GEH+ ++GSTKELGSW
Sbjct  47   FLNRRILCGVSSVLTREEEKKMR-TRTGSGKVKLSILLKHQVKFGEHVVMLGSTKELGSW  105



>ref|XP_002265211.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Vitis 
vinifera]
Length=1188

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 50/120 (42%), Positives = 66/120 (55%), Gaps = 21/120 (18%)
 Frame = +3

Query  159  MDSLRALH---NAKYAYPYR---HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTR  320
            MDSLR L    +A+Y Y  R     P   R++     F +PR+         S   R   
Sbjct  1    MDSLRVLQCSTSAQYQYHLRKQLEFPLQCRSN-----FLKPRI---------SHSFRNLG  46

Query  321  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
             L+ R +C VSSV TRE EKK +  R+    +KL I L HQV++GEH+ ++GSTKELGSW
Sbjct  47   FLNRRILCGVSSVLTREEEKKMR-TRTGSGKVKLSILLKHQVKFGEHVVMLGSTKELGSW  105



>gb|EYU23932.1| hypothetical protein MIMGU_mgv1a000391mg [Erythranthe guttata]
Length=1190

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 45/71 (63%), Gaps = 7/71 (10%)
 Frame = +3

Query  309  RPTRGLSSR-TICAVSSVETREVEKKG------KEKRSAHENLKLKIWLDHQVEYGEHIA  467
            R TR  S R T+ AVSS ETRE E K       + K+S    + LK+ L HQVEYGEH+A
Sbjct  51   RHTRKASVRMTVSAVSSTETREKESKNENNKERQSKKSGGNKVNLKLRLAHQVEYGEHVA  110

Query  468  IMGSTKELGSW  500
            I+GS KE GSW
Sbjct  111  ILGSAKEFGSW  121



>ref|XP_006358813.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Solanum tuberosum]
Length=1202

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 7/81 (9%)
 Frame = +3

Query  267  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  437
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  438  HQVEYGEHIAIMGSTKELGSW  500
            HQVEYGEHIA++GS KELGSW
Sbjct  98   HQVEYGEHIAVLGSAKELGSW  118



>ref|XP_006358812.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Solanum tuberosum]
Length=1206

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 7/81 (9%)
 Frame = +3

Query  267  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  437
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  438  HQVEYGEHIAIMGSTKELGSW  500
            HQVEYGEHIA++GS KELGSW
Sbjct  98   HQVEYGEHIAVLGSAKELGSW  118



>ref|NP_001274870.1| glucan/water dikinase [Solanum tuberosum]
 gb|ACZ66259.1| glucan/water dikinase [Solanum tuberosum]
Length=1202

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 54/81 (67%), Gaps = 7/81 (9%)
 Frame = +3

Query  267  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  437
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  438  HQVEYGEHIAIMGSTKELGSW  500
            HQVEYGEHIA++GS KELGSW
Sbjct  98   HQVEYGEHIAVLGSAKELGSW  118



>ref|XP_002518612.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
 gb|EEF43754.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
Length=1174

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 63/118 (53%), Gaps = 18/118 (15%)
 Frame = +3

Query  159  MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS-R  335
            MDSLR LH +  +     IPS  R       F  P +            + P R  SS R
Sbjct  1    MDSLRVLHLSNSSPKIIQIPS--RNQFHPFVFFNPGI------------SFPLRQSSSFR  46

Query  336  TI-CAVSSVETR--EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            TI C VSS ETR  E + K  + +S    ++L + LDHQVEYGEH+AI+GSTKELG W
Sbjct  47   TIICGVSSTETRGEEKKMKKTKSKSGRGKVRLFVHLDHQVEYGEHVAILGSTKELGLW  104



>ref|XP_011000022.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Populus euphratica]
Length=1172

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (50%), Gaps = 31/123 (25%)
 Frame = +3

Query  159  MDSLRALHNA--------KYAYPYRHIPSARR-TSLGKLKFSEPRLILEPQGIPGSIMNR  311
            MDSLR LH          ++ + + H   AR         F  PR+ +            
Sbjct  1    MDSLRLLHFVIPTPTRRNQFHHSHSHHKLARPPGQCATTTFFNPRISI------------  48

