BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS128H08

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO84745.1|  hypothetical protein CISIN_1g0038682mg                  166   6e-47   Citrus sinensis [apfelsine]
ref|XP_006473595.1|  PREDICTED: pentatricopeptide repeat-containi...    170   2e-45   Citrus sinensis [apfelsine]
ref|XP_009608057.1|  PREDICTED: pentatricopeptide repeat-containi...    170   2e-45   Nicotiana tomentosiformis
ref|XP_009777873.1|  PREDICTED: pentatricopeptide repeat-containi...    167   2e-44   Nicotiana sylvestris
ref|XP_006435103.1|  hypothetical protein CICLE_v10000322mg             166   7e-44   Citrus clementina [clementine]
ref|XP_004238467.1|  PREDICTED: pentatricopeptide repeat-containi...    166   7e-44   
ref|XP_006342194.1|  PREDICTED: pentatricopeptide repeat-containi...    165   1e-43   Solanum tuberosum [potatoes]
ref|XP_010271478.1|  PREDICTED: pentatricopeptide repeat-containi...    161   3e-42   Nelumbo nucifera [Indian lotus]
emb|CDP19381.1|  unnamed protein product                                161   5e-42   Coffea canephora [robusta coffee]
ref|XP_002302000.2|  pentatricopeptide repeat-containing family p...    160   1e-41   
ref|XP_011028950.1|  PREDICTED: pentatricopeptide repeat-containi...    159   3e-41   Populus euphratica
ref|XP_011099914.1|  PREDICTED: pentatricopeptide repeat-containi...    157   1e-40   Sesamum indicum [beniseed]
ref|XP_007034693.1|  Pentatricopeptide repeat (PPR) superfamily p...    156   3e-40   Theobroma cacao [chocolate]
ref|XP_009109879.1|  PREDICTED: pentatricopeptide repeat-containi...    155   3e-40   
ref|XP_008228974.1|  PREDICTED: pentatricopeptide repeat-containi...    156   4e-40   
emb|CDY36110.1|  BnaA08g19380D                                          153   4e-40   Brassica napus [oilseed rape]
ref|XP_010061020.1|  PREDICTED: pentatricopeptide repeat-containi...    155   5e-40   
ref|XP_004167110.1|  PREDICTED: pentatricopeptide repeat-containi...    155   7e-40   
emb|CDY24406.1|  BnaCnng04730D                                          154   7e-40   Brassica napus [oilseed rape]
ref|XP_010093155.1|  hypothetical protein L484_005164                   155   7e-40   
ref|XP_002280360.1|  PREDICTED: pentatricopeptide repeat-containi...    154   1e-39   Vitis vinifera
ref|XP_008343247.1|  PREDICTED: pentatricopeptide repeat-containi...    154   2e-39   
ref|XP_004152765.1|  PREDICTED: pentatricopeptide repeat-containi...    154   2e-39   Cucumis sativus [cucumbers]
gb|KGN62652.1|  hypothetical protein Csa_2G365100                       154   2e-39   Cucumis sativus [cucumbers]
emb|CBI19832.3|  unnamed protein product                                150   6e-39   Vitis vinifera
ref|XP_008444805.1|  PREDICTED: pentatricopeptide repeat-containi...    150   3e-38   
ref|XP_008444772.1|  PREDICTED: pentatricopeptide repeat-containi...    150   3e-38   Cucumis melo [Oriental melon]
ref|XP_006415862.1|  hypothetical protein EUTSA_v10006846mg             149   7e-38   Eutrema salsugineum [saltwater cress]
gb|KJB26847.1|  hypothetical protein B456_004G262700                    149   1e-37   Gossypium raimondii
gb|KFK44540.1|  hypothetical protein AALP_AA1G270100                    148   2e-37   Arabis alpina [alpine rockcress]
ref|XP_010477942.1|  PREDICTED: pentatricopeptide repeat-containi...    147   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002893429.1|  pentatricopeptide repeat-containing protein        147   4e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006306802.1|  hypothetical protein CARUB_v10008344mg             147   4e-37   Capsella rubella
ref|NP_173907.1|  pentatricopeptide repeat-containing protein           147   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499119.1|  PREDICTED: pentatricopeptide repeat-containi...    145   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004152758.1|  PREDICTED: pentatricopeptide repeat-containi...    144   3e-36   Cucumis sativus [cucumbers]
ref|XP_002521664.1|  pentatricopeptide repeat-containing protein,...    142   4e-36   
ref|XP_008228975.1|  PREDICTED: pentatricopeptide repeat-containi...    142   2e-35   
ref|XP_010549219.1|  PREDICTED: pentatricopeptide repeat-containi...    141   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_004495263.1|  PREDICTED: pentatricopeptide repeat-containi...    141   5e-35   Cicer arietinum [garbanzo]
ref|XP_010672235.1|  PREDICTED: pentatricopeptide repeat-containi...    141   7e-35   
gb|EPS72239.1|  hypothetical protein M569_02517                         140   2e-34   Genlisea aurea
ref|XP_003590744.1|  Pentatricopeptide repeat-containing protein        139   4e-34   Medicago truncatula
ref|XP_009378934.1|  PREDICTED: pentatricopeptide repeat-containi...    134   2e-32   
gb|KCW67919.1|  hypothetical protein EUGRSUZ_F01621                     132   8e-32   Eucalyptus grandis [rose gum]
ref|XP_004301492.2|  PREDICTED: pentatricopeptide repeat-containi...    130   5e-31   Fragaria vesca subsp. vesca
ref|XP_007144135.1|  hypothetical protein PHAVU_007G131600g             127   7e-30   Phaseolus vulgaris [French bean]
ref|XP_003535453.2|  PREDICTED: pentatricopeptide repeat-containi...    125   1e-29   Glycine max [soybeans]
ref|XP_010942837.1|  PREDICTED: pentatricopeptide repeat-containi...    106   1e-22   Elaeis guineensis
ref|XP_008787226.1|  PREDICTED: pentatricopeptide repeat-containi...    104   6e-22   Phoenix dactylifera
ref|XP_009394346.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006841418.1|  hypothetical protein AMTR_s00003p00032470          100   7e-21   Amborella trichopoda
ref|XP_006841563.1|  hypothetical protein AMTR_s00003p00182540        94.4    1e-18   
ref|XP_010938946.1|  PREDICTED: pentatricopeptide repeat-containi...  91.7    1e-17   Elaeis guineensis
ref|XP_008805705.1|  PREDICTED: pentatricopeptide repeat-containi...  90.5    3e-17   Phoenix dactylifera
gb|KFK44541.1|  hypothetical protein AALP_AA1G270100                  87.4    3e-16   Arabis alpina [alpine rockcress]
ref|XP_010100885.1|  hypothetical protein L484_009655                 77.0    9e-13   Morus notabilis
ref|XP_011009234.1|  PREDICTED: putative pentatricopeptide repeat...  76.6    9e-13   Populus euphratica
ref|XP_010257871.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  76.3    1e-12   
ref|XP_010091655.1|  hypothetical protein L484_026509                 75.5    2e-12   Morus notabilis
ref|XP_007139372.1|  hypothetical protein PHAVU_008G023900g           75.9    2e-12   Phaseolus vulgaris [French bean]
ref|XP_008783105.1|  PREDICTED: pentatricopeptide repeat-containi...  75.5    3e-12   Phoenix dactylifera
ref|XP_002314911.1|  pentatricopeptide repeat-containing family p...  75.1    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006841561.1|  hypothetical protein AMTR_s00003p00181560        73.2    7e-12   
ref|XP_010929076.1|  PREDICTED: pentatricopeptide repeat-containi...  73.6    1e-11   Elaeis guineensis
gb|KJB80450.1|  hypothetical protein B456_013G098500                  73.2    1e-11   Gossypium raimondii
ref|XP_003551787.1|  PREDICTED: pentatricopeptide repeat-containi...  73.2    1e-11   Glycine max [soybeans]
ref|XP_004303223.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   Fragaria vesca subsp. vesca
gb|EYU39396.1|  hypothetical protein MIMGU_mgv1a026743mg              72.4    2e-11   Erythranthe guttata [common monkey flower]
gb|KJB48770.1|  hypothetical protein B456_008G086200                  72.0    3e-11   Gossypium raimondii
ref|XP_003530462.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   Glycine max [soybeans]
ref|XP_002520145.1|  pentatricopeptide repeat-containing protein,...  70.5    3e-11   
ref|XP_008389362.1|  PREDICTED: putative pentatricopeptide repeat...  71.6    4e-11   
ref|XP_002533488.1|  pentatricopeptide repeat-containing protein,...  72.0    4e-11   
ref|XP_008243776.1|  PREDICTED: putative pentatricopeptide repeat...  71.6    5e-11   Prunus mume [ume]
ref|XP_009356472.1|  PREDICTED: putative pentatricopeptide repeat...  71.6    5e-11   Pyrus x bretschneideri [bai li]
gb|KDO79338.1|  hypothetical protein CISIN_1g038936mg                 70.9    5e-11   Citrus sinensis [apfelsine]
ref|XP_010694524.1|  PREDICTED: pentatricopeptide repeat-containi...  71.6    5e-11   
ref|XP_006878551.1|  hypothetical protein AMTR_s00011p00233950        71.2    5e-11   Amborella trichopoda
ref|XP_006406355.1|  hypothetical protein EUTSA_v10020511mg           70.9    6e-11   Eutrema salsugineum [saltwater cress]
ref|XP_008237416.1|  PREDICTED: pentatricopeptide repeat-containi...  70.5    1e-10   Prunus mume [ume]
ref|XP_009767912.1|  PREDICTED: pentatricopeptide repeat-containi...  70.1    1e-10   Nicotiana sylvestris
ref|XP_006466653.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    2e-10   Citrus sinensis [apfelsine]
ref|XP_006425825.1|  hypothetical protein CICLE_v10024955mg           69.7    2e-10   
ref|XP_009395862.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    2e-10   
ref|XP_009373813.1|  PREDICTED: pentatricopeptide repeat-containi...  69.7    2e-10   Pyrus x bretschneideri [bai li]
emb|CBI16904.3|  unnamed protein product                              69.7    2e-10   Vitis vinifera
ref|XP_002278668.2|  PREDICTED: pentatricopeptide repeat-containi...  69.7    2e-10   Vitis vinifera
ref|XP_006646070.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    3e-10   
ref|XP_008244547.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    3e-10   
ref|XP_009117354.1|  PREDICTED: pentatricopeptide repeat-containi...  69.3    3e-10   Brassica rapa
emb|CDP01970.1|  unnamed protein product                              68.9    3e-10   Coffea canephora [robusta coffee]
ref|XP_007226966.1|  hypothetical protein PRUPE_ppa025241mg           68.9    3e-10   Prunus persica
ref|XP_004242544.1|  PREDICTED: pentatricopeptide repeat-containi...  68.9    4e-10   Solanum lycopersicum
ref|XP_006299596.1|  hypothetical protein CARUB_v10015774mg           68.9    4e-10   
ref|XP_003621610.1|  Pentatricopeptide repeat-containing protein      68.6    5e-10   Medicago truncatula
ref|XP_004509764.1|  PREDICTED: putative pentatricopeptide repeat...  68.6    5e-10   
ref|XP_004289114.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    5e-10   Fragaria vesca subsp. vesca
ref|XP_006430993.1|  hypothetical protein CICLE_v10011041mg           68.6    5e-10   Citrus clementina [clementine]
ref|XP_002441797.1|  hypothetical protein SORBIDRAFT_08g002505        68.2    5e-10   
ref|XP_008362270.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    6e-10   
ref|XP_008342059.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    6e-10   
ref|XP_009625829.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    7e-10   Nicotiana tomentosiformis
ref|XP_007208178.1|  hypothetical protein PRUPE_ppa017277mg           67.8    7e-10   
ref|XP_006398078.1|  hypothetical protein EUTSA_v10001098mg           67.8    8e-10   
ref|XP_009117919.1|  PREDICTED: pentatricopeptide repeat-containi...  67.8    8e-10   Brassica rapa
ref|XP_010106892.1|  hypothetical protein L484_012985                 67.8    9e-10   Morus notabilis
emb|CDY34720.1|  BnaA01g33050D                                        67.8    9e-10   Brassica napus [oilseed rape]
ref|XP_007013068.1|  Tetratricopeptide repeat-like superfamily pr...  67.4    1e-09   
gb|KJB48511.1|  hypothetical protein B456_008G073100                  67.4    1e-09   Gossypium raimondii
ref|XP_010519672.1|  PREDICTED: putative pentatricopeptide repeat...  67.4    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_011077894.1|  PREDICTED: putative pentatricopeptide repeat...  67.4    1e-09   Sesamum indicum [beniseed]
gb|EEC71020.1|  hypothetical protein OsI_02714                        67.4    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004242310.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    1e-09   Solanum lycopersicum
ref|XP_007043264.1|  Pentatricopeptide repeat superfamily protein     66.6    1e-09   
gb|KHN06390.1|  Pentatricopeptide repeat-containing protein           66.6    1e-09   Glycine soja [wild soybean]
gb|EEE54934.1|  hypothetical protein OsJ_02489                        65.9    1e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010108113.1|  hypothetical protein L484_023201                 66.6    1e-09   Morus notabilis
emb|CDP02638.1|  unnamed protein product                              67.0    2e-09   Coffea canephora [robusta coffee]
ref|XP_004289369.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-09   Fragaria vesca subsp. vesca
ref|XP_010940859.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    2e-09   Elaeis guineensis
ref|XP_010262425.1|  PREDICTED: putative pentatricopeptide repeat...  66.6    2e-09   Nelumbo nucifera [Indian lotus]
ref|XP_006482464.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-09   Citrus sinensis [apfelsine]
ref|XP_008338226.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-09   
ref|XP_010463633.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010558533.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-09   Tarenaya hassleriana [spider flower]
gb|KDO72337.1|  hypothetical protein CISIN_1g002718mg                 66.6    2e-09   Citrus sinensis [apfelsine]
ref|XP_004491978.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-09   Cicer arietinum [garbanzo]
ref|XP_006437829.1|  hypothetical protein CICLE_v10033304mg           66.6    2e-09   Citrus clementina [clementine]
ref|XP_006352817.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    2e-09   
gb|KDO71020.1|  hypothetical protein CISIN_1g038673mg                 66.2    2e-09   Citrus sinensis [apfelsine]
emb|CDY13116.1|  BnaA09g17010D                                        66.2    3e-09   Brassica napus [oilseed rape]
ref|XP_008662428.1|  PREDICTED: pentatricopeptide repeat-containi...  66.2    3e-09   Zea mays [maize]
ref|XP_006847449.1|  hypothetical protein AMTR_s01569p00009850        63.2    3e-09   
ref|XP_002267613.1|  PREDICTED: putative pentatricopeptide repeat...  66.2    3e-09   Vitis vinifera
ref|XP_009348084.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_007217021.1|  hypothetical protein PRUPE_ppa001933mg           65.9    3e-09   
gb|KDP32117.1|  hypothetical protein JCGZ_12578                       65.9    3e-09   Jatropha curcas
ref|XP_010689314.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    3e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009775967.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    3e-09   Nicotiana sylvestris
ref|XP_010524431.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    3e-09   Tarenaya hassleriana [spider flower]
gb|EYU42170.1|  hypothetical protein MIMGU_mgv1a003558mg              65.9    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_008804906.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    3e-09   
ref|XP_010472662.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  65.9    3e-09   
gb|KCW59311.1|  hypothetical protein EUGRSUZ_H01992                   65.5    3e-09   Eucalyptus grandis [rose gum]
ref|XP_006362924.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    4e-09   Solanum tuberosum [potatoes]
ref|XP_002522543.1|  pentatricopeptide repeat-containing protein,...  65.5    4e-09   
ref|XP_009362610.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    4e-09   
ref|XP_010070499.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    4e-09   Eucalyptus grandis [rose gum]
ref|XP_006366808.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    4e-09   Solanum tuberosum [potatoes]
ref|XP_003610927.1|  Pentatricopeptide repeat-containing protein      65.5    4e-09   
ref|XP_009113933.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    4e-09   
ref|XP_004309485.2|  PREDICTED: pentatricopeptide repeat-containi...  65.1    4e-09   Fragaria vesca subsp. vesca
gb|AES93885.2|  pentatricopeptide (PPR) repeat protein                65.5    4e-09   Medicago truncatula
ref|XP_010278229.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    4e-09   
ref|XP_010278235.1|  PREDICTED: pentatricopeptide repeat-containi...  65.5    4e-09   
gb|EMT10346.1|  Pentatricopeptide repeat-containing protein           65.5    5e-09   
ref|XP_002454518.1|  hypothetical protein SORBIDRAFT_04g032600        65.5    5e-09   
gb|KCW47309.1|  hypothetical protein EUGRSUZ_K01097                   65.1    5e-09   Eucalyptus grandis [rose gum]
ref|XP_010551347.1|  PREDICTED: putative pentatricopeptide repeat...  65.1    5e-09   Tarenaya hassleriana [spider flower]
ref|XP_006844125.1|  hypothetical protein AMTR_s00006p00257350        65.1    6e-09   
ref|XP_007207552.1|  hypothetical protein PRUPE_ppa017672mg           65.1    6e-09   
ref|XP_010923534.1|  PREDICTED: pentatricopeptide repeat-containi...  65.1    6e-09   Elaeis guineensis
gb|KDP36109.1|  hypothetical protein JCGZ_08753                       64.7    6e-09   Jatropha curcas
ref|XP_011028231.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    6e-09   Populus euphratica
ref|XP_003524199.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    7e-09   Glycine max [soybeans]
ref|XP_008789842.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    7e-09   
gb|AAG12601.1|AC068900_7  hypothetical protein; 7123-4412             65.1    7e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976211.1|  PREDICTED: putative pentatricopeptide repeat...  64.7    7e-09   Setaria italica
ref|XP_004137118.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    7e-09   
ref|XP_007135284.1|  hypothetical protein PHAVU_010G116300g           64.3    7e-09   Phaseolus vulgaris [French bean]
ref|NP_186882.2|  pentatricopeptide repeat-containing protein         64.7    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009619976.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    8e-09   Nicotiana tomentosiformis
ref|XP_002991963.1|  hypothetical protein SELMODRAFT_134528           63.5    8e-09   
ref|XP_010429126.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    8e-09   
ref|XP_007203614.1|  hypothetical protein PRUPE_ppa002292mg           64.7    9e-09   Prunus persica
ref|XP_006451257.1|  hypothetical protein CICLE_v10010361mg           64.3    9e-09   Citrus clementina [clementine]
ref|XP_009140477.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    9e-09   Brassica rapa
ref|XP_008802431.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    9e-09   
ref|XP_010098972.1|  hypothetical protein L484_025631                 64.3    9e-09   
ref|XP_006843375.1|  hypothetical protein AMTR_s00053p00090700        64.3    9e-09   
ref|XP_008342174.1|  PREDICTED: pentatricopeptide repeat-containi...  64.3    9e-09   
emb|CAN67492.1|  hypothetical protein VITISV_035978                   64.3    1e-08   Vitis vinifera
ref|XP_008389431.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    1e-08   
ref|XP_010095360.1|  hypothetical protein L484_010890                 64.3    1e-08   Morus notabilis
ref|XP_008790796.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    1e-08   
ref|XP_008221533.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    1e-08   Prunus mume [ume]
ref|XP_010920669.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    1e-08   
ref|XP_007038671.1|  Tetratricopeptide repeat superfamily protein...  63.9    1e-08   
gb|KJB77362.1|  hypothetical protein B456_012G134100                  63.9    1e-08   Gossypium raimondii
gb|KDO53133.1|  hypothetical protein CISIN_1g0032732mg                62.4    1e-08   Citrus sinensis [apfelsine]
ref|XP_004298334.1|  PREDICTED: putative pentatricopeptide repeat...  63.9    1e-08   Fragaria vesca subsp. vesca
gb|KGN51874.1|  hypothetical protein Csa_5G604190                     63.9    1e-08   Cucumis sativus [cucumbers]
gb|EYU42356.1|  hypothetical protein MIMGU_mgv1a022159mg              63.9    1e-08   Erythranthe guttata [common monkey flower]
ref|XP_006430120.1|  hypothetical protein CICLE_v10011370mg           63.9    1e-08   Citrus clementina [clementine]
gb|KDO70550.1|  hypothetical protein CISIN_1g046956mg                 63.9    1e-08   Citrus sinensis [apfelsine]
ref|XP_007047157.1|  Pentatricopeptide repeat (PPR) superfamily p...  63.9    1e-08   
ref|XP_008790794.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    1e-08   
ref|XP_010432112.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006354595.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    1e-08   Solanum tuberosum [potatoes]
ref|XP_009353870.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_008246374.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    1e-08   
ref|XP_002869013.1|  pentatricopeptide repeat-containing protein      63.9    1e-08   Arabidopsis lyrata subsp. lyrata
gb|KJB21916.1|  hypothetical protein B456_004G021000                  63.5    1e-08   Gossypium raimondii
ref|XP_006411944.1|  hypothetical protein EUTSA_v10026762mg           63.9    1e-08   Eutrema salsugineum [saltwater cress]
ref|XP_008454910.1|  PREDICTED: pentatricopeptide repeat-containi...  63.9    2e-08   Cucumis melo [Oriental melon]
ref|XP_002971568.1|  hypothetical protein SELMODRAFT_96189            63.5    2e-08   
emb|CAN66581.1|  hypothetical protein VITISV_030261                   63.5    2e-08   Vitis vinifera
gb|KDO57645.1|  hypothetical protein CISIN_1g042265mg                 63.5    2e-08   Citrus sinensis [apfelsine]
ref|XP_003559929.1|  PREDICTED: putative pentatricopeptide repeat...  63.5    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_004485929.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Cicer arietinum [garbanzo]
ref|XP_010234956.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  63.9    2e-08   
ref|XP_006348632.1|  PREDICTED: putative pentatricopeptide repeat...  63.9    2e-08   Solanum tuberosum [potatoes]
ref|XP_003635554.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Vitis vinifera
ref|XP_010252400.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_009132312.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Brassica rapa
ref|XP_009347240.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_007032935.1|  Pentatricopeptide repeat (PPR) superfamily p...  63.5    2e-08   
ref|XP_006485061.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Citrus sinensis [apfelsine]
ref|XP_002878586.1|  pentatricopeptide repeat-containing protein      63.5    2e-08   
ref|XP_010488060.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008242522.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Prunus mume [ume]
ref|XP_004239007.1|  PREDICTED: putative pentatricopeptide repeat...  63.5    2e-08   Solanum lycopersicum
ref|XP_006838888.1|  hypothetical protein AMTR_s00002p00268120        62.8    2e-08   
emb|CDP00497.1|  unnamed protein product                              63.5    2e-08   Coffea canephora [robusta coffee]
ref|XP_007204248.1|  hypothetical protein PRUPE_ppa002250mg           63.5    2e-08   Prunus persica