Query  312  PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  491
            P RG   R +CAVSS +TRE E+       A    KL + +DHQVE+GEHI I+GS+KE+
Sbjct  49   PIRG---RIVCAVSSTQTREEER-------ATMKSKLNVRIDHQVEFGEHIVIVGSSKEM  98

Query  492  GSW  500
            GSW
Sbjct  99   GSW  101



>ref|XP_011074900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Sesamum 
indicum]
Length=1209

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 6/61 (10%)
 Frame = +3

Query  336  TICAVSSVETREVEKKG------KEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            T+ AVSSVETRE E K       + K S  + +KLK+ LDHQVE+GEH+AI+GS  ELGS
Sbjct  66   TVSAVSSVETREEEMKKDKKKKRQSKTSGADKVKLKVRLDHQVEFGEHVAILGSAIELGS  125

Query  498  W  500
            W
Sbjct  126  W  126



>ref|XP_002301739.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
 gb|EEE81012.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
Length=1138

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 44/119 (37%), Positives = 60/119 (50%), Gaps = 17/119 (14%)
 Frame = +3

Query  159  MDSLRALHNAKYAY--PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  332
            MDSLRAL  + + Y  P R+            +F     +    G      N        
Sbjct  1    MDSLRALLRSDFIYLTPTRN------------QFQSLHKVAPAGGTSTPFFNPRISIPIR  48

Query  333  RT-ICAVSSVETREVEKKGKEKRSAHE--NLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            R  +C VSS ++RE EK  ++ RS  E   ++L + +DHQVE+GE I I+GSTKELGSW
Sbjct  49   RRIVCGVSSTQSREQEKAMRKSRSRLERGKVRLNVRVDHQVEFGEQIVILGSTKELGSW  107



>ref|XP_002320442.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
 gb|EEE98757.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
Length=1159

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 62/123 (50%), Gaps = 31/123 (25%)
 Frame = +3

Query  159  MDSLRALHNA--------KYAYPYRHIPSARRTSL-GKLKFSEPRLILEPQGIPGSIMNR  311
            MDSLR LH          ++ + + H   AR   L     F  PR+ +            
Sbjct  1    MDSLRLLHFVTPTPTRRNQFHHSHSHHKLARPPGLRATTTFFNPRISI------------  48

Query  312  PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  491
            P RG   R +CAVSS +TRE E+  K+         L + +DHQVE+GE+I I+GS+KE+
Sbjct  49   PIRG---RIVCAVSSTQTREEERATKKSM-------LNVRIDHQVEFGENIVIVGSSKEM  98

Query  492  GSW  500
            GSW
Sbjct  99   GSW  101



>ref|XP_011042749.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Populus euphratica]
Length=1178

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 44/119 (37%), Positives = 59/119 (50%), Gaps = 17/119 (14%)
 Frame = +3

Query  159  MDSLRALHNAKYAY--PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  332
            MDSLRAL  + + Y  P R+            +F     +    G      N        
Sbjct  1    MDSLRALLRSDFMYLTPTRN------------QFQSLHKVAPAGGTSTPFFNPRISIPIR  48

Query  333  RT-ICAVSSVETREVEKKGKEKRSAHE--NLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            R  +C VSS ++RE EK  K+ RS  E   ++L + +DHQVE+GE I I+GS KELGSW
Sbjct  49   RRIVCGVSSPQSREQEKAMKKSRSRSERGKVRLNVRVDHQVEFGEQIVILGSDKELGSW  107



>ref|XP_010493900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Camelina sativa]
Length=1194

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +3

Query  318  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            R  SSR  C  SS  T  +E++ K+K  +   +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  44   RNSSSRLTCTASSSST--IEEQRKKKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGS  101

Query  498  W  500
            W
Sbjct  102  W  102



>ref|XP_010493901.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Camelina sativa]
Length=1194

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = +3

Query  318  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            R  SSR  C  SS  T  +E++ K+K  +   +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  44   RNSSSRLTCTASSSST--IEEQRKKKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGS  101

Query  498  W  500
            W
Sbjct  102  W  102



>ref|XP_010546803.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=1176

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +3

Query  255  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVE--KKGKEKRSAHENLKLKI  428
            S PRL+   + +P     R     S R  C VS+  +  +E  ++ K+ RS  + + LK+
Sbjct  21   SLPRLVFFSRRVPFGRSQRFNHS-SCRITCTVSASASSTIEEQRQKKDDRSG-KKVMLKL  78

Query  429  WLDHQVEYGEHIAIMGSTKELGSW  500
             LDHQV++GEH+AI+GS+KE+GSW
Sbjct  79   RLDHQVKFGEHVAILGSSKEIGSW  102



>ref|XP_010546804.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=1174

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +3

Query  255  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVE--KKGKEKRSAHENLKLKI  428
            S PRL+   + +P     R     S R  C VS+  +  +E  ++ K+ RS  + + LK+
Sbjct  21   SLPRLVFFSRRVPFGRSQRFNHS-SCRITCTVSASASSTIEEQRQKKDDRSG-KKVMLKL  78

Query  429  WLDHQVEYGEHIAIMGSTKELGSW  500
             LDHQV++GEH+AI+GS+KE+GSW
Sbjct  79   RLDHQVKFGEHVAILGSSKEIGSW  102



>ref|XP_010454990.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=1182

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  318  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            R  SSR  C  SS  +  +E++ K+K  +   +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  44   RNSSSRLTCTASSSSSSTIEEQRKKKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGS  103

Query  498  W  500
            W
Sbjct  104  W  104



>ref|XP_010454991.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=895

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +3

Query  318  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            R  SSR  C  SS  +  +E++ K+K  +   +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  44   RNSSSRLTCTASSSSSSTIEEQRKKKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGS  103

Query  498  W  500
            W
Sbjct  104  W  104



>emb|CDP10310.1| unnamed protein product [Coffea canephora]
Length=1144

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 4/62 (6%)
 Frame = +3

Query  327  SSRTICAVSSVETR----EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  494
            SSR +  VSSVET     + +KK K+ R   E + +K+ L+HQVE+GEHIA++GS KELG
Sbjct  5    SSRILSGVSSVETSRKEEKKQKKTKQSRQGQEKVLMKVLLNHQVEFGEHIALLGSAKELG  64

Query  495  SW  500
            SW
Sbjct  65   SW  66



>ref|XP_002872212.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48471.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
Length=1193

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = +3

Query  210  HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  389
            H  S+  T + +   S P+L+   + +  S  +   R  SSR  C  +S  T  +E++ K
Sbjct  7    HCCSSPFTFITRNTSSLPKLVNFTRRVNLSHQSHRLRNSSSRLTCTATSSST--IEEQRK  64

Query  390  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            +K  +   +KL + LD+QV++GEH+A+ GS KE+GSW
Sbjct  65   KKDGSGTKVKLNVRLDYQVKFGEHVAMFGSAKEIGSW  101



>ref|XP_010673296.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673297.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1189

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = +3

Query  330  SRTICAVSSVETREVEK--KGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            S+  C +SSV+TRE E+     + RS  EN  ++L I L HQV++GE + I GS+KE+GS
Sbjct  52   SQIFCGISSVQTREEEEIMNNNKTRSRRENGKVQLSILLKHQVQFGECVVIFGSSKEMGS  111

Query  498  W  500
            W
Sbjct  112  W  112



>ref|XP_008393849.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Malus domestica]
Length=965

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  327  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + + IC VSS ++ + E+K    +S    ++L I LDHQVE+GE +AI+GS KELGSW
Sbjct  56   TCQIICGVSSAQSID-EEKDSMMKSESGKVRLNIRLDHQVEFGESVAILGSVKELGSW  112



>ref|XP_008393850.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Malus domestica]
Length=937

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  327  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + + IC VSS ++ + E+K    +S    ++L I LDHQVE+GE +AI+GS KELGSW
Sbjct  56   TCQIICGVSSAQSID-EEKDSMMKSESGKVRLNIRLDHQVEFGESVAILGSVKELGSW  112



>gb|AAC26245.1| contains similarity glycosyl hydrolases [Arabidopsis thaliana]
Length=491

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = +3

Query  201  PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEK  380
            P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +E+
Sbjct  12   PFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--IEE  62