ref|XP_004135465.1|  PREDICTED: putative pentatricopeptide repeat...  63.5    2e-08   Cucumis sativus [cucumbers]
gb|KDO80373.1|  hypothetical protein CISIN_1g007077mg                 63.5    2e-08   Citrus sinensis [apfelsine]
gb|EYU44257.1|  hypothetical protein MIMGU_mgv1a021838mg              63.5    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_004233728.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Solanum lycopersicum
ref|XP_006475772.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Citrus sinensis [apfelsine]
ref|XP_006451021.1|  hypothetical protein CICLE_v10007671mg           63.5    2e-08   Citrus clementina [clementine]
ref|XP_002523296.1|  pentatricopeptide repeat-containing protein,...  62.8    2e-08   
ref|XP_010508236.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   
ref|XP_003632466.2|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Vitis vinifera
ref|XP_007222375.1|  hypothetical protein PRUPE_ppa004015mg           63.2    2e-08   Prunus persica
ref|XP_006483247.1|  PREDICTED: putative pentatricopeptide repeat...  63.2    2e-08   Citrus sinensis [apfelsine]
ref|XP_003566841.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_004248284.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   Solanum lycopersicum
ref|XP_009416454.1|  PREDICTED: putative pentatricopeptide repeat...  63.5    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN33415.1|  Pentatricopeptide repeat-containing protein           63.5    2e-08   Glycine soja [wild soybean]
ref|XP_004139977.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   
ref|XP_004163116.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    2e-08   
ref|XP_010506424.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010104571.1|  hypothetical protein L484_025549                 63.2    2e-08   Morus notabilis
emb|CDY36989.1|  BnaC09g18050D                                        63.2    2e-08   Brassica napus [oilseed rape]
ref|XP_008798789.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   Phoenix dactylifera
ref|XP_010096333.1|  hypothetical protein L484_021080                 63.2    2e-08   Morus notabilis
ref|XP_002463110.1|  hypothetical protein SORBIDRAFT_02g037960        63.2    2e-08   
ref|XP_008369504.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   
ref|XP_007045718.1|  Pentatricopeptide repeat-containing protein      63.2    2e-08   
ref|XP_011096416.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   Sesamum indicum [beniseed]
ref|XP_006293876.1|  hypothetical protein CARUB_v10022861mg           63.2    2e-08   
ref|XP_010109916.1|  hypothetical protein L484_013254                 63.2    2e-08   
ref|XP_010091291.1|  hypothetical protein L484_001646                 63.2    2e-08   Morus notabilis
ref|XP_009623675.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    2e-08   Nicotiana tomentosiformis
ref|XP_008805694.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    3e-08   
ref|XP_004140378.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   
ref|NP_179798.1|  pentatricopeptide repeat-containing protein         63.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844123.1|  hypothetical protein AMTR_s00006p00257020        63.2    3e-08   
ref|XP_002270938.2|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   Vitis vinifera
emb|CDP14502.1|  unnamed protein product                              63.2    3e-08   Coffea canephora [robusta coffee]
ref|XP_009386093.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   
ref|XP_007046822.1|  Pentatricopeptide repeat (PPR) superfamily p...  62.8    3e-08   
ref|XP_002880144.1|  pentatricopeptide repeat-containing protein      62.8    3e-08   
ref|XP_009391517.1|  PREDICTED: pentatricopeptide repeat-containi...  63.2    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008464984.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   Cucumis melo [Oriental melon]
ref|XP_009610860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.2    3e-08   
ref|XP_002263755.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   Vitis vinifera
ref|XP_010526710.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_010437286.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   Camelina sativa [gold-of-pleasure]
emb|CBI17453.3|  unnamed protein product                              62.4    3e-08   Vitis vinifera
ref|XP_010509233.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006857044.1|  hypothetical protein AMTR_s00065p00033910        62.4    3e-08   
emb|CDY23034.1|  BnaC07g31530D                                        62.8    3e-08   Brassica napus [oilseed rape]
ref|XP_006471568.1|  PREDICTED: pentatricopeptide repeat-containi...  62.8    3e-08   Citrus sinensis [apfelsine]
ref|XP_009404762.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP22212.1|  unnamed protein product                              62.4    4e-08   Coffea canephora [robusta coffee]
ref|XP_008803058.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  62.4    4e-08   Phoenix dactylifera
gb|KFK39390.1|  hypothetical protein AALP_AA3G238900                  62.4    4e-08   
ref|XP_006438573.1|  hypothetical protein CICLE_v10030908mg           62.4    4e-08   
ref|XP_008459333.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   
ref|XP_004966840.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   
ref|XP_010065411.1|  PREDICTED: putative pentatricopeptide repeat...  62.4    4e-08   
emb|CDY36792.1|  BnaA03g10940D                                        62.4    4e-08   
ref|XP_010276285.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   
ref|XP_006425612.1|  hypothetical protein CICLE_v10025108mg           62.4    4e-08   
ref|XP_004145327.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   
ref|XP_009352530.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   
ref|XP_010679679.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   
ref|XP_007045928.1|  Pentatricopeptide repeat-containing protein      62.0    4e-08   
ref|XP_009384885.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    4e-08   
gb|KJB48240.1|  hypothetical protein B456_008G059500                  62.4    5e-08   
gb|KCW90501.1|  hypothetical protein EUGRSUZ_A02621                   62.0    5e-08   
ref|XP_009360403.1|  PREDICTED: putative pentatricopeptide repeat...  62.0    5e-08   
ref|XP_006850796.1|  hypothetical protein AMTR_s00025p00107100        59.7    5e-08   
ref|XP_002522407.1|  pentatricopeptide repeat-containing protein,...  59.3    5e-08   
ref|XP_006283244.1|  hypothetical protein CARUB_v10004277mg           62.4    5e-08   
ref|XP_009608343.1|  PREDICTED: pentatricopeptide repeat-containi...  62.4    5e-08   
ref|XP_009391755.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    5e-08   
ref|XP_008446300.1|  PREDICTED: putative pentatricopeptide repeat...  62.0    5e-08   
emb|CBI22269.3|  unnamed protein product                              62.0    5e-08   
ref|XP_008452110.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    5e-08   
ref|XP_011073672.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    5e-08   
ref|XP_006404655.1|  hypothetical protein EUTSA_v10000053mg           62.0    5e-08   
ref|XP_008353470.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    6e-08   
ref|XP_006391071.1|  hypothetical protein EUTSA_v10019713mg           62.0    6e-08   
gb|KDO66510.1|  hypothetical protein CISIN_1g005454mg                 62.0    6e-08   
emb|CDY19612.1|  BnaA05g20200D                                        62.0    6e-08   
gb|KJB22911.1|  hypothetical protein B456_004G073100                  62.0    6e-08   
ref|XP_010542740.1|  PREDICTED: transcription factor bHLH155          62.0    6e-08   
ref|XP_011028230.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    6e-08   
ref|XP_008337499.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    6e-08   
ref|XP_010518097.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    6e-08   
ref|XP_010446721.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    6e-08   
ref|XP_010911475.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    6e-08   
ref|XP_006344830.1|  PREDICTED: pentatricopeptide repeat-containi...  62.0    6e-08   
ref|XP_010059384.1|  PREDICTED: putative pentatricopeptide repeat...  61.6    6e-08   
ref|XP_002983533.1|  hypothetical protein SELMODRAFT_118613           61.2    6e-08   
ref|XP_002448183.1|  hypothetical protein SORBIDRAFT_06g022570        61.6    6e-08   
emb|CBI20254.3|  unnamed protein product                              61.6    6e-08   
emb|CDP10224.1|  unnamed protein product                              61.6    6e-08   
ref|XP_008457445.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    7e-08   
gb|KDP21066.1|  hypothetical protein JCGZ_21537                       61.6    7e-08   
gb|AET03186.2|  PPR containing plant-like protein                     61.6    7e-08   
ref|XP_002282675.3|  PREDICTED: pentatricopeptide repeat-containi...  61.6    7e-08   
ref|XP_010528563.1|  PREDICTED: putative pentatricopeptide repeat...  61.6    7e-08   
ref|XP_003542017.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    7e-08   
gb|KDP31290.1|  hypothetical protein JCGZ_11666                       61.6    7e-08   
ref|XP_003609609.1|  Pentatricopeptide repeat-containing protein      61.6    7e-08   
gb|KGN46644.1|  hypothetical protein Csa_6G117760                     61.6    7e-08   
ref|XP_004146494.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    7e-08   
emb|CDP03192.1|  unnamed protein product                              61.6    7e-08   
ref|XP_010274119.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    7e-08   
ref|XP_004511479.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  61.6    8e-08   
ref|XP_009136519.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    8e-08   
ref|XP_009774998.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    8e-08   
ref|XP_009356368.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    8e-08   
ref|XP_008777202.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    8e-08   
ref|XP_006466854.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    8e-08   
ref|XP_006404106.1|  hypothetical protein EUTSA_v10010148mg           61.6    8e-08   
ref|XP_004295338.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    8e-08   
ref|XP_007226957.1|  hypothetical protein PRUPE_ppa002695mg           61.2    8e-08   
ref|XP_002311156.2|  hypothetical protein POPTR_0008s05220g           61.6    8e-08   
ref|XP_010109889.1|  hypothetical protein L484_013224                 61.6    8e-08   
ref|XP_011025378.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    9e-08   
ref|XP_011099068.1|  PREDICTED: pentatricopeptide repeat-containi...  61.6    9e-08   
ref|XP_006481702.1|  PREDICTED: putative pentatricopeptide repeat...  61.2    9e-08   
ref|XP_001754449.1|  predicted protein                                61.2    9e-08   
gb|KDO52711.1|  hypothetical protein CISIN_1g039362mg                 61.2    9e-08   
ref|XP_002514567.1|  pentatricopeptide repeat-containing protein,...  61.2    9e-08   
gb|KJB38678.1|  hypothetical protein B456_006G266600                  61.2    9e-08   
ref|NP_190543.1|  pentatricopeptide repeat-containing protein         61.2    9e-08   
ref|XP_009145594.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    1e-07   
gb|KHN30207.1|  Pentatricopeptide repeat-containing protein           61.2    1e-07   
ref|XP_006854888.1|  hypothetical protein AMTR_s00439p00011190        59.7    1e-07   
ref|XP_002272744.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    1e-07   
gb|KDP44009.1|  hypothetical protein JCGZ_05476                       61.2    1e-07   
ref|XP_010939608.1|  PREDICTED: pentatricopeptide repeat-containi...  61.2    1e-07   
gb|EYU37931.1|  hypothetical protein MIMGU_mgv1a003299mg              61.2    1e-07   
emb|CDX79001.1|  BnaA01g10680D                                        60.8    1e-07   
ref|XP_010322701.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_008241553.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  60.8    1e-07   
ref|XP_002884315.1|  pentatricopeptide repeat-containing protein      61.2    1e-07   
ref|XP_010088132.1|  hypothetical protein L484_013576                 60.8    1e-07   
ref|XP_010087362.1|  hypothetical protein L484_018388                 60.8    1e-07   
gb|EPS71377.1|  hypothetical protein M569_03380                       60.8    1e-07   
emb|CDP02363.1|  unnamed protein product                              61.2    1e-07   
ref|XP_006340666.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_010257435.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_007159438.1|  hypothetical protein PHAVU_002G237800g           60.8    1e-07   
gb|EYU35572.1|  hypothetical protein MIMGU_mgv1a018815mg              60.8    1e-07   
ref|XP_009415765.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
emb|CDP12017.1|  unnamed protein product                              61.2    1e-07   
gb|KEH20172.1|  PPR containing plant-like protein                     60.8    1e-07   
ref|XP_004982069.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_006363843.1|  PREDICTED: putative pentatricopeptide repeat...  60.8    1e-07   
ref|XP_002514718.1|  pentatricopeptide repeat-containing protein,...  60.5    1e-07   
emb|CAN83351.1|  hypothetical protein VITISV_028907                   60.8    1e-07   
ref|XP_004155716.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
gb|KCW47301.1|  hypothetical protein EUGRSUZ_K01090                   60.8    1e-07   
ref|XP_002264194.2|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
gb|KGN66775.1|  hypothetical protein Csa_1G690140                     60.5    1e-07   
ref|XP_010466274.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_008241735.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_009392649.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_010523919.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_008221546.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
ref|XP_007203772.1|  hypothetical protein PRUPE_ppa002597mg           60.8    1e-07   
ref|XP_010919698.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  60.8    1e-07   
ref|XP_008230222.1|  PREDICTED: putative pentatricopeptide repeat...  60.5    1e-07   
ref|XP_007224962.1|  hypothetical protein PRUPE_ppa021143mg           60.5    1e-07   
ref|XP_010028057.1|  PREDICTED: pentatricopeptide repeat-containi...  60.8    1e-07   
gb|EYU44173.1|  hypothetical protein MIMGU_mgv1a020276mg              60.5    1e-07   
ref|XP_007217579.1|  hypothetical protein PRUPE_ppa019357mg           60.5    2e-07   
gb|AEN99840.1|  chlororespiratory reduction 4                         60.5    2e-07   
ref|NP_195434.1|  pentatricopeptide repeat-containing protein         60.5    2e-07   
ref|XP_003628710.1|  Pentatricopeptide repeat-containing protein      60.8    2e-07   
ref|XP_002991831.1|  hypothetical protein SELMODRAFT_186416           60.1    2e-07   
ref|XP_006385618.1|  hypothetical protein POPTR_0003s08690g           60.5    2e-07   
ref|XP_002267303.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
ref|XP_003522563.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
gb|KDO43922.1|  hypothetical protein CISIN_1g003937mg                 60.5    2e-07   
gb|KFK33588.1|  hypothetical protein AALP_AA5G033300                  60.1    2e-07   
ref|XP_009352331.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
ref|XP_008390483.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
ref|XP_007134299.1|  hypothetical protein PHAVU_010G035600g           60.5    2e-07   
gb|KDO83513.1|  hypothetical protein CISIN_1g0436371mg                60.5    2e-07   
ref|XP_007138310.1|  hypothetical protein PHAVU_009G197900g           60.5    2e-07   
ref|XP_004500589.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  60.5    2e-07   
ref|XP_010258291.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
emb|CAN76058.1|  hypothetical protein VITISV_032001                   58.5    2e-07   
ref|XP_006434326.1|  hypothetical protein CICLE_v10000445mg           60.5    2e-07   
ref|XP_010437793.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
ref|XP_010943703.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_010035839.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
ref|XP_010035835.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
emb|CBI30660.3|  unnamed protein product                              60.5    2e-07   
ref|XP_008795676.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
ref|XP_010923573.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_009352955.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_009369706.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_009359788.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_010416963.1|  PREDICTED: pentatricopeptide repeat-containi...  60.5    2e-07   
ref|XP_009773656.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
gb|AEB39776.1|  pentatricopeptide repeat protein 78                   60.5    2e-07   
ref|XP_004306131.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_004233934.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_002875993.1|  pentatricopeptide repeat-containing protein      60.1    2e-07   
ref|XP_004971569.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_011459353.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_010938918.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
gb|EPS63127.1|  hypothetical protein M569_11659                       60.1    2e-07   
ref|XP_010250314.1|  PREDICTED: putative pentatricopeptide repeat...  60.1    2e-07   
ref|XP_008810930.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
emb|CDO96747.1|  unnamed protein product                              60.1    2e-07   
ref|XP_010255189.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_008389535.1|  PREDICTED: putative pentatricopeptide repeat...  60.1    2e-07   
ref|XP_006296049.1|  hypothetical protein CARUB_v10025197mg           60.1    2e-07   
ref|XP_009389041.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_010915122.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
emb|CBI36364.3|  unnamed protein product                              60.1    2e-07   
ref|XP_010255696.1|  PREDICTED: putative pentatricopeptide repeat...  60.1    2e-07   
ref|XP_004142577.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
ref|XP_010426500.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    2e-07   
gb|EEC81238.1|  hypothetical protein OsI_24298                        59.7    2e-07   
ref|XP_006294030.1|  hypothetical protein CARUB_v10023022mg           59.7    2e-07   
ref|XP_010507359.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    3e-07   
ref|XP_006426143.1|  hypothetical protein CICLE_v10025041mg           60.1    3e-07   
ref|XP_010277362.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_010541412.1|  PREDICTED: LOW QUALITY PROTEIN: putative pen...  59.7    3e-07   
ref|XP_006466421.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    3e-07   
gb|KDO78853.1|  hypothetical protein CISIN_1g004733mg                 60.1    3e-07   
ref|XP_010047699.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    3e-07   
ref|XP_002529360.1|  pentatricopeptide repeat-containing protein,...  60.1    3e-07   
emb|CAN75464.1|  hypothetical protein VITISV_006518                   59.7    3e-07   
ref|XP_006383156.1|  hypothetical protein POPTR_0005s12100g           60.1    3e-07   
ref|XP_008221687.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    3e-07   
emb|CBI30711.3|  unnamed protein product                              60.1    3e-07   
ref|XP_006448819.1|  hypothetical protein CICLE_v10018334mg           60.1    3e-07   
ref|XP_008794221.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    3e-07   
gb|KDO77577.1|  hypothetical protein CISIN_1g041741mg                 60.1    3e-07   
ref|XP_009338904.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_006468369.1|  PREDICTED: pentatricopeptide repeat-containi...  60.1    3e-07   
ref|XP_006858742.1|  hypothetical protein AMTR_s00066p00131520        59.7    3e-07   
ref|XP_010670405.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
dbj|BAK04243.1|  predicted protein                                    59.7    3e-07   
ref|XP_011085507.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
emb|CBI23043.3|  unnamed protein product                              59.7    3e-07   
ref|XP_008803697.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_008447444.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_010942245.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    3e-07   
ref|XP_002465797.1|  hypothetical protein SORBIDRAFT_01g045970        59.7    3e-07   
ref|XP_010655542.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_009416039.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    3e-07   
ref|XP_010267716.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_009105448.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    3e-07   
ref|XP_002323422.2|  hypothetical protein POPTR_0016s07840g           59.7    3e-07   
gb|KCW79656.1|  hypothetical protein EUGRSUZ_C01009                   59.7    3e-07   
gb|ACD56635.1|  putative pentatricopeptide repeat protein             59.7    3e-07   
ref|XP_010451066.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
emb|CDY37495.1|  BnaC01g37370D                                        59.7    3e-07   
ref|XP_003633097.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_010041208.1|  PREDICTED: putative pentatricopeptide repeat...  59.7    3e-07   
ref|XP_002324099.1|  hypothetical protein POPTR_0017s12720g           59.7    3e-07   
ref|XP_002281719.2|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_009624583.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_002512787.1|  pentatricopeptide repeat-containing protein,...  59.3    3e-07   
gb|ACD56662.1|  putative pentatricopeptide                            59.7    3e-07   
gb|AAT64030.1|  putative pentatricopeptide repeat protein             59.7    3e-07   
gb|AAT64016.1|  putative pentatricopeptide repeat protein             59.7    3e-07   
ref|XP_006847060.1|  hypothetical protein AMTR_s00017p00201310        59.7    3e-07   
ref|XP_008797556.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
ref|XP_006837084.1|  hypothetical protein AMTR_s00110p00099550        59.7    3e-07   
gb|KJB69698.1|  hypothetical protein B456_011G038100                  59.7    3e-07   
gb|AHB18405.1|  pentatricopeptide repeat-containing protein           59.7    3e-07   
ref|XP_011048334.1|  PREDICTED: pentatricopeptide repeat-containi...  59.7    3e-07   
gb|KJB66190.1|  hypothetical protein B456_010G131200                  59.3    3e-07   
ref|XP_009395698.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    3e-07   
ref|XP_002268784.1|  PREDICTED: pentatricopeptide repeat-containi...  59.3    3e-07   