Query  381  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSW
Sbjct  63   QRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSW  102



>ref|XP_010551754.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Tarenaya hassleriana]
Length=1183

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 10/94 (11%)
 Frame = +3

Query  225  RRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEK--R  398
            R +SL +L     R+  +  G      N P    S R  C VS+  +  +E++ K K   
Sbjct  18   RSSSLPRLGLFSRRVRFDRSGR----FNYP----SCRITCTVSASASSTIEEQRKSKGDD  69

Query  399  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
             + + +KL + LDHQVE+GEH++I GS++E+GSW
Sbjct  70   KSGKTVKLNLRLDHQVEFGEHVSIFGSSEEIGSW  103



>ref|XP_009371116.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=1185

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  327  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + + IC VSS ++ + EK    K  + + ++L I LDHQVE+GE +AI+GS KELGSW
Sbjct  56   TCQIICGVSSAQSIDEEKDNMMKPESGK-VRLNIRLDHQVEFGESVAILGSVKELGSW  112



>ref|NP_001119280.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93556.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=865

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = +3

Query  201  PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEK  380
            P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +E+
Sbjct  12   PFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--IEE  62

Query  381  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSW
Sbjct  63   QRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSW  102



>ref|NP_198009.3| phosphoglucan, water dikinase [Arabidopsis thaliana]
 sp|Q6ZY51.1|PWD_ARATH RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAG25776.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93555.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=1196

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = +3

Query  201  PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEK  380
            P+  I     +SL       PRL+     +  S  +   R  +SR  C  +S  T  +E+
Sbjct  12   PFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--IEE  62

Query  381  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSW
Sbjct  63   QRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSW  102



>ref|XP_004952076.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Setaria italica]
Length=1206

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  318  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            RG S R   A S+ +     K+ K  + + + ++L++ LDHQV++GEH+ I+GSTKE+GS
Sbjct  47   RGFSCRAGSAASAAQRT---KEKKRTKPSKDRVQLRVCLDHQVKFGEHVGIIGSTKEVGS  103

Query  498  W  500
            W
Sbjct  104  W  104



>ref|XP_009371117.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=965

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  327  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + + IC VSS ++ + EK    K  + + ++L I LDHQVE+GE +AI+GS KELGSW
Sbjct  56   TCQIICGVSSAQSIDEEKDNMMKPESGK-VRLNIRLDHQVEFGESVAILGSVKELGSW  112



>ref|XP_006663965.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Oryza brachyantha]
Length=1206

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 48/80 (60%), Gaps = 8/80 (10%)
 Frame = +3

Query  279  PQGIPGSIMNRPT------RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDH  440
            P+ + G++  R        RG S R   A S+ E   +++K +   S    + L+++L+H
Sbjct  27   PRVVAGAMFRREAIALPGRRGFSCRGGSAASAAE--RIKEKQRGDSSKKPLVHLQVYLEH  84

Query  441  QVEYGEHIAIMGSTKELGSW  500
            QV++GEHI ++GSTKELGSW
Sbjct  85   QVKFGEHIGVIGSTKELGSW  104



>ref|XP_006394878.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
 gb|ESQ32164.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
Length=880

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 4/82 (5%)
 Frame = +3

Query  255  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWL  434
            S PR++   + +     ++  R   SR  CA SS     +E++ K+K  +   +KL + L
Sbjct  21   SLPRIVNFTRSVHLGRQSQRLRNSPSRLTCAASST----IEEQRKKKDGSGTKVKLNVRL  76

Query  435  DHQVEYGEHIAIMGSTKELGSW  500
            +HQV +GEH+A+ GS KE+GSW
Sbjct  77   NHQVNFGEHVAMFGSAKEIGSW  98



>ref|NP_001066613.1| Os12g0297500 [Oryza sativa Japonica Group]
 sp|Q2QTC2.2|PWD_ORYSJ RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA97816.2| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29632.1| Os12g0297500 [Oryza sativa Japonica Group]
Length=1206

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 9/85 (11%)
 Frame = +3

Query  267  LILEPQGIPGSIMNR-------PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLK  425
            L+L P G+   ++ R         RG + R   A S+ E R  EKK ++  S    + L+
Sbjct  21   LVLPPPGVGAGVLLRRGAMALPGRRGFACRGRSAASAAE-RTKEKKRRDS-SKQPLVHLQ  78