>gb|KDO84745.1| hypothetical protein CISIN_1g0038682mg, partial [Citrus sinensis]
Length=270

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R LA+RYA+ LQLC      P  SSLA ++HA+MI+SGFKPR HI+NRLIDIYCKS  L 
Sbjct  10   RTLANRYASQLQLCDP--RNPITSSLARSVHAHMISSGFKPREHIINRLIDIYCKSLKLV  67

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LFDEIPQPDIVARTT++AAYSAS +  LA E+F++TPL MRDTVFYNA ITA+
Sbjct  68   YARTLFDEIPQPDIVARTTLIAAYSASDNVKLAREMFNKTPLKMRDTVFYNAMITAY  124



>ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
isoform X1 [Citrus sinensis]
 ref|XP_006473596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
isoform X2 [Citrus sinensis]
Length=799

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 82/117 (70%), Positives = 96/117 (82%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R LA+RYA+ LQLC      P  SSLA ++HA+MI+SGFKPR HI+NRLIDIYCKS  L 
Sbjct  10   RTLANRYASQLQLCDP--RNPITSSLARSVHAHMISSGFKPREHIINRLIDIYCKSLKLV  67

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LFDEIPQPDIVARTT++AAYSASG+  LA E+F++TPL MRDTVFYNA ITA+
Sbjct  68   YARTLFDEIPQPDIVARTTLIAAYSASGNVKLAREMFNKTPLKMRDTVFYNAMITAY  124



>ref|XP_009608057.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana tomentosiformis]
 ref|XP_009608058.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana tomentosiformis]
 ref|XP_009608059.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana tomentosiformis]
 ref|XP_009608061.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana tomentosiformis]
Length=807

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 103/139 (74%), Gaps = 4/139 (3%)
 Frame = +3

Query  192  MKNGAAAAKSFESWAQGIYICRQLASRYAAHLQ-LCSSNIHTPAASSLATAIHANMITSG  368
            MKN A A K+     Q     R +A+ YAA LQ LC    H  +A +L  +IH NMITSG
Sbjct  1    MKNAATAVKTS---LQNQSDTRTIANFYAAQLQPLCREKKHASSAFALVRSIHGNMITSG  57

Query  369  FKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
            F+PR+HILNRLIDIYCK+S L YA+ LFD IPQPD+VARTT++AAYSASGDP LA E+FD
Sbjct  58   FRPRSHILNRLIDIYCKNSGLVYAKRLFDRIPQPDVVARTTVIAAYSASGDPKLAREVFD  117

Query  549  RTPLSMRDTVFYNARITAH  605
            +TPLS+RDTV YNA IT +
Sbjct  118  KTPLSIRDTVCYNAMITGY  136



>ref|XP_009777873.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana sylvestris]
 ref|XP_009777874.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana sylvestris]
 ref|XP_009777875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nicotiana sylvestris]
Length=807

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 6/140 (4%)
 Frame = +3

Query  192  MKNGAAAAK-SFESWAQGIYICRQLASRYAAHLQL-CSSNIHTPAASSLATAIHANMITS  365
            MKN AAA K S  + +      R +A+ YA  LQL C    +  +A +L  +IH NMITS
Sbjct  1    MKNAAAAVKTSLLNQSD----TRTIANFYAVQLQLLCREKKYASSAFALVRSIHGNMITS  56

Query  366  GFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            GF+PR+HILNRLIDIYCK+S L+YA+HLFD IPQPD+VARTT++AAYSASGDP LA E+F
Sbjct  57   GFRPRSHILNRLIDIYCKNSGLAYAKHLFDRIPQPDVVARTTIIAAYSASGDPKLAREVF  116

Query  546  DRTPLSMRDTVFYNARITAH  605
            ++TPLS+RDTV YNA IT +
Sbjct  117  NKTPLSIRDTVCYNAMITGY  136



>ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citrus clementina]
 gb|ESR48343.1| hypothetical protein CICLE_v10000322mg [Citrus clementina]
Length=799

 Score =   166 bits (420),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 80/115 (70%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = +3

Query  261  LASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYA  440
            LA+RYA+ LQLC      P  SSLA ++HA+MI+SGFKPR HI+NRLIDIYCKS NL YA
Sbjct  12   LANRYASQLQLCDP--RNPITSSLARSVHAHMISSGFKPRGHIINRLIDIYCKSLNLVYA  69

Query  441  RHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            R LFDEIPQPDIVARTT++AAYSAS +  LA E+F++TPL  RDTVFYNA ITA+
Sbjct  70   RKLFDEIPQPDIVARTTLIAAYSASDNVKLAREMFNKTPLKKRDTVFYNAMITAY  124



>ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Solanum lycopersicum]
 ref|XP_010320488.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Solanum lycopersicum]
Length=804

 Score =   166 bits (420),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 79/116 (68%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +3

Query  261  LASRYAAHLQL-CSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSY  437
            +A+ YA  LQL C  + H  +AS+L  +IHANMITSGF+PR+HILN LI+IYCK+S L Y
Sbjct  18   IANFYAVQLQLLCREHKHATSASALLRSIHANMITSGFRPRSHILNSLINIYCKNSGLVY  77

Query  438  ARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            A+HLFD IPQPD+VARTTM+AAYSASG+P LA EIFD+TPLS RDTV YNA IT +
Sbjct  78   AKHLFDRIPQPDVVARTTMIAAYSASGEPKLAREIFDKTPLSFRDTVCYNAMITGY  133



>ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Solanum tuberosum]
Length=804

 Score =   165 bits (418),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +3

Query  261  LASRYAAHLQL-CSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSY  437
            +A+ YA  LQL C  + H  +AS+L  +IHANMITSGF PR+HILN LI+IYCK+S L Y
Sbjct  18   IANFYAVQLQLLCREHKHATSASALLRSIHANMITSGFSPRSHILNNLINIYCKNSGLVY  77

Query  438  ARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            A+HLFD IPQPD+VARTTM+AAYSASG+P LA E+FD+TPLS+RDTV YNA IT +
Sbjct  78   AKHLFDRIPQPDVVARTTMIAAYSASGEPKLAREVFDKTPLSIRDTVCYNAMITGY  133



>ref|XP_010271478.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Nelumbo nucifera]
Length=801

 Score =   161 bits (408),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 82/138 (59%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = +3

Query  192  MKNGAAAAKSFESWAQGIYICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGF  371
            MKN A A+ S           R  A+RYAA LQLC      P + SLA ++HA+MITSGF
Sbjct  1    MKNAALASSSL------FTDVRATANRYAALLQLCCP--QGPKSYSLARSVHAHMITSGF  52

Query  372  KPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDR  551
            +PR HILNRLIDIYCKS N++YARHLFD IP+PDIVARTT+++AYS  G   LA E+FD 
Sbjct  53   RPRGHILNRLIDIYCKSRNIAYARHLFDAIPKPDIVARTTLISAYSVEGSLKLARELFDG  112

Query  552  TPLSMRDTVFYNARITAH  605
            TP+S+RDTV YNA IT +
Sbjct  113  TPVSVRDTVSYNAMITGY  130


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 52/92 (57%), Gaps = 7/92 (8%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCK-----SSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            H  ++ SG +    +LN LI +Y K     SS ++ AR LFD +P+ D ++ TTM+  Y 
Sbjct  179  HCTVVKSGLESVVSVLNALISLYVKCAGFSSSLMNSARRLFDAMPEKDELSWTTMITGYV  238

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              GD + A ++FD   ++ +  V +NA I+ +
Sbjct  239  KRGDLDAARKLFD--GMTEKLEVAWNAMISGY  268



>emb|CDP19381.1| unnamed protein product [Coffea canephora]
Length=811

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R +A+R AA LQLC  N  +P + + A  IH +MITSGFKPR HILNRLID+YCKSSNL 
Sbjct  22   RAVANRCAAQLQLCCPN--SPTSYTRARTIHGHMITSGFKPRGHILNRLIDVYCKSSNLG  79

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YA+ LFD IPQPD+VARTT++AAYSASG P LA  IFD TPL +RDTV YNA IT +
Sbjct  80   YAKKLFDRIPQPDVVARTTLIAAYSASGSPKLARAIFDGTPLRVRDTVIYNAMITCY  136



>ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=797

 Score =   160 bits (404),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R  A+RY + LQ+C   + +P + SLA  +HA+MI SGF+PR HILNRLIDIY KSS L+
Sbjct  8    RTAANRYGSLLQICC--LQSPISYSLARPVHAHMIASGFQPRGHILNRLIDIYSKSSKLN  65

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR+LFDEIPQPDIVARTT++AAYSA+GD  L+ +IF  TPL MRD+VFYNA ITA+
Sbjct  66   YARYLFDEIPQPDIVARTTLIAAYSAAGDLKLSRKIFSDTPLGMRDSVFYNAMITAY  122



>ref|XP_011028950.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Populus euphratica]
 ref|XP_011028951.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Populus euphratica]
 ref|XP_011028952.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Populus euphratica]
Length=797

 Score =   159 bits (401),  Expect = 3e-41, Method: Composition-based stats.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R  A+RY + LQ+C   + +P + SLA  +HA+MI SGF+PR HILNRLIDIY KSS L+
Sbjct  8    RTAANRYGSLLQICC--LQSPISYSLACPVHAHMIASGFQPRGHILNRLIDIYRKSSKLN  65

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR+LFDEIPQPDIVARTT++AAYSA+GD  L+ +IF  TPL MRD+VFYNA ITA+
Sbjct  66   YARYLFDEIPQPDIVARTTLIAAYSAAGDLKLSRKIFSDTPLRMRDSVFYNAMITAY  122



>ref|XP_011099914.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Sesamum indicum]
Length=811

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            A++YAA LQLC      P   +LA A+HA+MI SGF PR HILNRLID YCKSSN +YA+
Sbjct  25   ANQYAAKLQLCFQR--GPPVYALAPAVHAHMIASGFIPRGHILNRLIDFYCKSSNFNYAK  82

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             LFDEIPQPD+VARTT++AAYSASG P +A EIFD+TPL +RDTV YN+ IT +
Sbjct  83   RLFDEIPQPDVVARTTLIAAYSASGKPKMAREIFDKTPLRIRDTVCYNSMITCY  136



>ref|XP_007034693.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY05619.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=788

 Score =   156 bits (394),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+RYA+ LQLC     TPA+ SLA AIH+ MI SGF PR HILNRLID+YCKSS 
Sbjct  6    LIRAVANRYASQLQLCYP--QTPASFSLAKAIHSRMIASGFHPRGHILNRLIDVYCKSSR  63

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            + YAR+LFD+IP PDIV+RT+++ AYS SG+   A E+F+ TPLS+RD+VFYNA IT 
Sbjct  64   IDYARNLFDKIPAPDIVSRTSLVLAYSTSGNIKKAREMFEETPLSIRDSVFYNAMITG  121



>ref|XP_009109879.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Brassica rapa]
Length=790

 Score =   155 bits (393),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 90/118 (76%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+RYAA+L LC     T  +  LA AIHAN IT GF+PRAHILNRLID+Y KSS 
Sbjct  7    LIRTIANRYAANLTLCFPLRRT--SLQLARAIHANFITFGFQPRAHILNRLIDVYSKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L YARHLFDEIP+PD +ARTTM++ YSASGD  LA  IF+ TPLSMRDT+ YNA IT 
Sbjct  65   LRYARHLFDEIPEPDKIARTTMVSGYSASGDIALAQNIFEETPLSMRDTIMYNAMITG  122



>ref|XP_008228974.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Prunus mume]
Length=822

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = +3

Query  246  YICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSS  425
            +I   +A+RYAA LQLC     +P + S+A   HA+MI SGFKPR HILNRLID+YCKSS
Sbjct  30   FIFLTVANRYAAQLQLCCP--QSPVSYSIARTTHAHMIASGFKPRGHILNRLIDVYCKSS  87

Query  426  NLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            N SYA  LFD+IP+PDIVARTT++ AYSA G+  LA +IF+ TPLSMRDTV YNA IT +
Sbjct  88   NFSYAHQLFDQIPKPDIVARTTLITAYSAIGNLTLARKIFNETPLSMRDTVCYNAMITGY  147



>emb|CDY36110.1| BnaA08g19380D [Brassica napus]
Length=517

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 90/118 (76%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+RYAA+L LC     T  +  LA AIHAN IT GF+PRAHILNRLID+Y KSS 
Sbjct  7    LIRTIANRYAANLTLCFPLRRT--SLQLARAIHANFITFGFQPRAHILNRLIDVYSKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L YARHLFDEIP+PD +ARTTM++ YSASGD  LA  IF+ TPLSMRDT+ YNA IT 
Sbjct  65   LRYARHLFDEIPEPDKIARTTMVSGYSASGDIALAQNIFEETPLSMRDTIMYNAMITG  122



>ref|XP_010061020.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Eucalyptus grandis]
Length=799

 Score =   155 bits (392),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 90/117 (77%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R +A+R+AA L+ C      PA+ S A A+HA+MI SG KPR HI+NRLID+YCKSSN+ 
Sbjct  10   RAIATRFAAQLRRCGPG--APASHSAARAVHAHMIASGLKPRGHIVNRLIDVYCKSSNIG  67

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YARHLFD IPQPD+VARTT++AAY+ +G   LA EIFD TPL MRDTV YNA IT +
Sbjct  68   YARHLFDGIPQPDVVARTTLIAAYAGAGGLKLAREIFDGTPLGMRDTVCYNAMITGY  124



>ref|XP_004167110.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis sativus]
Length=797

 Score =   155 bits (391),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 89/117 (76%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R LA+RYA  LQLCS     PA+ SLA A+HA+MI SGFKPR H LNRL+++YCKSSNL 
Sbjct  8    RLLANRYAEKLQLCSP--QDPASFSLARAVHAHMIASGFKPRGHFLNRLLEMYCKSSNLV  65

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LF+EIP PD +ARTT++ AY A G+  L  EIF+ TPL MRD+VFYNA IT +
Sbjct  66   YARQLFEEIPNPDAIARTTLITAYCALGNLELGREIFNGTPLYMRDSVFYNAMITGY  122



>emb|CDY24406.1| BnaCnng04730D [Brassica napus]
Length=703

 Score =   154 bits (389),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+RYAA+L LC     T  +  LA AIHAN IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LIRTIANRYAANLTLCFPLRRT--SLQLARAIHANFITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L YAR+LFDEIP+PD +ARTTM++ Y ASGD +LA  +F+ TPLSMRDT+ YNA IT 
Sbjct  65   LRYARNLFDEIPEPDKIARTTMVSGYCASGDISLARSVFEETPLSMRDTIMYNAMITG  122



>ref|XP_010093155.1| hypothetical protein L484_005164 [Morus notabilis]
 gb|EXB53614.1| hypothetical protein L484_005164 [Morus notabilis]
Length=800

 Score =   155 bits (391),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R +A+R+AA L  C      P + SLA  IHA+M  SGF+PR HI+NRLID+YCK SNLS
Sbjct  9    RSVANRFAAQLHFCRR--QNPISYSLARTIHAHMTASGFRPRGHIVNRLIDVYCKCSNLS  66

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR+LFDEIPQPD+VARTT++AAYSA+G+  LA EIF   PL MRDT+ YNA IT +
Sbjct  67   YARNLFDEIPQPDVVARTTLVAAYSAAGNLKLAREIFCGIPLDMRDTICYNAMITGY  123



>ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Vitis vinifera]
Length=799

 Score =   154 bits (390),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 74/117 (63%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R+LA++YAA LQ C    H P + S+A  +HA+MI SGFKPR +ILNRLID+YCKSS+L 
Sbjct  10   RRLANQYAAQLQQCCP--HNPMSYSIARTVHAHMIASGFKPRGYILNRLIDVYCKSSDLV  67

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             A HLFDEI QPDIVARTT++AA+S++G+ NLA EIF  TPL +RDTV YNA IT +
Sbjct  68   SAHHLFDEIRQPDIVARTTLIAAHSSAGNSNLAREIFFATPLGIRDTVCYNAMITGY  124



>ref|XP_008343247.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Malus domestica]
Length=807

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = +3

Query  261  LASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYA  440
            +A+RYAA LQLC     +P + SLA  IHA+MI SGF PR HILNRLIDIYCKSSN+ YA
Sbjct  20   VANRYAAQLQLCCP--QSPTSHSLARTIHAHMIASGFSPRGHILNRLIDIYCKSSNIXYA  77

Query  441  RHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            R LFD+IP+ DIVARTT++ AYS  G+  LA +IFD TPLSMRDTV YNA IT +
Sbjct  78   RQLFDKIPKXDIVARTTLVKAYSVIGNLTLARKIFDETPLSMRDTVSYNAMITGY  132



>ref|XP_004152765.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis sativus]
Length=797

 Score =   154 bits (388),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R LA+RYA  LQLCS     PA+ SLA A+HA+MI SGFKPR H LNRL+++YCKSSN+ 
Sbjct  8    RLLANRYAEKLQLCSP--QDPASFSLARAVHAHMIASGFKPRGHFLNRLLEMYCKSSNVV  65

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LF+EIP PD +ARTT++ AY A G+  L  EIF+ TPL MRD+VFYNA IT +
Sbjct  66   YARQLFEEIPNPDAIARTTLITAYCALGNLELGREIFNGTPLYMRDSVFYNAMITGY  122



>gb|KGN62652.1| hypothetical protein Csa_2G365100 [Cucumis sativus]
Length=816

 Score =   154 bits (388),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R LA+RYA  LQLCS     PA+ SLA A+HA+MI SGFKPR H LNRL+++YCKSSN+ 
Sbjct  27   RLLANRYAEKLQLCSP--QDPASFSLARAVHAHMIASGFKPRGHFLNRLLEMYCKSSNVV  84

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LF+EIP PD +ARTT++ AY A G+  L  EIF+ TPL MRD+VFYNA IT +
Sbjct  85   YARQLFEEIPNPDAIARTTLITAYCALGNLELGREIFNGTPLYMRDSVFYNAMITGY  141



>emb|CBI19832.3| unnamed protein product [Vitis vinifera]
Length=544

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R+LA++YAA LQ C    H P + S+A  +HA+MI SGFKPR +ILNRLID+YCKSS+L 
Sbjct  8    RRLANQYAAQLQQCCP--HNPMSYSIARTVHAHMIASGFKPRGYILNRLIDVYCKSSDLV  65

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             A HLFDEI QPDIVARTT++AA+S++G+ NLA EIF  TPL +RDTV YNA IT +
Sbjct  66   SAHHLFDEIRQPDIVARTTLIAAHSSAGNSNLAREIFFATPLGIRDTVCYNAMITGY  122



>ref|XP_008444805.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis melo]
Length=797

 Score =   150 bits (379),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R LA+RY A L LC      P++ SLA  +HA++I SGFK R HI+NRLID+Y KSS+  
Sbjct  8    RVLANRYVAQLNLCCP--QNPSSYSLARTVHAHVIASGFKLRGHIVNRLIDVYWKSSDFV  65

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LFDEIPQPD++ARTT++ AYSA G+  +A EIF+ TPL MRDTVFYNA IT +
Sbjct  66   YARQLFDEIPQPDVIARTTLITAYSALGNLKMAREIFNETPLDMRDTVFYNAMITGY  122



>ref|XP_008444772.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis melo]
Length=797

 Score =   150 bits (379),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 87/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R +A+RYA  LQLCS     PA+ SLA A+HA+MI SGFKPR H LNRL+++YCKSSNL 
Sbjct  8    RLVANRYAEKLQLCSP--QDPASFSLARAVHAHMIASGFKPRGHFLNRLLEMYCKSSNLV  65

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LFDEIP P  + RTT++ AY A G+  L  E+F+ TPL MRD+VFYNA IT +
Sbjct  66   YARQLFDEIPNPGAITRTTLITAYCALGNLELGREVFNGTPLYMRDSVFYNAMITGY  122



>ref|XP_006415862.1| hypothetical protein EUTSA_v10006846mg [Eutrema salsugineum]
 gb|ESQ34215.1| hypothetical protein EUTSA_v10006846mg [Eutrema salsugineum]
Length=787

 Score =   149 bits (376),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+RYAA+L+LC     T  +  LA A+H N+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANRYAANLRLCLPLRRT--SLQLARAVHGNIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L YAR LFDEI +PD +ARTTM++ Y ASGD  LA  +F+ TPLSMRDTV YNA IT 
Sbjct  65   LHYARQLFDEISEPDKIARTTMVSGYCASGDVTLARCVFEETPLSMRDTVMYNAMITG  122


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCK-SSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            HA  + SG      +LN L+ +Y K +S LS AR +FDEIP+ D  + TTM+  Y  +G 
Sbjct  172  HAAAMKSGAGYITSVLNALVSVYSKCASMLSSARKVFDEIPEKDERSWTTMITGYVKNGF  231

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +   ++ +    +MR  V YNA I+ +
Sbjct  232  FDSGQDLLEGMDENMR-LVAYNAMISGY  258



>gb|KJB26847.1| hypothetical protein B456_004G262700 [Gossypium raimondii]
Length=761

 Score =   149 bits (375),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 71/123 (58%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +3

Query  237  QGIYICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYC  416
            +G    R +A+RYA+ LQLC     T A+ SLA  IH++MIT GF PR H+LNRLID+Y 
Sbjct  2    KGSDFIRTVANRYASQLQLCYP--QTLASFSLAKTIHSHMITFGFHPRGHLLNRLIDVYS  59

Query  417  KSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARI  596
            KSS + YARHLFD+IP+PDI +RT++L AYS SGD   A ++F+ TPLS+RD+VFYNA I
Sbjct  60   KSSKIIYARHLFDQIPEPDIASRTSLLLAYSLSGDVKTAQKMFEETPLSIRDSVFYNAMI  119

Query  597  TAH  605
            T +
Sbjct  120  TGY  122



>gb|KFK44540.1| hypothetical protein AALP_AA1G270100 [Arabis alpina]
Length=795

 Score =   148 bits (373),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L+LC     T  +  LA A+H N+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIAHRYAANLRLCLPIRRT--SLQLARAVHGNIITYGFQPRAHILNRLIDVYCKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            LSYAR LFDEI +PD VARTTM++ Y AS D  LA  +F+ TPLSMRDTV YNA IT 
Sbjct  65   LSYARQLFDEISEPDKVARTTMVSGYCASRDIALARLVFEETPLSMRDTVMYNAMITG  122



>ref|XP_010477942.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Camelina sativa]
Length=790

 Score =   147 bits (372),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+ YAA L+LC     T  +  LA A+HAN+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANSYAASLRLCLPIRRT--SLQLARAVHANIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L YARHLFDEI +PD +A TTM++ Y ASGD  LA  +F+ TP+SMRDTV YNA IT 
Sbjct  65   LRYARHLFDEISEPDKIASTTMVSGYCASGDITLARGVFEETPVSMRDTVMYNAMITG  122



>ref|XP_002893429.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69688.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=790

 Score =   147 bits (371),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+RYAA+L+LC     T  +  LA A+H N+IT GF+P AHILNRLID+YCKSS 
Sbjct  7    LVRAIANRYAANLRLCLPLRRT--SLQLARAVHGNIITFGFQPHAHILNRLIDVYCKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L YAR LFDEI +PD +ARTTM++ Y ASGD  LA  +F+ TP+SMRDTV YNA IT 
Sbjct  65   LDYARQLFDEISEPDKIARTTMVSGYCASGDIALARSVFEETPVSMRDTVMYNAMITG  122



>ref|XP_006306802.1| hypothetical protein CARUB_v10008344mg [Capsella rubella]
 gb|EOA39700.1| hypothetical protein CARUB_v10008344mg [Capsella rubella]
Length=790

 Score =   147 bits (371),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+RYAA+L+LC     T  +  LA A+HAN+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANRYAANLRLCLPIRRT--SLQLARAVHANIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L YAR LFDEI +PD +ARTTM++ Y ASGD  LA  +F+ T +SMRDTV YNA IT 
Sbjct  65   LRYARELFDEISEPDKIARTTMVSGYCASGDITLARGVFEETSVSMRDTVMYNAMITG  122



>ref|NP_173907.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9FRI5.1|PPR57_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g25360 
[Arabidopsis thaliana]
 gb|AAG28801.1|AC079374_4 hypothetical protein [Arabidopsis thaliana]
 gb|AEE30612.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=790

 Score =   147 bits (370),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+RYAA+L+LC     T  +  LA A+H N+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANRYAANLRLCLPLRRT--SLQLARAVHGNIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L+YAR LFDEI +PD +ARTTM++ Y ASGD  LA  +F++ P+ MRDTV YNA IT 
Sbjct  65   LNYARQLFDEISEPDKIARTTMVSGYCASGDITLARGVFEKAPVCMRDTVMYNAMITG  122



>ref|XP_010499119.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Camelina sativa]
Length=790

 Score =   145 bits (365),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 71/118 (60%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A+ YAA L+LC     T  +  LA A+HAN+IT GF+PRAHILNRLID+YCKSS 
Sbjct  7    LVRAIANSYAASLRLCLPIRRT--SLQLARAVHANIITFGFQPRAHILNRLIDVYCKSSE  64

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            L YAR LFDEI +PD +A TTM++ Y ASGD  LA  +F+ TP+SMRDTV YNA IT 
Sbjct  65   LRYARQLFDEISEPDKIASTTMVSGYCASGDITLARGVFEETPVSMRDTVIYNAMITG  122



>ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis sativus]
 ref|XP_004162249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cucumis sativus]
 gb|KGN62675.1| hypothetical protein Csa_2G368270 [Cucumis sativus]
Length=797

 Score =   144 bits (364),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 70/117 (60%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R LA+RY A L LC       ++ SLA  +H ++I SGFK R HI+NRLIDIY KSS+  
Sbjct  8    RVLANRYFAQLNLCCP--QNLSSYSLARTVHGHVIASGFKLRGHIVNRLIDIYWKSSDFV  65

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LFDEIPQPD++ARTT++ AYSA G+  +A EIF+ TPL MRDTVFYNA IT +
Sbjct  66   YARKLFDEIPQPDVIARTTLITAYSALGNLKMAREIFNETPLDMRDTVFYNAMITGY  122



>ref|XP_002521664.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40651.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=574

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R  A+ YA+ LQLC     +P +   A  IHA+MI SGFKP  H LNRLI IYCKSS LS
Sbjct  12   RTAANHYASLLQLCCP--QSPISYPFARTIHAHMIASGFKPHGHTLNRLIYIYCKSSKLS  69

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LFDEIPQPDIVARTT++ AYSA+G   LA E+F  TPL MRD V YNA ITA+
Sbjct  70   YARSLFDEIPQPDIVARTTLINAYSATGHLKLAKEMFYETPLIMRDAVIYNAMITAY  126



>ref|XP_008228975.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Prunus mume]
Length=849

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 2/120 (2%)
 Frame = +3

Query  246  YICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSS  425
            +I   +A RY A LQLC     +P + S+A   HA+MI SGFKP  HILNRLID+Y KS 
Sbjct  57   FIFFTVAHRYLAQLQLCCP--QSPVSYSIARTTHAHMIVSGFKPCGHILNRLIDVYYKSL  114

Query  426  NLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            N SYA  LFD+IP+PDIVARTT++ AYSA G+  LA +IF+ TPLSMRDTV YNA IT +
Sbjct  115  NFSYAHQLFDQIPKPDIVARTTLITAYSAIGNLTLARKIFNETPLSMRDTVCYNAMITGY  174



>ref|XP_010549219.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Tarenaya hassleriana]
Length=789

 Score =   141 bits (356),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 69/116 (59%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R +A+RYAA+L+LC     T A+  LA +IHAN+  SGF+PRAHI+NRLID YCKSS L 
Sbjct  9    RIIANRYAAYLRLCFPP--TGASLPLALSIHANITASGFRPRAHIVNRLIDFYCKSSKLD  66

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            YAR LFDEIP+ D +ART+M++ YS SG+  L+  +F  TPLS+RDT+ YNA ITA
Sbjct  67   YARTLFDEIPKQDGIARTSMISGYSNSGNIKLSCRVFLETPLSLRDTIMYNAMITA  122



>ref|XP_004495263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Cicer arietinum]
Length=795

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R +A RY   L       HT A  +LA AIHA++ITSGF P   ILNRLI+IYCKSSN++
Sbjct  4    RDMAYRYLTQLT------HTSATKTLARAIHAHIITSGFTPNTFILNRLINIYCKSSNIT  57

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LFD+IP+PDIVARTT+L+AYS+SG+  LA E+F+ TPL++ DTV YNA ITA+
Sbjct  58   YARKLFDKIPKPDIVARTTLLSAYSSSGNIKLAQELFNTTPLTIHDTVSYNAMITAY  114