Query  426  IWLDHQVEYGEHIAIMGSTKELGSW  500
            + L+HQV++GEH+ I+GSTKELGSW
Sbjct  79   VCLEHQVKFGEHVGIIGSTKELGSW  103



>gb|ABG21981.1| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
Length=728

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 9/85 (11%)
 Frame = +3

Query  267  LILEPQGIPGSIMNR-------PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLK  425
            L+L P G+   ++ R         RG + R   A S+ E R  EKK ++  S    + L+
Sbjct  21   LVLPPPGVGAGVLLRRGAMALPGRRGFACRGRSAASAAE-RTKEKKRRDS-SKQPLVHLQ  78

Query  426  IWLDHQVEYGEHIAIMGSTKELGSW  500
            + L+HQV++GEH+ I+GSTKELGSW
Sbjct  79   VCLEHQVKFGEHVGIIGSTKELGSW  103



>gb|KJB37917.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=1161

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +3

Query  339  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + AVS+  T E E+K + K SA   + L I LDHQV+YGEH+  +GS KELGSW
Sbjct  53   VFAVSAAPTIE-EEKTRMKLSAPGKVCLNICLDHQVKYGEHVVFLGSAKELGSW  105



>gb|EEE53074.1| hypothetical protein OsJ_35828 [Oryza sativa Japonica Group]
Length=1188

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +3

Query  318  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            RG + R   A S+ E R  EKK ++  S    + L++ L+HQV++GEH+ I+GSTKELGS
Sbjct  7    RGFACRGRSAASAAE-RTKEKKRRDS-SKQPLVHLQVCLEHQVKFGEHVGIIGSTKELGS  64

Query  498  W  500
            W
Sbjct  65   W  65



>gb|KJB37918.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=872

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +3

Query  339  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + AVS+  T E E+K + K SA   + L I LDHQV+YGEH+  +GS KELGSW
Sbjct  53   VFAVSAAPTIE-EEKTRMKLSAPGKVCLNICLDHQVKYGEHVVFLGSAKELGSW  105



>ref|XP_004497421.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=1212

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  330  SRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            S T+  +S+  + + + +  +     EN+ L + LDHQV++G+H+A++GSTK+LGSW
Sbjct  47   SHTLPLLSAFSSTQTQPRKSKNNIKIENVHLHVRLDHQVQFGDHVALLGSTKQLGSW  103



>ref|XP_004296959.2| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=1191

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 5/63 (8%)
 Frame = +3

Query  327  SSRTICAVS-----SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  491
            S R +C V      S+E  +  K   + +  H  + L I LDHQVE+GE IA++GS+KEL
Sbjct  57   SLRILCGVGVSPPQSIEEEKETKMKSKSKDRHGKVWLNIRLDHQVEFGESIAVLGSSKEL  116

Query  492  GSW  500
            GSW
Sbjct  117  GSW  119



>ref|XP_010244064.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Nelumbo nucifera]
 ref|XP_010244065.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=1197

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = +3

Query  327  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            SSR  C VSSVE R+ EKK + ++   + L L + L+HQVE+GEH+A++GS+KELGSW
Sbjct  59   SSRITCGVSSVEERKEEKKMESRKRRGKVL-LSVRLNHQVEFGEHVAMLGSSKELGSW  115



>ref|XP_010069404.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57742.1| hypothetical protein EUGRSUZ_H00494 [Eucalyptus grandis]
Length=1189

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +3

Query  315  TRGLSSRTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKE  488
             RG  S  +  VSS ETRE EKKGK+ +S    E + L + LDHQVE+GE +AI+GS +E
Sbjct  59   ARGRPSTVVRGVSSTETREGEKKGKKIKSKPGGEKVHLSVRLDHQVEFGESVAILGSARE  118

Query  489  LGSW  500
            LGSW
Sbjct  119  LGSW  122



>ref|XP_010907528.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Elaeis 
guineensis]
Length=926