>ref|XP_010672235.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Beta vulgaris subsp. vulgaris]
Length=813

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +3

Query  192  MKNGAAAAKSF--ESWAQGIYICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITS  365
            M+N A  A +F   ++ Q I   R+LA+RYAA LQLC     +P + S A AIHA+M TS
Sbjct  1    MRNAAQYAINFTRNNFPQQIDF-RELANRYAAQLQLCCPP--SPTSHSRARAIHAHMTTS  57

Query  366  GFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            GF PR H+++RLIDIYCKS NL YA  LFD++P+PDIVARTTM++AY    D   A  IF
Sbjct  58   GFNPRGHLIDRLIDIYCKSKNLVYAHRLFDKMPEPDIVARTTMVSAYCNLRDMKEARRIF  117

Query  546  DRTPLSMRDTVFYNARITAH  605
            D  PL +RD V YNA IT +
Sbjct  118  DEIPLRIRDVVSYNAMITGY  137



>gb|EPS72239.1| hypothetical protein M569_02517, partial [Genlisea aurea]
Length=786

 Score =   140 bits (352),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 2/116 (2%)
 Frame = +3

Query  258  QLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSY  437
            + A+ YA  L+LC      PA  SLA  +H +MI SGF PR HILNRLID+YCKSS   Y
Sbjct  4    EAANLYAGKLRLCWEK--GPAGYSLAGGVHGHMIVSGFIPRRHILNRLIDMYCKSSCFDY  61

Query  438  ARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            AR +FDEIPQPD+V RTT++AAYS+ G+P +A  +FD TP+ +RD + YNA IT +
Sbjct  62   ARKMFDEIPQPDVVTRTTLIAAYSSYGNPKMARVLFDATPVGIRDNICYNAMITCY  117


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H  +I SG      +LN L+ +Y K  +++ AR LFDE+   D ++ TT++A Y  + D
Sbjct  166  LHCAVIKSGCGQVTSVLNALVSVYVKCESMASARLLFDEMVHKDELSWTTIIAGYVKNDD  225

Query  522  PNLAAEIFD  548
               A E+FD
Sbjct  226  LAAAREVFD  234



>ref|XP_003590744.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES60995.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=795

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R LA RY   L       H      +A A+HA+++TSGFKP   ILNRLI+IYCKSSN++
Sbjct  4    RDLAYRYLTQLN------HVSTTQIIARAVHAHILTSGFKPNTFILNRLINIYCKSSNIT  57

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            YAR LFD+IP+PDIVARTT+L+AYS+SG+  LA ++F+ TPL++RDTV YNA ITA+
Sbjct  58   YARKLFDKIPKPDIVARTTLLSAYSSSGNVKLAQQLFNATPLTIRDTVSYNAMITAY  114



>ref|XP_009378934.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Pyrus x bretschneideri]
Length=759

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLA  533
            MI SGF PR HILNRLIDIYCKSSN+ YAR LFD+IP+PDIVARTT++ AYS  G+  LA
Sbjct  1    MIASGFSPRGHILNRLIDIYCKSSNIRYARQLFDKIPKPDIVARTTLVKAYSVIGNLTLA  60

Query  534  AEIFDRTPLSMRDTVFYNARITAH  605
             +IFD TPLSMRDTV YNA IT H
Sbjct  61   RKIFDETPLSMRDTVSYNAMITGH  84



>gb|KCW67919.1| hypothetical protein EUGRSUZ_F01621 [Eucalyptus grandis]
Length=759

 Score =   132 bits (332),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLA  533
            MI SG KPR HI+NRLID+YCKSSN+ YARHLFD IPQPD+VARTT++AAY+ +G   LA
Sbjct  1    MIASGLKPRGHIVNRLIDVYCKSSNIGYARHLFDGIPQPDVVARTTLIAAYAGAGGLKLA  60

Query  534  AEIFDRTPLSMRDTVFYNARITAH  605
             EIFD TPL MRDTV YNA IT +
Sbjct  61   REIFDGTPLGMRDTVCYNAMITGY  84



>ref|XP_004301492.2| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Fragaria vesca subsp. vesca]
Length=754

 Score =   130 bits (326),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 59/84 (70%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLA  533
            MI SGF PR HILNRLID+YCKS+NL YA HLFDEIP PDIVARTT+++AYS  GD  LA
Sbjct  1    MIASGFSPRGHILNRLIDVYCKSNNLRYALHLFDEIPNPDIVARTTLVSAYSGVGDVTLA  60

Query  534  AEIFDRTPLSMRDTVFYNARITAH  605
              +F  TP+SMRDTV YNA IT +
Sbjct  61   RRVFRETPVSMRDTVSYNAMITGY  84



>ref|XP_007144135.1| hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris]
 gb|ESW16129.1| hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris]
Length=787

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R + +RY A L       HT    SLA A+HA+++TSGF P   I+NRLID YCKSSN+ 
Sbjct  4    RTMGNRYLAQLT------HT----SLARAVHAHILTSGFNPFPLIINRLIDHYCKSSNIP  53

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            YARHLFD+I +PDIVA TT+L+AYSA+G+  LA ++F+ TPL++RDTV YNA ITA
Sbjct  54   YARHLFDKISKPDIVATTTLLSAYSAAGNIKLAHQLFNATPLTIRDTVSYNAMITA  109



>ref|XP_003535453.2| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Glycine max]
Length=787

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 85/114 (75%), Gaps = 10/114 (9%)
 Frame = +3

Query  261  LASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYA  440
            + +RY A L       HT    S A A+HA+++TSGFKP   I+NRLID YCKS N+ YA
Sbjct  6    MGNRYLAQLS------HT----SFARAVHAHILTSGFKPFPLIINRLIDHYCKSFNIPYA  55

Query  441  RHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            R+LFD+IP+PDIVA TTML+AYSA+G+  LA ++F+ TP+S+RDTV YNA ITA
Sbjct  56   RYLFDKIPKPDIVAATTMLSAYSAAGNIKLAHQLFNATPMSIRDTVSYNAMITA  109



>ref|XP_010942837.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Elaeis guineensis]
Length=818

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 86/129 (67%), Gaps = 13/129 (10%)
 Frame = +3

Query  258  QLASRYAAHLQLCSSNIHTPAASSLAT-----------AIHANMITSGFKPRAHILNRLI  404
            +LA+R+AAHLQL S+ +   +AS  AT           A+HA+++ SGFKPRAHILNRLI
Sbjct  20   KLANRFAAHLQLLSAVLPKTSASPPATTSPTPLLRRLRALHAHVLASGFKPRAHILNRLI  79

Query  405  DIYCKSSNLSYARHLF--DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTV  578
            D+Y KS +L  AR LF        D VA T+++ AY+ASG   LA  +FDRTPL  RDTV
Sbjct  80   DLYAKSGDLPSARCLFDAASPAPADAVAATSLVNAYAASGHLPLARRLFDRTPLPARDTV  139

Query  579  FYNARITAH  605
            FYNA I+++
Sbjct  140  FYNAMISSY  148



>ref|XP_008787226.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Phoenix dactylifera]
Length=817

 Score =   104 bits (259),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 53/91 (58%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +3

Query  339  AIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEI-PQP-DIVARTTMLAAYSA  512
            A+HA+++ SGFKPRAHILNRLID+Y K+ +L  AR LFD   P P D VA T+++ AY+A
Sbjct  57   ALHAHILASGFKPRAHILNRLIDLYAKAGDLPSARRLFDAASPAPTDAVAATSLVNAYAA  116

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +G   LA  +FDRTPL  RDTVFYNA I+ +
Sbjct  117  AGHLPLARCLFDRTPLPARDTVFYNAMISGY  147



>ref|XP_009394346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 
[Musa acuminata subsp. malaccensis]
Length=799

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 68/91 (75%), Gaps = 2/91 (2%)
 Frame = +3

Query  339  AIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP--QPDIVARTTMLAAYSA  512
            A+HA+++ SGFKPRAHILNRLID+Y KS +L  AR LFD     + D +A T+++ AYSA
Sbjct  39   AVHAHILASGFKPRAHILNRLIDLYSKSGDLPSARRLFDATTARRHDSIAATSLITAYSA  98

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             G  + A +IFD TPL+ RDTVFYNA I+++
Sbjct  99   GGHLDAARQIFDHTPLASRDTVFYNAMISSY  129



>ref|XP_006841418.1| hypothetical protein AMTR_s00003p00032470 [Amborella trichopoda]
 gb|ERN03093.1| hypothetical protein AMTR_s00003p00032470 [Amborella trichopoda]
Length=791

 Score =   100 bits (250),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = +3

Query  270  RYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            R A+ LQ  +     P       AIHA +ITSG KPRAH+LN LI  YC + +L  A H+
Sbjct  24   RLASLLQASTRTQSRPRGR----AIHAVIITSGLKPRAHLLNLLIAFYCSTEDLKCAHHV  79

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            FD +PQ D+VARTT+LAA++ SG   +A +IFD  P   RD V YNA I+A+
Sbjct  80   FDRMPQRDVVARTTLLAAHARSGALAVAHQIFDEMP--TRDAVAYNAMISAY  129



>ref|XP_006841563.1| hypothetical protein AMTR_s00003p00182540 [Amborella trichopoda]
 gb|ERN03238.1| hypothetical protein AMTR_s00003p00182540 [Amborella trichopoda]
Length=689

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = +3

Query  321  ASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            + S   AIHA +ITSG KPRAH+LN LI  YC + +L+ A H+FD +PQ D+VARTT+LA
Sbjct  22   SRSQGRAIHALIITSGLKPRAHLLNPLIAFYCSTEDLTCAHHVFDRMPQRDVVARTTLLA  81

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYN  587
             ++ +G   +  ++FDR P   RDT+ +N
Sbjct  82   THACAGALAVVRQLFDRMP--TRDTMVFN  108



>ref|XP_010938946.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Elaeis guineensis]
Length=811

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/89 (53%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +3

Query  339  AIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASG  518
            A HA+++  GFKPRAHILNRL+DIY K+ +L  ARHLFD     +  A T+++ AY+A+G
Sbjct  54   AFHAHILAFGFKPRAHILNRLVDIYAKAGDLPSARHLFDAA-PAEAAAATSLVNAYAAAG  112

Query  519  DPNLAAEIFDRTPLSMRDTVFYNARITAH  605
               LA  +FD  PL  RDTVFYNA I+++
Sbjct  113  CLPLARRLFDCIPLPARDTVFYNAMISSY  141



>ref|XP_008805705.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like 
[Phoenix dactylifera]
Length=812

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/89 (52%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = +3

Query  339  AIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASG  518
            A+HA+++ SGFKPRAHILNRL+D+Y K+ +L  AR LFD     D  A T+++ AY+A+G
Sbjct  54   ALHAHILASGFKPRAHILNRLVDLYAKAGDLPSARLLFDAAAPADAAAATSLVNAYAATG  113

Query  519  DPNLAAEIFDRTPLSMRDTVFYNARITAH  605
               LA  +FD  PL  RDTVFYN+ I+ +
Sbjct  114  RLPLARRLFDCIPLPSRDTVFYNSMISGY  142



>gb|KFK44541.1| hypothetical protein AALP_AA1G270100 [Arabis alpina]
Length=769

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 53/118 (45%), Positives = 64/118 (54%), Gaps = 28/118 (24%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            + R +A RYAA+L+LC     T  +  LA A+H                           
Sbjct  7    LVRAIAHRYAANLRLCLPIRRT--SLQLARAVH--------------------------E  38

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            LSYAR LFDEI +PD VARTTM++ Y AS D  LA  +F+ TPLSMRDTV YNA IT 
Sbjct  39   LSYARQLFDEISEPDKVARTTMVSGYCASRDIALARLVFEETPLSMRDTVMYNAMITG  96



>ref|XP_010100885.1| hypothetical protein L484_009655 [Morus notabilis]
 gb|EXB85809.1| hypothetical protein L484_009655 [Morus notabilis]
Length=879

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            H  MI SGF+P   ++N LI +Y K SNL YA   FDE+P+ D V+  TM++ YS  G  
Sbjct  64   HCRMIVSGFEPTVFVMNCLIQMYVKCSNLEYASKTFDEMPERDSVSWNTMISGYSVRGKM  123

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A  +FD  P   RD V +N+ I+ +
Sbjct  124  EIAQSLFDAMP--RRDVVSWNSLISGY  148



>ref|XP_011009234.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
 ref|XP_011009241.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
 ref|XP_011009249.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Populus euphratica]
Length=743

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
            A  +H  +I S   P   + N LI+ Y K  N++YARHLFD++PQP+  +  TML+AYS 
Sbjct  24   AKKLHCLIIKSLTNPETFLYNNLINAYSKLGNITYARHLFDKMPQPNSFSWNTMLSAYSK  83

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            SGD +   EIF   P   RD V +N+ I+ +
Sbjct  84   SGDLSTMQEIFSIMP--SRDGVSWNSLISGY  112



>ref|XP_010257871.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g02330 [Nelumbo nucifera]
Length=875

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MITSGF P   + N LI++Y + SN+ YA  +F+ +PQ D V+   M++ Y+  G  
Sbjct  60   HAQMITSGFSPTVFVTNCLINMYIRCSNIDYASKVFERMPQRDTVSWNAMISGYAGCGSM  119

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
            +LA  IFD  P   RD + +N+ I+ +
Sbjct  120  DLAQSIFDSMP--ERDVISWNSLISGY  144


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 47/93 (51%), Gaps = 4/93 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            YA  L  C++     A   L   +HA +I    +    I + L+D+Y K  N+  +R +F
Sbjct  577  YATVLDTCAN----LATIGLGRQVHAQVIKQEMQSDVFISSTLVDMYSKCGNMQDSRLMF  632

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDR  551
            +++P+ D V+   M+  Y+  G    A +IF+R
Sbjct  633  EKMPKKDFVSWNAMITGYAQHGLGEEALKIFER  665



>ref|XP_010091655.1| hypothetical protein L484_026509 [Morus notabilis]
 gb|EXB44921.1| hypothetical protein L484_026509 [Morus notabilis]
Length=743

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 6/107 (6%)
 Frame = +3

Query  285  LQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP  464
            L+LC    +     +LA  +H +++ +   P   + N+LID Y K   + YARHLFD++P
Sbjct  12   LKLCCETQN----QALAKKLHGHIVRNLTNPEIFLSNKLIDAYGKLGKVRYARHLFDQMP  67

Query  465  QPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            Q ++ +  T+L+AYS SG  +   EIFDR P   RD V +NA I+ +
Sbjct  68   QRNLFSWNTILSAYSKSGYLSEMQEIFDRMP--SRDGVTWNALISGY  112



>ref|XP_007139372.1| hypothetical protein PHAVU_008G023900g [Phaseolus vulgaris]
 gb|ESW11366.1| hypothetical protein PHAVU_008G023900g [Phaseolus vulgaris]
Length=891

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI +GF P  ++ N LI  YCK SN+ YA ++FD +P+ D+++  TM+  Y+  G+ 
Sbjct  68   HAQMIVTGFVPNIYVANCLIQFYCKGSNMGYAFNVFDRMPERDVISWNTMIFGYAGVGNM  127

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A  +FD  P   RD V +N+ ++ +
Sbjct  128  GFAQSLFDTMP--ERDVVSWNSLLSCY  152



>ref|XP_008783105.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Phoenix dactylifera]
Length=889

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MIT+GF P   + N L+ +Y + SNL YAR +FD +P+ D ++   M++ YS SG  
Sbjct  68   HAQMITTGFVPTTFVANCLMHMYVRCSNLDYARKVFDRMPEKDTISWNAMISGYSESGAM  127

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A  +FD  P   RD + +N+ I+ +
Sbjct  128  GIAESLFDAIP--ERDVISWNSLISGY  152



>ref|XP_002314911.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEF01082.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=743

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
            A  +H  +I S   P   + N LI+ Y K  N++YARH+FD++PQP+  +  TML+AYS 
Sbjct  24   AKKLHCLIIKSLTNPETFLYNNLINAYSKLGNITYARHVFDKMPQPNSFSWNTMLSAYSK  83

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            SGD +   EIF   P   RD V +N+ I+ +
Sbjct  84   SGDLSTMQEIFSIMP--NRDGVSWNSLISGY  112



>ref|XP_006841561.1| hypothetical protein AMTR_s00003p00181560 [Amborella trichopoda]
 gb|ERN03236.1| hypothetical protein AMTR_s00003p00181560 [Amborella trichopoda]
Length=379

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 10/110 (9%)
 Frame = +3

Query  279  AHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDE  458
            A L   S+  H+    S   AIHA +ITSG KPR H+L   I  YC + +L+ A ++FD 
Sbjct  26   ASLHQASTRTHS---RSQGRAIHALIITSGLKPRVHLL---IAFYCSTEDLTCAHYVFDR  79

Query  459  IPQPDIVARTTMLAAYSASGDPNLAA--EIFDRTPLSMRDTVFYNARITA  602
            +PQ D+V+RTT+LAA+  +G   LA   ++FD  P S  DTV YN  I+A
Sbjct  80   MPQRDVVSRTTLLAAHGRAGARALAVARQLFDEMPTS--DTVAYNTIISA  127



>ref|XP_010929076.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Elaeis guineensis]
Length=889

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF P   + N L+ +Y + SNL YAR +FD +P+ D ++   M++ YS SG  
Sbjct  68   HARMIASGFVPTIFVANCLMHMYTRCSNLDYARKVFDRMPEKDTISWNAMISGYSQSGAM  127

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A  +FD  P   RD + +N+ I+ +
Sbjct  128  GIAESLFDAMP--ERDVISWNSLISGY  152



>gb|KJB80450.1| hypothetical protein B456_013G098500 [Gossypium raimondii]
Length=743