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +3

Query  372  VEKKGKEKRSA---HENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            VE+  +EKR A      +++++ LDHQVE+GEH+A++GSTKELG W
Sbjct  57   VERIEEEKRKASGKRRKVRMRVQLDHQVEFGEHVAVLGSTKELGLW  102



>ref|XP_007034117.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
 gb|EOY05043.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
Length=1180

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +3

Query  345  AVSSVETREVEKKGKEKR--SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            AVSS  TRE EKK  + +  S    + L + LDHQVE+GEH+AI+GSTKELGSW
Sbjct  53   AVSSTLTREEEKKKMKAKPKSGRGKVGLNVCLDHQVEFGEHVAILGSTKELGSW  106



>ref|XP_006286926.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
 gb|EOA19824.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
Length=1195

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +3

Query  318  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  497
            R  SSR  C+ +S  +   E++ KE  S  + +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  45   RNSSSRLTCSAASSSSTIEEQRKKEDGSGTK-VKLNVRLDHQVNFGEHVAMFGSAKEIGS  103

Query  498  W  500
            W
Sbjct  104  W  104



>ref|XP_004497422.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=1180

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  330  SRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            S T+  +S+  + + + +  +     EN+ L + LDHQV++G+H+A++GSTK+LGSW
Sbjct  47   SHTLPLLSAFSSTQTQPRKSKNNIKIENVHLHVRLDHQVQFGDHVALLGSTKQLGSW  103



>ref|XP_010424348.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Camelina sativa]
Length=1126

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  375  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            E++ K+K  +   +KL + LDHQV++GEH+A+ GS KE+GSW
Sbjct  50   EEQRKKKDGSGTKVKLNVRLDHQVQFGEHVAMFGSAKEIGSW  91



>ref|XP_009416602.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=1264

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  LKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            +++++ LDHQVE+GEH+A++GSTKELGSW
Sbjct  158  VRVRVRLDHQVEFGEHVAVLGSTKELGSW  186



>ref|XP_007142602.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
 gb|ESW14596.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
Length=952

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 6/60 (10%)
 Frame = +3

Query  339  ICAVSSVETREVEKKGKEKR------SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + AVSS E++  +++ +E        S    ++L++ LDHQV++G+H+AI GSTKELGSW
Sbjct  54   LSAVSSPESQTRDEQQQEGDNNPSSVSMDRKVRLQVRLDHQVQFGDHVAIRGSTKELGSW  113



>gb|KHN37254.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=1179

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 8/62 (13%)
 Frame = +3

Query  339  ICAVSS---VETR-----EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  494
            I AVSS    +TR     E E++  + +S    ++L++ LDHQV++G+H+ I GSTKELG
Sbjct  52   ISAVSSSPQTQTRDDQDQEHEQEQGKNKSLKNKVRLQVRLDHQVQFGDHVVIRGSTKELG  111

Query  495  SW  500
            SW
Sbjct  112  SW  113



>gb|KFK26410.1| hypothetical protein AALP_AA8G245000 [Arabis alpina]
Length=1180

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = +3

Query  318  RGLSSRTIC-AVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  494
            R   SR  C A SS  T E ++K   K ++   +KLK+ LDHQV +GEH+A+ GS KE+G
Sbjct  42   RNSHSRLTCTASSSSSTIEDQRK---KDASGTKVKLKVRLDHQVNFGEHVAMFGSAKEIG  98

Query  495  SW  500
            SW
Sbjct  99   SW  100



>ref|XP_006493516.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Citrus sinensis]
Length=1190

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            N+++   LDHQVE+GEH+ I+GSTKELGSW
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSW  117



>ref|XP_010107197.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14221.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=894

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  399  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            S  + ++L I LDHQV++GEH+ I+GSTKELGSW
Sbjct  5    SGRDKVQLSIRLDHQVKFGEHVVILGSTKELGSW  38



>ref|XP_006421075.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34315.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=445

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            N+++   LDHQVE+GEH+ I+GSTKELGSW
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSW  117



>gb|KDO57834.1| hypothetical protein CISIN_1g015140mg [Citrus sinensis]
Length=412

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            N+++   LDHQVE+GEH+ I+GSTKELGSW
Sbjct  10   NVRISFRLDHQVEFGEHVVILGSTKELGSW  39