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            Y + L++C+   +     S A  IH +++ +   P   +LN L++ Y K  +L+YAR+LF
Sbjct  8    YCSLLKICTETRN----RSQAKKIHCHILRTIKDPETFLLNNLVNAYGKLGDLTYARNLF  63

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            D+IPQP++ +  T+L  YS SG+ +   +IF+R P   RD V +N+ I+ +
Sbjct  64   DKIPQPNLFSWNTILFTYSKSGNLSDMNDIFNRMP--KRDGVSWNSLISGY  112



>ref|XP_003551787.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Glycine max]
Length=852

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/107 (34%), Positives = 60/107 (56%), Gaps = 6/107 (6%)
 Frame = +3

Query  285  LQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP  464
            LQ CS+      A +    +H  MI +GF P  ++ N L+  YCKSS ++YA  +FD +P
Sbjct  13   LQKCSN----LKALNPGKQVHTQMIVTGFVPTIYVANCLLQFYCKSSKMNYAFKVFDRMP  68

Query  465  QPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            Q D+++  T++  Y+  G+   A  +FD  P   RD V +N+ ++ +
Sbjct  69   QRDVISWNTLIFGYAGIGNMGFAQSLFDSMP--ERDVVSWNSLLSCY  113



>ref|XP_004303223.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Fragaria vesca subsp. vesca]
Length=857

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA M+ SGF P   + N LI +Y K   L YA  +FDE+PQ D V+  TM+  Y+ SGD 
Sbjct  50   HARMLISGFDPTVFVSNCLIQMYLKCRVLRYAAKVFDEMPQRDTVSWNTMIFGYAESGDM  109

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             LA   FD  P   RD V +N+ ++ +
Sbjct  110  GLAQACFDAMP--ARDVVSWNSLVSGY  134



>gb|EYU39396.1| hypothetical protein MIMGU_mgv1a026743mg, partial [Erythranthe 
guttata]
Length=670

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 64/117 (55%), Gaps = 6/117 (5%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R  AS YAA LQLC        A      +H+++  SGF P   I N+++D+YCK  ++S
Sbjct  61   RPSASLYAAVLQLCIEK----RALDEGKRVHSHIKGSGFAPGVFISNKILDLYCKCESIS  116

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             AR LFDE+   D+ +  T+++ Y+  G  + A ++FD  P   RD   + A I+ +
Sbjct  117  DARKLFDEMGDRDVCSWNTLISGYAKMGRVSEARKLFDEMP--KRDNFSWTAMISGY  171


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+       A  L   +H  M+  GF P +   + L+ +Y K  ++  A  +F
Sbjct  301  FAGVLNACAHQ----TAEELGRQVHGLMMRIGFDPSSFAASALVHMYTKCGSVERANRVF  356

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
            + +P+PD+V+ T+++  Y+ +G P+ A ++FD
Sbjct  357  NWLPKPDLVSYTSLINGYAQNGQPHEALKLFD  388



>gb|KJB48770.1| hypothetical protein B456_008G086200 [Gossypium raimondii]
Length=597

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
              T +HA  I SGFKP +H+ N L+ +Y K+ +L+    +F+EI  PD+ + TTML++ S
Sbjct  101  FGTKLHAYAIKSGFKPYSHVSNTLLFLYSKTHHLASVERVFNEIEHPDVYSWTTMLSSCS  160

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
              G  + A E+FD+ P   ++   +N  +T 
Sbjct  161  KLGGISYACEVFDKMP--KKEVAVWNVMVTG  189



>ref|XP_003530462.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Glycine max]
Length=852

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI + F P  ++ N L+  YCKSSN++YA  +FD +P  D+++  TM+  Y+  G+ 
Sbjct  29   HAQMIVTSFVPTIYVANCLVQFYCKSSNMNYAFKVFDRMPHRDVISWNTMIFGYAEIGNM  88

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A  +FD  P   RD V +N+ ++ +
Sbjct  89   GFAQSLFDTMP--ERDVVSWNSLLSCY  113


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            YA  L +C++     A   L   IHA ++        +I + L+D+Y K  N+  +R +F
Sbjct  545  YATVLDVCANM----ATIELGKQIHAQILKLNLHSDVYIASTLVDMYSKCGNMQDSRLMF  600

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPL  560
            ++ P+ D V  + M+ AY+  G    A ++F+   L
Sbjct  601  EKTPKRDYVTWSAMICAYAYHGHGEQAIKLFEEMQL  636



>ref|XP_002520145.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF42200.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=327

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = +3

Query  321  ASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            A  +  A+H  +I  GF    H+ + LI +Y +   L + R +FD IPQPD+V +T M++
Sbjct  99   AKEIGLAVHGCVIKYGFGLDPHVQSGLIFMYAELGCLGFCRQVFDLIPQPDLVCQTAMVS  158

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            A S  GD   A E+FD  P   RD + ++A I  +
Sbjct  159  ACSKCGDVGFARELFDSMP--HRDHIAWSAMIAGY  191



>ref|XP_008389362.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Malus domestica]
Length=743

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            ++ Y   L+LCS       + + A  +H  +I +   P   +LN L+  Y +  NLSYAR
Sbjct  5    SNYYCNLLKLCSQ----AGSHAQAKKLHCYIIKTVTNPETFLLNNLVTTYGRLGNLSYAR  60

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            H+FD+IP   + +   +L+ YS SG  +   +IF+R P   RD V +N+ I+ H
Sbjct  61   HVFDQIPHRTLFSWNAILSVYSKSGHISEMQDIFNRMP--SRDGVSWNSVISGH  112



>ref|XP_002533488.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF28892.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=939

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF P  +I N L+ +Y + S+L+YA  +F+++ Q D+++  TM++ Y+ +G+ 
Sbjct  66   HARMIVSGFIPDVYISNCLMKMYLRCSHLNYAYKVFEKMSQRDVISYNTMISGYADAGEM  125

Query  525  NLAAEIFDRTPLSMRDTVFYNARITA  602
            NLA E F  TP   RD V +N+ ++ 
Sbjct  126  NLANEFFYDTP--KRDVVSWNSMLSG  149



>ref|XP_008243776.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Prunus mume]
Length=743

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/91 (38%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
            A  +H ++I +   P   +LN +I  Y +  NL YARH+FD++P P + +   +L+ YS 
Sbjct  24   AKKLHCHIIKTLTSPETFLLNNIITTYGRLGNLRYARHVFDQMPHPTLFSWNAILSVYSK  83

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            SG  +   EIFDR P   RD V +N+ I+ H
Sbjct  84   SGYLSDMQEIFDRMP--RRDGVSWNSFISGH  112



>ref|XP_009356472.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Pyrus x bretschneideri]
Length=743

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            ++ Y   L+LCS         + A  +H +++ +   P   +LN L+  Y K  NLSYAR
Sbjct  5    SNYYCNLLKLCSQ----AGNHAQARKLHCHIVKTVTNPETFLLNNLVTTYGKLGNLSYAR  60

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            H+FD+IP   + +   +L+ YS SG  +   +IF+R P   RD V +N+ I+ H
Sbjct  61   HVFDQIPHRTLFSWNAILSVYSKSGHISEMQDIFNRRP--SRDGVSWNSVISGH  112



>gb|KDO79338.1| hypothetical protein CISIN_1g038936mg, partial [Citrus sinensis]
Length=476

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = +3

Query  267  SRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARH  446
            S Y++ +Q C  N     A      +H+++ +SGFKP   I N L+D+Y K  N+S A+ 
Sbjct  27   SIYSSLIQFCRQN----RALEEGKKVHSHLKSSGFKPGVFISNCLLDMYAKCGNISDAQT  82

Query  447  LFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            LFDE+ + D+ +  TM++ ++  G    A  +FD  P   RD   + A I+ +
Sbjct  83   LFDEMQERDVCSYNTMISGFTKGGSLEQARNLFDEMP--QRDNFSWTAMISGY  133


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+ +    AA  L   +H  M   G+ P +   + L+ +Y K  N+  ++ +F
Sbjct  263  FAGVLNACADH----AAEELGKQVHGYMTRIGYDPYSFAASALVHMYSKCGNVENSKKVF  318

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
            + +P+PD+V+ T+++A Y+ +G P+ A E F+
Sbjct  319  NGMPRPDLVSWTSLIAGYAQNGMPDKALEYFE  350



>ref|XP_010694524.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Beta vulgaris subsp. vulgaris]
Length=872

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF+P   + N L+ +Y K S L YA  +FD++PQ D V+  +M+  YS  G  
Sbjct  66   HAQMIVSGFEPTIFVTNCLLQMYIKCSRLGYAHKVFDQMPQRDTVSWNSMIFGYSGEGKM  125

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A  +FD  P   RD V +N  I+++
Sbjct  126  KVAQILFDLMP--KRDVVSWNTLISSY  150



>ref|XP_006878551.1| hypothetical protein AMTR_s00011p00233950 [Amborella trichopoda]
 gb|ERM94696.1| hypothetical protein AMTR_s00011p00233950 [Amborella trichopoda]
Length=607

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 66/117 (56%), Gaps = 7/117 (6%)
 Frame = +3

Query  258  QLASRYAAHLQLCSSNIHTPAASSLATAIHANMITS-GFKPRAHILNRLIDIYCKSSNLS  434
            Q A  YA+ LQ C+       A      +H++M++S  F+P   + NRL+D+Y K ++L+
Sbjct  115  QFAPIYASLLQACAQQ----RALDEGKTVHSHMLSSPSFEPGLFLFNRLLDVYIKCNSLN  170

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             AR LFDE+ Q DI +  T++A Y   GD   A ++FD   +  RD   +++ I+ +
Sbjct  171  QARQLFDEMTQKDICSYNTLIAGYCKVGDLCNAKKLFDE--MDQRDNFSWSSIISGY  225


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            AA  L   +H  M+ +GF P    ++ L+D+Y K  N+  A ++F  IP PD++  T ++
Sbjct  367  AAEKLGREVHGYMVRAGFDPSGSSVSALVDMYAKCGNIKSAENIFQSIPNPDLITWTAII  426

Query  498  AAYSASGDPNLAAEIFD  548
            +  + +G    A + F+
Sbjct  427  SGSAKNGRDLEALQYFE  443


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/68 (34%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +HA++  +G +  A + + L D+Y K  +++ AR++FD I + D VA TTM+  Y  +G 
Sbjct  273  LHAHITRTGLESDAIVWSALSDMYAKCGSITEARYVFDRILERDTVAWTTMIGRYVQAGQ  332

Query  522  PNLAAEIF  545
             + A ++F
Sbjct  333  ASEALQLF  340



>ref|XP_006406355.1| hypothetical protein EUTSA_v10020511mg [Eutrema salsugineum]
 gb|ESQ47808.1| hypothetical protein EUTSA_v10020511mg [Eutrema salsugineum]
Length=522

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 54/111 (49%), Gaps = 4/111 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            Y   L+LCS              IH N +TSG        NRL+D+Y K  ++ +AR LF
Sbjct  44   YIKALKLCS----CQNVGKQVLLIHGNSLTSGLGSNLKFNNRLMDLYAKQGDMKHARKLF  99

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            D IP+ D+V+ T M++ +S  G    A  +F +     RD V +N  I  +
Sbjct  100  DRIPKRDVVSWTVMISGFSECGRHEDALLLFKQIRPEERDVVSWNVMINGY  150



>ref|XP_008237416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Prunus mume]
Length=734

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
              T +HA+ I +G K   H+ N L+ +Y K+ NL+  + +FDEI  PD+ + TT+L+A +
Sbjct  75   FGTQLHAHAIRTGLKAYPHVANTLLSLYAKAENLNSVKWVFDEIENPDVYSWTTLLSACT  134

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
              G  + A+++FD  P   R+   +NA IT 
Sbjct  135  KLGHVDYASKLFDTMP-EKRNVAIWNAMITG  164



>ref|XP_009767912.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Nicotiana sylvestris]
Length=842

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K SNL YA  +FD++P  D V+   M+  YS   D 
Sbjct  47   HARMIISGFQPTIFVTNCLIQMYIKCSNLGYADKVFDKMPLRDTVSWNAMIFGYSMVNDM  106

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A  +FD  P   RD + +N+ I+ H
Sbjct  107  EKAKLMFDLMP--ERDVISWNSMISGH  131


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 47/96 (49%), Gaps = 4/96 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            YA  L  C++     A   L   IHA +I    +    I + L+D+Y K  N+  +R +F
Sbjct  563  YATVLDACAN----LATVGLGKQIHAQIIKQELQSDVFITSTLVDMYSKCGNMQDSRLMF  618

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPL  560
            ++ P+ D V    M+  Y+  G  + A +IF++  L
Sbjct  619  EKAPKKDFVTWNAMVCGYAQHGLGDEALQIFEKMQL  654



>ref|XP_006466653.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Citrus sinensis]
Length=695

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = +3

Query  267  SRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARH  446
            S Y++ +Q C  N     A      +H+++ +SGFKP   I N L+D+Y K  NLS AR 
Sbjct  90   SIYSSLIQFCRQN----RALEEGKKVHSHLKSSGFKPGVFISNCLLDMYAKCGNLSDART  145

Query  447  LFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            LFDE+ + D+ +  TM++ Y+  G    A  +FD  P   RD   + A I+ +
Sbjct  146  LFDEMHERDVCSYNTMISGYTKVGFLEQARNLFDEMP--QRDNFSWTAIISGY  196


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R  A  +A  L  C+ +    AA  L   +H  M   G+ P +   + L+ +Y K  N+ 
Sbjct  320  RPNAFTFAGVLNACADH----AAEELGKQVHGYMTRIGYDPYSFAASALVHMYSKCGNVE  375

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
             ++ +F+ +P+PD+V+ T+++A Y+ +G P+ A E F+
Sbjct  376  NSKKVFNGMPRPDLVSWTSLIAGYAQNGMPDKALEYFE  413



>ref|XP_006425825.1| hypothetical protein CICLE_v10024955mg [Citrus clementina]
 gb|ESR39065.1| hypothetical protein CICLE_v10024955mg [Citrus clementina]
Length=759

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = +3

Query  267  SRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARH  446
            S Y++ +Q C  N     A      +H+++ +SGFKP   I N L+D+Y K  NLS AR 
Sbjct  154  SIYSSLIQFCRQN----RALEEGKKVHSHLKSSGFKPGVFISNCLLDMYAKCGNLSDART  209

Query  447  LFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            LFDE+ + D+ +  TM++ Y+  G    A  +FD  P   RD   + A I+ +
Sbjct  210  LFDEMHERDVCSYNTMISGYTKVGFLEQARNLFDEMP--QRDNFSWTAIISGY  260


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 29/98 (30%), Positives = 54/98 (55%), Gaps = 4/98 (4%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            R  A  +A  L  C+ +    AA  L   +H  M   G+ P +   + L+ +Y K  N+ 
Sbjct  384  RPNAFTFAGVLNACADH----AAEELGKQVHGYMTRIGYDPYSFAASALVHMYSKCGNVE  439

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
             ++ +F+ +P+PD+V+ T+++A Y+ +G P+ A E F+
Sbjct  440  NSKKVFNGMPRPDLVSWTSLIAGYAQNGMPDKALEYFE  477



>ref|XP_009395862.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Musa acuminata subsp. malaccensis]
Length=841

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA M+ SGF P   + N LI +Y   SNL YA  +F  +PQ D V+   M+A Y+ +G  
Sbjct  23   HARMLVSGFVPTTFVANCLIHMYITCSNLDYAHQVFVRMPQRDTVSWNAMIAGYARNGSV  82

Query  525  NLAAEIFDRTPLSMRDTVFYNARITA  602
            ++A  +FDR P   RD + +N+ ++ 
Sbjct  83   DVAKSLFDRMP--ERDVISWNSLMSG  106



>ref|XP_009373813.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Pyrus x bretschneideri]
Length=892

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF P   + N LI +Y K   L YA  +FD +PQ D+V+  TM+  Y+ SG  
Sbjct  72   HARMIVSGFDPTVFVTNCLIQMYVKCGVLQYAGKVFDGMPQRDMVSWNTMVFGYAGSGKM  131

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A   FD  P   RD V +N+ I+ +
Sbjct  132  GFAQSCFDAMP--ERDVVSWNSLISGY  156



>emb|CBI16904.3| unnamed protein product [Vitis vinifera]
Length=843

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI + FKP   + N LI +Y K S+L +A  +FD +PQ D V+   ML  Y+  GD 
Sbjct  65   HARMILTEFKPTVFVTNCLIQMYIKCSDLEFAFKVFDGMPQRDTVSWNAMLFGYAGRGDI  124

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A ++FD  P   RD V +N+ I+ +
Sbjct  125  GVAQKLFDAMP--ERDVVSWNSLISGY  149



>ref|XP_002278668.2| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
isoform X1 [Vitis vinifera]
Length=877

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI + FKP   + N LI +Y K S+L +A  +FD +PQ D V+   ML  Y+  GD 
Sbjct  65   HARMILTEFKPTVFVTNCLIQMYIKCSDLEFAFKVFDGMPQRDTVSWNAMLFGYAGRGDI  124

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A ++FD  P   RD V +N+ I+ +
Sbjct  125  GVAQKLFDAMP--ERDVVSWNSLISGY  149



>ref|XP_006646070.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like, 
partial [Oryza brachyantha]
Length=746

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = +3

Query  339  AIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASG  518
            A+HA ++ SG +P A + + L+++YCK   LS AR +FD +P  D+VA T M++A++A+G
Sbjct  2    ALHARLLRSGLRPDAFLRDSLLNMYCKCGRLSDARSVFDGMPHRDVVAWTAMISAHTAAG  61

Query  519  DPNLAAEIF  545
            D   A E+F
Sbjct  62   DAGSALELF  70



>ref|XP_008244547.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Prunus mume]
Length=904