>ref|XP_006421076.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34316.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=356

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            N+++   LDHQVE+GEH+ I+GSTKELGSW
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSW  117



>ref|XP_006421074.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34314.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=353

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            N+++   LDHQVE+GEH+ I+GSTKELGSW
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSW  117



>gb|AAU93516.1| chloroplast alpha-glucan water dikinase isoform 3 [Arabidopsis 
thaliana]
Length=1196

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +3

Query  201  PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEK  380
            P+  I     +SL       PRL+     +  S  +   R  +SR     +S  T  +E+
Sbjct  12   PFTFITRNSSSSL-------PRLVNITHRVNLSHQSHRLRNSNSRLTRTATSSST--IEE  62

Query  381  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            + K+K  +   ++L + LDHQV +G+H+A+ GS KE+GSW
Sbjct  63   QRKKKDGSGTKVRLNVRLDHQVNFGDHVAMFGSAKEIGSW  102



>gb|KHF99077.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1169

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 61/120 (51%), Gaps = 22/120 (18%)
 Frame = +3

Query  165  SLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQ-GIPGSI---MNRPTRGLSS  332
            SLR+LH   +  P R           +LKF     I  P+   P      +NR  R  S 
Sbjct  5    SLRSLH---FQIPARK----------QLKFLPDATIFSPRISFPFPFPPGINR-HRKHSH  50

Query  333  RTICAVSSVETREVEKKGKEKR----SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
              + AVSS  TRE EKK K  +    S    + L + LDHQV++GEH+ I+GSTKELGSW
Sbjct  51   SLVFAVSSTPTREEEKKKKMTKVKPMSGSGKVGLNVCLDHQVQFGEHVVILGSTKELGSW  110



>gb|KJB71921.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  399  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            S    + L I LDHQV++GEH+ I+GSTKELGSW
Sbjct  77   SGSGKVGLNICLDHQVQFGEHVVILGSTKELGSW  110



>gb|KJB71923.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1127

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  399  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            S    + L I LDHQV++GEH+ I+GSTKELGSW
Sbjct  18   SGSGKVGLNICLDHQVQFGEHVVILGSTKELGSW  51



>gb|KJB71922.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  399  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            S    + L I LDHQV++GEH+ I+GSTKELGSW
Sbjct  77   SGSGKVGLNICLDHQVQFGEHVVILGSTKELGSW  110



>ref|XP_008454006.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Cucumis melo]
Length=1237

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +3

Query  327  SSRTICAVSSVETREVEKKGKE----KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  494
            S R +C VSS     + +  ++    K  +   + LK+ LDHQV++GE + I+GS++ELG
Sbjct  55   SRRIVCGVSSASQETIREDEEQMMTGKLGSGGKVLLKVRLDHQVQFGESVVILGSSEELG  114

Query  495  SW  500
            SW
Sbjct  115  SW  116



>emb|CDY65142.1| BnaC02g48400D [Brassica napus]
Length=1315

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 4/60 (7%)
 Frame = +3

Query  327  SSRTICAVSS--VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            S R  C+ SS  +E + + K G     + + +KL + L+HQV++GEH+AI GS +E+GSW
Sbjct  41   SRRLTCSASSSTIEEQRMNKDGS--GPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSW  98



>ref|XP_006589801.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Glycine max]
Length=1186

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +3

Query  384  GKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            GK K S    ++L++ LDHQV++G+H+ I GSTKELGSW
Sbjct  78   GKNK-SLKNKVRLQVRLDHQVQFGDHVVIRGSTKELGSW  115



>emb|CDY05529.1| BnaA02g31620D [Brassica napus]
Length=1312

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 14/104 (13%)
 Frame = +3

Query  192  YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  371
            Y  P+  I   R +SL +L    PR I           +  ++  S R +   +S  T E
Sbjct  9    YTSPFASI--TRNSSLPRLLHFTPRAI-----------HIRSQSDSRRLLTCSASSSTIE  55

Query  372  VEKKGKEKRS-AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
              +K K+    + + +KL + L+HQV++GEH+AI GS +E+GSW
Sbjct  56   EHRKNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSW  99



>ref|XP_006845104.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
 gb|ERN06779.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
Length=1176

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 55/114 (48%), Gaps = 5/114 (4%)
 Frame = +3

Query  159  MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRT  338
            M S R L +   +  Y     +  +SL  LK   PR  L P    GS  +          
Sbjct  1    MASFR-LFSCSSSSLYTDYDESSSSSLHILKL-RPRFFLLP-CFEGSRFSSHVLSRRLYP  57

Query  339  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            +    SV  RE +    +++     + ++I LDHQV++GEHIAI GS+KELGSW
Sbjct  58   VVCRGSVSEREAKMAPVDRKKG--KVAIRIRLDHQVKFGEHIAITGSSKELGSW  109



>ref|XP_009129923.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Brassica rapa]
Length=1156

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 14/104 (13%)
 Frame = +3

Query  192  YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  371
            Y  P+  I   R +SL +L    PR I           +  ++  S R +   +S  T E
Sbjct  9    YTSPFASI--TRNSSLPRLLHFTPRAI-----------HIRSQSDSRRLLTCSASSSTIE  55

Query  372  VEKKGKEKRS-AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
              +K K+    + + +KL + L+HQV++GEH+AI GS +E+GSW
Sbjct  56   EHRKNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSW  99



>gb|KEH27294.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=1202

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  336  TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            ++ A SS +T+        K+    N+ L + LDHQV++G+H+ ++GSTK+LGSW
Sbjct  63   SVAASSSTQTQP-RNNTNNKKEEDINVHLHLRLDHQVQFGDHVVLLGSTKQLGSW  116



>ref|XP_008222722.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Prunus 
mume]
Length=1190

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  324  LSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            L S  + +  S+E  +  K   + +S +E ++L + LDHQVE+GE + I+GS KELGSW
Sbjct  59   LCSAGVSSAQSIEEEKESKMKSKSKSGNEKVRLNVRLDHQVEFGESVVILGSIKELGSW  117



>ref|XP_002453659.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
 gb|EES06635.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
Length=1212

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +3

Query  354  SVETREVEKKGKEKR---SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            +  T+ + +  +EK+   S  + ++L + LDHQV +GEH+ I+GS KELGSW
Sbjct  60   AASTKHITRTKEEKQTDPSKQDIVRLHVCLDHQVMFGEHVGIIGSAKELGSW  111



>gb|EEC69133.1| hypothetical protein OsI_38056 [Oryza sativa Indica Group]
Length=1191

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +3

Query  378  KKGKEKRSAHENL-KLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            K+ K + S+ + L  L++ L+HQV++GEH+ I+GSTKELGSW
Sbjct  27   KEKKRRDSSKQPLVHLQVCLEHQVKFGEHVGIIGSTKELGSW  68



>ref|XP_004152111.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004156941.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
Length=1217

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = +3

Query  333  RTICAVSSVETREV----EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            R +C VSS     +    E+K   K  +   + LK+ L HQVE+GE + I+GS++ELGSW
Sbjct  57   RIVCGVSSASQETIREDEEQKMTGKLGSGGKVLLKLRLAHQVEFGESVVILGSSEELGSW  116



>gb|KDP32558.1| hypothetical protein JCGZ_13108 [Jatropha curcas]
Length=1114

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  381  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            K  + +S    ++L   LDHQVE+G+H+ I+GSTKELG W
Sbjct  2    KTNKSKSGSGKVRLNFRLDHQVEFGDHVVILGSTKELGLW  41



>ref|XP_010228078.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brachypodium 
distachyon]
Length=1182

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  420  LKIWLDHQVEYGEHIAIMGSTKELGSW  500
            L+++L+HQV++GEH+ ++GSTKELGSW
Sbjct  76   LRVFLEHQVKFGEHVGVIGSTKELGSW  102



>gb|KGN53052.1| hypothetical protein Csa_4G012480 [Cucumis sativus]
Length=1241

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = +3

Query  333  RTICAVSSVETREV----EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  500
            R +C VSS     +    E+K   K  +   + LK+ L HQVE+GE + I+GS++ELGSW
Sbjct  57   RIVCGVSSASQETIREDEEQKMTGKLGSGGKVLLKLRLAHQVEFGESVVILGSSEELGSW  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300