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 6/129 (5%)
 Frame = +3

Query  219  SFESWAQGIYICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNR  398
            SF + AQ      +    ++   Q CS       A +     HA MI SGF+P   + N 
Sbjct  44   SFSTLAQNQTTPTKNFKTFSHIFQQCSHG----RAPNPGKQAHARMIVSGFEPTVFVKNC  99

Query  399  LIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTV  578
            LI +Y K   L YA  +FD +PQ D V+  TM+  Y+ SG    A   FD  P   RD V
Sbjct  100  LIQMYVKCGFLEYASKVFDGMPQRDTVSWNTMIFGYAESGKMGFAQSCFDVMP--ERDVV  157

Query  579  FYNARITAH  605
             +N+ I+ +
Sbjct  158  SWNSLISGY  166



>ref|XP_009117354.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 
[Brassica rapa]
Length=794

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 38/110 (35%), Positives = 62/110 (56%), Gaps = 6/110 (5%)
 Frame = +3

Query  285  LQLCSSNIHTPAASS----LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            L+LC++ + TP  S+     A  +H  +I SG     +++N LI++Y K+ N  +AR LF
Sbjct  14   LELCTNLLQTPLKSNNARFTAQLVHCRVIKSGLFFSVYLINNLINVYSKTGNALHARKLF  73

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            DE+P     +  T+L+AY+  GD + A E FD+ P   +D+V +   I  
Sbjct  74   DEMPLRTAFSWNTVLSAYAKRGDMSSAREFFDQMP--NKDSVSWTTMIVG  121



>emb|CDP01970.1| unnamed protein product [Coffea canephora]
Length=657

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 60/111 (54%), Gaps = 7/111 (6%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMIT-SGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            + A L+ C+  +H      L   IH   +   GF     + N LID+Y K   L +AR +
Sbjct  152  FTALLKACTGVLHV----DLGRQIHGQSLKIGGFVQDLFVGNTLIDMYVKCGCLDFARRV  207

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            FDE+P  D+++ T ++ AY+ SGD   A+++FDR P   +D V + A +T 
Sbjct  208  FDELPTRDVISFTALIVAYAKSGDMVAASDLFDRLP--AKDMVAWTAMVTG  256



>ref|XP_007226966.1| hypothetical protein PRUPE_ppa025241mg [Prunus persica]
 gb|EMJ28165.1| hypothetical protein PRUPE_ppa025241mg [Prunus persica]
Length=743

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 62/116 (53%), Gaps = 7/116 (6%)
 Frame = +3

Query  261  LASRYAAHL-QLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSY  437
            L+S Y  +L +LC          + A  +H ++I +   P   +LN +I  Y +  NL Y
Sbjct  3    LSSNYYCNLLKLCCQ----AGNHAQAKKLHCHIIKTVASPETFLLNNIITTYGRLGNLRY  58

Query  438  ARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            ARH+FD++P P + +   +L+ YS SG  +   EIFDR P    D V +N+ I+ H
Sbjct  59   ARHVFDQMPHPTLFSWNAILSVYSKSGYLSDMQEIFDRMP--RLDGVSWNSFISGH  112



>ref|XP_004242544.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Solanum lycopersicum]
Length=858

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K SNL YA  +FD++P  D V+   M+  YS   + 
Sbjct  47   HARMIISGFQPTVFVTNCLIQMYVKCSNLGYADKVFDKMPLRDTVSWNAMIFGYSMVSEL  106

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
            + A  +FD TP   RD + +N+ I+ +
Sbjct  107  DKAQLMFDLTP--ERDAISWNSLISGY  131



>ref|XP_006299596.1| hypothetical protein CARUB_v10015774mg [Capsella rubella]
 gb|EOA32494.1| hypothetical protein CARUB_v10015774mg [Capsella rubella]
Length=1030

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             A  L    HA+MI SGF+P   +LN LI +Y  S +   A  +FD +P  D+V+   M+
Sbjct  62   GALELGKQTHAHMILSGFRPTTFVLNCLIQVYTNSRDFMSASMVFDRMPLRDVVSWNKMI  121

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              Y+ S D   A+  FD+ P+  RD V +N+ ++ +
Sbjct  122  NGYAKSNDMAKASSFFDKMPV--RDVVSWNSMLSGY  155



>ref|XP_003621610.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES77828.1| PPR containing plant-like protein [Medicago truncatula]
 gb|KEH21778.1| PPR containing plant-like protein [Medicago truncatula]
Length=881

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA +  +GF P   + N L+  YCK  NL+YA ++FD++PQ D+++  TM+  Y+  G+ 
Sbjct  61   HAQITVTGFVPTVFVSNCLLQFYCKCLNLNYAFNVFDKMPQRDVISWNTMIFGYAGVGNM  120

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A  +FD  P   RD V +N+ ++ +
Sbjct  121  EFAQFLFDSMP--ERDVVSWNSMLSCY  145



>ref|XP_004509764.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930-like isoform X1 [Cicer arietinum]
 ref|XP_004509765.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930-like isoform X2 [Cicer arietinum]
Length=744

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 63/114 (55%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            ++ Y   L+LC  + +   A +L    H+++I S   P   +LN LI  Y K  +++YAR
Sbjct  6    SNHYCTLLKLCCESRNFNNAKNL----HSHIIKSIPNPETFLLNNLISSYAKLGSITYAR  61

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +FDEIP P + +  T+L+AYS  G  N    +F+  P   RD V +N+ I+ +
Sbjct  62   RVFDEIPHPTLYSWNTILSAYSKLGRVNEMEHLFNSMP--TRDGVSWNSLISGY  113



>ref|XP_004289114.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Fragaria vesca subsp. vesca]
Length=650

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 3/94 (3%)
 Frame = +3

Query  327  SLATAIHAN-MITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAA  503
            SL   +HA  ++  GF    ++ N +ID+Y K   L   R +FDE+P+ D+V+ T ++A 
Sbjct  158  SLGRQVHAQTVVIGGFAADLYVGNTMIDMYLKCGELGCGRKVFDEMPERDVVSWTELIAV  217

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            Y+ SGD   A E+F+   LS++D V + A +T +
Sbjct  218  YAKSGDMGSARELFEE--LSLKDMVAWTAMVTGY  249



>ref|XP_006430993.1| hypothetical protein CICLE_v10011041mg [Citrus clementina]
 gb|ESR44233.1| hypothetical protein CICLE_v10011041mg [Citrus clementina]
Length=888

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA +I SGFKP   + N LI +Y K SNL  A  +FD++PQ D+V+   ++  Y+A G+ 
Sbjct  69   HARLIVSGFKPTIFVSNCLIQLYIKCSNLKSALKVFDKMPQRDVVSWNALIFGYAARGEM  128

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A  +F+  P   RD + +N+ ++ +
Sbjct  129  GIARTLFEAMP--ERDVISWNSLLSGY  153



>ref|XP_002441797.1| hypothetical protein SORBIDRAFT_08g002505 [Sorghum bicolor]
 gb|EES15635.1| hypothetical protein SORBIDRAFT_08g002505 [Sorghum bicolor]
Length=839

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 64/117 (55%), Gaps = 9/117 (8%)
 Frame = +3

Query  264  ASRYAAHL-QLCSSNIHTPAASSLAT--AIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            A+   +HL QLC+        S+LAT  A HA M+ SGF P   + N L+ +Y +    +
Sbjct  1    ATATFSHLYQLCAG----AGRSALATGQAAHARMLVSGFMPTTFVSNCLLQMYARCGGAA  56

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +AR +FD +P  D V+  TML AY+ +GD   AA +F   P    D V +NA ++ +
Sbjct  57   HARGVFDVMPHRDTVSWNTMLTAYAHAGDTGAAASLFGAMPDP--DVVSWNALLSGY  111



>ref|XP_008362270.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Malus domestica]
Length=377

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 2/84 (2%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLA  533
            MI SGF P   + N LI +Y K   L YA  +FD +PQ D+V+  TM+  Y+ SG    A
Sbjct  1    MIVSGFDPTVFVTNCLIQMYVKCGVLQYAGKVFDGMPQRDMVSWNTMVFGYARSGKMGFA  60

Query  534  AEIFDRTPLSMRDTVFYNARITAH  605
               FD  P   +D V +N+ I+ +
Sbjct  61   QSCFDAMP--EKDVVSWNSLISGY  82



>ref|XP_008342059.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Malus domestica]
Length=892

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF P   + N LI +Y K   L YA  +FD +PQ D+V+  TM+  Y+ SG  
Sbjct  72   HARMIVSGFDPTVFVTNCLIQMYVKCGVLQYAGKVFDGMPQRDMVSWNTMVFGYAGSGKM  131

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A   FD  P   +D V +N+ I+ +
Sbjct  132  GFAQSCFDAMP--EKDVVSWNSLISGY  156



>ref|XP_009625829.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Nicotiana tomentosiformis]
Length=873

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K SNL YA  +FD++P  D V+   M+  YS   D 
Sbjct  47   HARMIISGFQPTIFVTNCLIQLYIKCSNLGYADRVFDKMPLRDTVSWNAMIFGYSMVSDM  106

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A  +FD  P   RD + +N+ I+ +
Sbjct  107  EKAKLMFDLMP--ERDVISWNSMISGY  131



>ref|XP_007208178.1| hypothetical protein PRUPE_ppa017277mg, partial [Prunus persica]
 gb|EMJ09377.1| hypothetical protein PRUPE_ppa017277mg, partial [Prunus persica]
Length=634

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
              T +HA+ I +G K   H+ N L+ +Y K+ +L+  + +FDEI  PD+ + TT+L+A +
Sbjct  75   FGTQLHAHAIRTGLKAYPHVANTLLSLYAKAEDLNSVKWVFDEIENPDVYSWTTLLSACT  134

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
              G  + A ++FD  P   R+   +NA IT 
Sbjct  135  KLGHVDYAYKLFDTMP-EKRNVTIWNAMITG  164



>ref|XP_006398078.1| hypothetical protein EUTSA_v10001098mg [Eutrema salsugineum]
 gb|ESQ39531.1| hypothetical protein EUTSA_v10001098mg [Eutrema salsugineum]
Length=889

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             A  L    +A+MI SGF+P  ++LN L+ +Y  S +L  A  LFD +P  D+V+  TM+
Sbjct  56   GALELGKQAYAHMILSGFRPTTYVLNCLLQMYTNSRDLVSACMLFDRMPLRDVVSWNTMI  115

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              Y+ S D   A+  FD  P   RD V +N+ ++A+
Sbjct  116  NGYAKSKDMVKASSFFDMMP--ERDVVSWNSMLSAY  149



>ref|XP_009117919.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Brassica rapa]
Length=898

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             A  L    HA+MI SGF+P   +LN L+ +Y  S +L  A  LFD++P  D+V+  TM+
Sbjct  63   GAVELGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDLLSASKLFDKMPVRDVVSWNTMI  122

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              Y+ S D   A+  F+  P   RD V +N+ ++ +
Sbjct  123  NCYAKSKDMVKASSFFNTMP--GRDVVSWNSMLSGY  156



>ref|XP_010106892.1| hypothetical protein L484_012985 [Morus notabilis]
 gb|EXC12608.1| hypothetical protein L484_012985 [Morus notabilis]
Length=737

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            IHA+ + +G K   H+ N L+ +Y K+ +L   + +F EI  PD+ + TT+L+A    GD
Sbjct  79   IHAHAVRAGLKAYPHVFNTLLSLYAKAGDLRSVKRVFGEIESPDVYSWTTLLSACVKLGD  138

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITA  602
               A ++FD  P   RD   +NA IT 
Sbjct  139  VEYAQQVFDGMP--SRDVAIWNAMITG  163



>emb|CDY34720.1| BnaA01g33050D [Brassica napus]
Length=881

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             A  L    HA+MI SGF+P   +LN L+ +Y  S +L  A  LFD++P  D+V+  TM+
Sbjct  63   GAVELGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDLLSASKLFDKMPVRDVVSWNTMI  122

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              Y+ S D   A+  F+  P   RD V +N+ ++ +
Sbjct  123  NCYAKSKDMVKASSFFNTMP--GRDVVSWNSMLSGY  156



>ref|XP_007013068.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY30687.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=697

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHIL-NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            A  + ++M    F P    L NRL+ +Y KS  +  AR+LFD++PQ D+++   ML+AY+
Sbjct  41   AKRLQSHMDLHYFTPSDTFLHNRLLHLYAKSGKILDARNLFDKMPQRDVISWNAMLSAYA  100

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
             SG       +FD+ P  +RD+V YN  I  
Sbjct  101  KSGSIENLIAVFDQMPFRLRDSVSYNTVIAG  131



>gb|KJB48511.1| hypothetical protein B456_008G073100 [Gossypium raimondii]
Length=684

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 63/119 (53%), Gaps = 6/119 (5%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            I R  AS Y+  +QLC  N     A +    +H  M  SGF P   I NRL+D+Y K  +
Sbjct  73   IERPPASVYSTLIQLCCQN----RALNEGKTVHKRMRYSGFLPGIVISNRLLDMYAKCGS  128

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            LS A+ +FDE+ + D+ +  T+++ Y+  G    A ++FD  P   RD   + A I+ +
Sbjct  129  LSDAQKVFDEMSEKDLCSWNTLISGYTKLGMLKEAKKLFDEMP--ERDNFSWTAMISGY  185


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            +   +H  M    F P +   + L+ +Y K  N+  A+ +F+ +PQPD+V+ T+++  Y+
Sbjct  330  IGKQVHGYMSRVYFNPLSFAASALVHMYSKCGNVENAKRVFNGMPQPDLVSWTSLITGYA  389

Query  510  ASGDPNLAAEIFD  548
             +G P+ A E F+
Sbjct  390  QNGQPDEALEYFE  402



>ref|XP_010519672.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Tarenaya hassleriana]
Length=700

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHIL-NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            A  + +++ ++ F+P    L NRL+ IY KS  +SYAR LFD++P  D+++   +LAAY+
Sbjct  44   AKRLQSHIESTSFEPSGTFLFNRLLHIYAKSGLVSYARDLFDKMPVRDVISWNALLAAYA  103

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
             +G  +   E+FD  P+  RD+V YN  ++ 
Sbjct  104  RAGSVDKLKEVFDAMPV--RDSVSYNTVVSG  132



>ref|XP_011077894.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Sesamum indicum]
 ref|XP_011077902.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Sesamum indicum]
Length=743

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 65/114 (57%), Gaps = 6/114 (5%)
 Frame = +3

Query  261  LASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYA  440
            +++ Y A L+ C  + +   A  L    HA++I S  +P   +LN LI  Y K +N+++A
Sbjct  4    ISNYYCALLKRCCESQNLKQAKQL----HAHIIRSLAEPETFLLNNLIKGYYKLNNMTFA  59

Query  441  RHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            R +FDE+ +P++ +  T+L+AYS  GD     EIF+  P   +D V +N  I+ 
Sbjct  60   RRVFDEMRRPNLFSWNTILSAYSEQGDVTKMQEIFNLIP--NKDGVSWNLVISG  111



>gb|EEC71020.1| hypothetical protein OsI_02714 [Oryza sativa Indica Group]
Length=825

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            YAA LQ C+++     A     A+HA ++ SG +P A + + L+++YCK   L+ AR +F
Sbjct  63   YAAALQGCAAS----RALRRGKALHARLLRSGPRPDAFLHDSLLNMYCKCGRLADARSVF  118

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            D +P  D+VA T M++A +A+GD   A  +F
Sbjct  119  DGMPHRDVVAWTAMVSAITAAGDAGAALRLF  149



>ref|XP_004242310.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 
[Solanum lycopersicum]
Length=765

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  285  LQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP  464
            + L  ++I T A S+    +HA+++  G      +LNRLI++Y KS ++  ARHLFD++ 
Sbjct  11   VNLLQTSIDTKAYSA-GKLLHAHILRIGLSADTFLLNRLIELYSKSGHIHTARHLFDQML  69

Query  465  QPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            +P++ +  ++L AY   G  + A E+F   P   R+TV +N  I+A
Sbjct  70   EPNVYSWHSLLTAYCKQGQLDNAHELFSNMP--ERNTVSWNTLISA  113



>ref|XP_007043264.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
 gb|EOX99095.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao]
Length=530

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 2/93 (2%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
             L  AIH + + +GF+    I N LI +Y    ++ YAR +FDE+P  +IV+   ML  Y
Sbjct  119  ELGGAIHCHALKNGFELDKFINNSLIHMYASCHDIVYARRVFDELPMKNIVSWNAMLDGY  178

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +  GD  LA ++FD  P   RD V ++  I  +
Sbjct  179  AKCGDMALARQVFDWMP--QRDVVSWSCLIDGY  209



>gb|KHN06390.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=599

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = +3

Query  324  SSLATAIHAN-MITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            S+L   +HA  ++  GF    ++ N +ID+Y K  +L  AR +FDE+P+ D+++ T ++ 
Sbjct  125  SALGAQLHAQTLLLGGFSSDLYVNNAVIDMYVKCGSLRCARMVFDEMPERDVISWTGLIV  184

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            AY+  GD   A ++FD  P+  +D V + A +T +
Sbjct  185  AYTRIGDMRAARDLFDGLPV--KDMVTWTAMVTGY  217



>gb|EEE54934.1| hypothetical protein OsJ_02489 [Oryza sativa Japonica Group]
Length=309

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            YAA LQ C+++     A     A+HA ++ SG +P A + + L+++YCK   L+ AR +F
Sbjct  63   YAAALQGCAAS----RALRRGKALHARLLRSGPRPDAFLHDSLLNMYCKCGRLADARSVF  118

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            D +P  D+VA T M++A +A+GD   A  +F
Sbjct  119  DGMPHRDVVAWTAMVSAITAAGDAGAALRLF  149



>ref|XP_010108113.1| hypothetical protein L484_023201 [Morus notabilis]
 gb|EXC17845.1| hypothetical protein L484_023201 [Morus notabilis]
Length=577

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 60/111 (54%), Gaps = 6/111 (5%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +++ L+ C+   H     S    +HA +   G     ++   L+D+Y K  ++  A+ LF
Sbjct  108  FSSSLKACARIGHKLGGLS----VHAQVYKYGVCGSVYVQTALLDLYSKVGDVKSAQKLF  163

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            DE+P+ ++V+  +ML+ Y +SGD  +A  +FD  P   +D V +N  IT +
Sbjct  164  DEMPERNVVSWNSMLSGYLSSGDLEMAKRVFDEIP--KKDVVSWNCMITGY  212



>emb|CDP02638.1| unnamed protein product [Coffea canephora]
Length=731

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
            S    +HAN I +G     H+ N L+ +Y KS +LS  + +F+EI  PD  + TT+L+A 
Sbjct  73   STGNQLHANAIRAGLIFFPHVSNTLLSVYAKSQDLSSVKRVFNEIESPDDYSWTTLLSAC  132

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            +  GD   A ++FD+ P   R+   +NA IT 
Sbjct  133  AKLGDVEYACQMFDKMP--QRNVAVWNAMITG  162



>ref|XP_004289369.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Fragaria vesca subsp. vesca]
Length=733

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 1/91 (1%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
              T +H N + SG K   H+ N L+ +Y  + +L   R +FDEI +PD+ A TT+L+A +
Sbjct  74   FGTQLHGNAVRSGLKAFPHVANPLLSLYASAGDLDDVRLVFDEIAEPDVYAWTTLLSACA  133

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
              G+   A ++FD+ P    +   +NA IT 
Sbjct  134  KLGEVEYACKVFDKIP-EKSNVAIWNAMITG  163



>ref|XP_010940859.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510 
[Elaeis guineensis]
Length=510

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
              A+HA+ + SGF   A +   L+D+Y K+  L+ AR LFDE+P  D+    +M+  Y+ 
Sbjct  104  GRALHADFVKSGFTFDAFVATSLLDMYAKAGLLASARRLFDEMPHRDVALWNSMIGGYAK  163

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             G+   A E+FD  PL  R+ + + + I+ +
Sbjct  164  CGELAKAKELFDMMPL--RNVISWTSMISGY  192



>ref|XP_010262425.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405 [Nelumbo nucifera]
Length=611

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            ++S  A A+HA +I  G     H+ + LI++Y +   L  AR LF EI +PD+V++T M+
Sbjct  121  SSSDAALAVHAAIIKHGSDSNRHVQSGLINMYAELGFLGSARKLFSEIREPDLVSQTAMV  180

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +A +  G+ + A  +FD  P   RD + +NA I  +
Sbjct  181  SACARCGEVDFAQNLFDEMP--YRDPIAWNAMIAGY  214



>ref|XP_006482464.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Citrus sinensis]
Length=892

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA +I SGFKP   + N LI +Y K SNL  A  +FD++PQ D+V+   ++  Y+  G+ 
Sbjct  69   HARLIVSGFKPTIFVSNCLIQLYIKCSNLKSALKVFDKMPQRDVVSWNALIFGYAVRGEM  128

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A  +F+  P   RD + +N+ ++ +
Sbjct  129  GIARTLFEAMP--ERDVISWNSLLSGY  153



>ref|XP_008338226.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Malus domestica]
Length=692

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +3

Query  246  YICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSS  425
            +I +  AS Y+  LQLC   +H  A +     +HA+   SGF P   I NRLI +Y K  
Sbjct  80   HIDKPSASIYSTLLQLC---LHQRALAQ-GKLVHAHTRASGFVPGMFICNRLIXMYAKCG  135

Query  426  NLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            ++  A+ +FDE+P+ D+ +  TM++ Y+  G    A ++FD  P   RD   + A I+ +
Sbjct  136  SIVDAQMVFDEMPERDLCSWNTMISGYAKVGQLAEARKLFDEMP--QRDNFSWTAVISGY  193


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 29/91 (32%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+ +    AA +L   +H  M   GF P +   + L+ +Y K  N+  A  +F
Sbjct  323  FAGVLNACAQH----AAENLGKQVHGYMTRIGFDPLSFAASALVHMYSKCGNIENANKVF  378

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            +E+P PD+V+ T+++A ++ +G PN A ++F
Sbjct  379  NEMPCPDVVSWTSLIAGHAQNGQPNEALQLF  409



>ref|XP_010463633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Camelina sativa]
Length=899

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             A  L    HA+MI SGF+P   +LN L+ +Y  S +   A  +FD++P  D+V+   M+
Sbjct  62   GALELGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNKMI  121

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              Y+ S D   A+  FD  P+  RD V +N+ ++ +
Sbjct  122  NGYAKSNDMAKASSFFDMMPV--RDVVSWNSMLSGY  155



>ref|XP_010558533.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Tarenaya hassleriana]
 gb|ABD96900.1| hypothetical protein [Cleome spinosa]
Length=924

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 2/94 (2%)
 Frame = +3

Query  321  ASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            A  L    HA+MI SGF+P   + N L+ +Y    NL YA  LFD +P  D+V+   M+ 
Sbjct  64   AHELGKQAHAHMIISGFRPTVFVSNCLLQLYINCGNLGYATKLFDGMPLRDVVSWNAMIF  123

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
             Y+AS D   A+  F+  P   RD V +N+ ++ 
Sbjct  124  GYAASNDMVRASLCFEMMP--TRDVVSWNSMLSG  155



>gb|KDO72337.1| hypothetical protein CISIN_1g002718mg [Citrus sinensis]
Length=888

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA +I SGFKP   + N LI +Y K SNL  A  +FD++PQ D+V+   ++  Y+  G+ 
Sbjct  69   HARLIVSGFKPTIFVSNCLIQLYIKCSNLKSALKVFDKMPQRDVVSWNALIFGYAVRGEM  128

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A  +F+  P   RD + +N+ ++ +
Sbjct  129  GIARTLFEAMP--ERDVISWNSLLSGY  153



>ref|XP_004491978.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Cicer arietinum]
Length=880

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI +GF P  ++ N L+  YCK SN++YA ++FD++   D+++  TM+  ++  G+ 
Sbjct  56   HAQMIVTGFVPTIYVSNCLLQFYCKCSNMNYAFNVFDKMHHRDVISWNTMIFGFAGIGNM  115

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A  +FD  P   RD V +N+ ++ +
Sbjct  116  GFAQFLFDSMP--ERDVVSWNSLLSCY  140



>ref|XP_006437829.1| hypothetical protein CICLE_v10033304mg [Citrus clementina]
 ref|XP_006484277.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930-like [Citrus sinensis]
 gb|ESR51069.1| hypothetical protein CICLE_v10033304mg [Citrus clementina]
Length=743

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 60/114 (53%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            ++ YA+ L+LC  N       S    IH  +I +   P   + N L++ Y K  N+ YAR
Sbjct  5    SNHYASLLKLCCEN----KDQSQLKKIHCLIIKTLTDPETFLSNCLVNCYSKVGNIKYAR  60

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             LFD++ QP++ +  T+L+AYS SG+ +    +F   P    D V +N  I+ H
Sbjct  61   RLFDKMAQPNLFSWNTILSAYSKSGNLSEMNSVFHYMPF--HDGVSWNLLISGH  112



>ref|XP_006352817.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like 
[Solanum tuberosum]
Length=765

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = +3

Query  285  LQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP  464
            + L  ++I T A ++    +HA+++  G      +LNRLI++Y KS ++  ARHLFD++ 
Sbjct  11   VNLLQTSIDTKAYTA-GKLLHAHILRIGLSADTFLLNRLIELYSKSGHIHTARHLFDQML  69

Query  465  QPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            QP+I +  ++L AY   G  + A E+F   P   R++V +N  I+A
Sbjct  70   QPNIYSWHSLLTAYCKQGQLDNAHELFSIMP--ERNSVSWNTLISA  113



>gb|KDO71020.1| hypothetical protein CISIN_1g038673mg [Citrus sinensis]
Length=548

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  327  SLATAIHANMIT-SGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAA  503
            SL   IHA  I   GF    ++ N +I +Y K   L  +R +FDE+P+ D+V+ T ++ A
Sbjct  69   SLGQQIHAQTILLGGFTSDLYVGNTMIGMYVKCGFLGCSRKVFDEMPERDVVSWTELIVA  128

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            Y+ +GD   A  +F+  PL  +D V + A +T +
Sbjct  129  YANNGDMESAGGLFNELPL--KDKVAWTAMVTGY  160



>emb|CDY13116.1| BnaA09g17010D [Brassica napus]
Length=656

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 64/111 (58%), Gaps = 8/111 (7%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMIT-SGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            ++A L+ C S        SL    HA     SGF    ++ N +ID+Y K  ++  AR +
Sbjct  151  FSALLKACGS----VGDLSLGRQFHAQTFRLSGF-CSVYVGNTMIDLYVKCGSMECARKV  205

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            FDE+P+ D+++ T ++AAY+ +GD + AAE+F+R P   +D V + A +T 
Sbjct  206  FDEMPERDVISWTELIAAYAKAGDMDSAAELFERLP--KKDIVAWTAMVTG  254



>ref|XP_008662428.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
[Zea mays]
 gb|AFW55950.1| hypothetical protein ZEAMMB73_919937 [Zea mays]
Length=864

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 42/118 (36%), Positives = 63/118 (53%), Gaps = 9/118 (8%)
 Frame = +3

Query  261  LASRYAAHL-QLCSSNIHTPAASSLAT--AIHANMITSGFKPRAHILNRLIDIYCKSSNL  431
            +A+   +HL QLC+S       S+L T  A HA M+ SGF P   + N L+ +Y +    
Sbjct  15   VATATFSHLYQLCAS----AGRSALTTGQAAHARMLVSGFMPTTFVSNCLLQMYARCGGT  70

Query  432  SYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            ++A  +FD +P  D V+  TML AY  +GD + AA +F   P    D V +N  I+ +
Sbjct  71   AHAHGVFDTMPHRDTVSWNTMLTAYVHAGDTDTAASLFGTMPDP--DVVSWNTLISGY  126



>ref|XP_006847449.1| hypothetical protein AMTR_s01569p00009850, partial [Amborella 
trichopoda]
 gb|ERN09030.1| hypothetical protein AMTR_s01569p00009850, partial [Amborella 
trichopoda]
Length=193

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            Y+  LQ CS ++    A+SLA  +  +M+ + F     + NRLIDIYCKS  +  AR +F
Sbjct  78   YSCLLQACSESM----AASLAQKVETHMVKTSFPHCLFLNNRLIDIYCKSGYIREARKVF  133

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            DE+ + D+ +  TM+  Y   G  + A ++F
Sbjct  134  DEMSEKDLFSYNTMIHGYCCFGLLDDARQVF  164



>ref|XP_002267613.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Vitis vinifera]
 ref|XP_010654170.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Vitis vinifera]
 ref|XP_010654175.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Vitis vinifera]
 emb|CBI27415.3| unnamed protein product [Vitis vinifera]
Length=743

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            ++ YA+ L+LC  + +   A  L    H  ++ +  +P   + N LI  Y K  NL+YA 
Sbjct  5    SNYYASLLKLCCESQNQTQAKKL----HCLILKTIKQPETFLSNNLITAYYKLGNLAYAH  60

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            H+FD IPQP++ +  T+L+ YS  G  +   +IF+  P   RD V +N  I+ +
Sbjct  61   HVFDHIPQPNLFSWNTILSVYSKLGLLSQMQQIFNLMPF--RDGVSWNLAISGY  112



>ref|XP_009348084.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Pyrus x bretschneideri]
Length=692

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +3

Query  246  YICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSS  425
            +I +  AS Y+  L LC    H   A +    +HA+   SGF P   I NRLI++Y K  
Sbjct  80   HIDKPSASIYSTLLLLC----HHQRALAQGKLVHAHTRASGFVPGMFICNRLIEMYAKCG  135

Query  426  NLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            ++  A+ LFDE+P+ D+ +  TM++ ++  G    A ++FD  P   RD   + A I+ +
Sbjct  136  SIVDAQMLFDEMPERDLCSWNTMISGHAKVGQLAEARKLFDEMP--QRDNFSWTAMISGY  193


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+ +    AA +L   +H  M   GF P +   + L+ +Y K  N+  A  +F
Sbjct  323  FAGVLNACAQH----AAENLGKQVHGYMTRIGFDPLSFAASALVHMYSKCGNIENANKVF  378

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            +E+P PD+V+ T+++A Y+ +G PN A ++F
Sbjct  379  NEMPCPDVVSWTSLIAGYAQNGQPNEALQLF  409



>ref|XP_007217021.1| hypothetical protein PRUPE_ppa001933mg [Prunus persica]
 gb|EMJ18220.1| hypothetical protein PRUPE_ppa001933mg [Prunus persica]
Length=739

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLA  533
            MI SGF+P   + N LI +Y K   L YA  +FD +PQ D V+  TM+  Y+ SG+   A
Sbjct  1    MIVSGFEPTVFVTNCLIQMYVKCGVLEYASKVFDGMPQRDTVSWNTMIFGYAESGNMGFA  60

Query  534  AEIFDRTPLSMRDTVFYNARITAH  605
               FD  P   RD V +N+ I+ +
Sbjct  61   QSCFDVMP--ERDVVSWNSLISGY  82



>gb|KDP32117.1| hypothetical protein JCGZ_12578 [Jatropha curcas]
Length=741

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
                +HA+ I SG +   H+ N L+ +Y K+ ++   + +FDEI  PD+ + TT+L++ +
Sbjct  83   FGDKLHAHAIKSGLRSFLHVANPLLSLYAKAKDIVSVKWVFDEIENPDVYSYTTLLSSST  142

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
              G  + A E+FD+ P   RD   +NA IT 
Sbjct  143  KMGHVDYACEVFDKMP--NRDLAVWNAIITG  171



>ref|XP_010689314.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Beta vulgaris subsp. vulgaris]
Length=658

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 5/96 (5%)
 Frame = +3

Query  327  SLATAIHANMIT-SGFKPRA--HILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             L   +H  M    GF      H  N LID+Y KS  L  AR +FDE+P  D+++ T+++
Sbjct  165  GLGCQLHGQMFKFGGFGSELFLHAGNSLIDLYVKSGVLESARKVFDEMPMRDVISGTSLI  224

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             AY+  GD   A E+F    L ++D V + A IT++
Sbjct  225  VAYAKGGDMEAATELF--VELDVKDAVVWTAMITSY  258



>ref|XP_009775967.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana sylvestris]
 ref|XP_009775968.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana sylvestris]
 ref|XP_009775969.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana sylvestris]
 ref|XP_009775970.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana sylvestris]
Length=730

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 6/106 (6%)
 Frame = +3

Query  285  LQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP  464
            L  C++  H    +S    +HA  I +G K  +H+ N L+  Y KS +LS  + +F EI 
Sbjct  61   LTACANITH----ASFGNQLHAFAINAGLKEYSHVSNSLLSFYAKSKDLSSVKRVFSEIE  116

Query  465  QPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
             PD+ + TT+L+A +  G+   A ++FD  P   R+   +NA IT 
Sbjct  117  NPDVYSWTTLLSACAKLGEVEYACQMFDEMP--KRNLAVWNAMITG  160



>ref|XP_010524431.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880 
[Tarenaya hassleriana]
Length=594

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H +++ SGF    ++   +ID+Y K   +++AR++F+E+PQ   V+ T ++  Y+  GD
Sbjct  137  LHGHIMKSGFCLDMYVSTGMIDMYAKFGMVNWARNVFEEMPQRSAVSWTALICGYAKCGD  196

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
              +A+++F   P  M+D V YNA I  +
Sbjct  197  MRVASKLFAEMP-EMKDVVIYNALIDGY  223


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = +3

Query  387  ILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSM  566
            I N LID Y KS ++  AR LF+E+P   +V  TTM++ Y  +GD   A  +FD  P   
Sbjct  215  IYNALIDGYVKSGDMVSARSLFNEMPDRSVVTWTTMISGYCTNGDIVSARLLFDAMP--E  272

Query  567  RDTVFYNARITA  602
            R+ V +NA I  
Sbjct  273  RNLVSWNAMIGG  284



>gb|EYU42170.1| hypothetical protein MIMGU_mgv1a003558mg [Erythranthe guttata]
Length=578

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 2/87 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            IH  +   GF+    +   L+D Y K  +L  AR LFDEI + ++V+  +ML  Y   GD
Sbjct  126  IHGQVEKFGFRNVVFVQTALVDFYLKMGDLMIARKLFDEITEKNVVSWNSMLDGYVKYGD  185

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITA  602
              +A  +FD  P  MRD + +N+ ++ 
Sbjct  186  MAMAQNVFDEMP--MRDVISWNSMVSG  210



>ref|XP_008804906.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Phoenix dactylifera]
Length=519

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHAN-MITSGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            ++A L+ C +    P    + T +HA  + T GF     + N LI  Y + S+LS AR L
Sbjct  15   FSALLKACGAARCLP----MGTQVHAQALATGGFDSDLFVQNTLISFYVECSDLSSARKL  70

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            FD +   D ++ T+++ AY+ +GD   A  +F++TP+  +D V + A +T +
Sbjct  71   FDRMSVRDAISWTSLIVAYTKTGDMGSAEGLFEKTPV--KDMVAWTAMVTGY  120



>ref|XP_010472662.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g02330-like [Camelina sativa]
Length=899

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 55/116 (47%), Gaps = 2/116 (2%)
 Frame = +3

Query  258  QLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSY  437
            QL S    +            A  L    HA+MI SGF+P   +LN L+ +Y  S +   
Sbjct  42   QLNSASTTNFSFVFKECAKQGALELGKQAHAHMILSGFRPTTFVLNCLLQVYTNSRDFVS  101

Query  438  ARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            A  +FD +P  D+V+   M+  Y+ S D   A   FD  P+  RD V +N+ ++ +
Sbjct  102  ASMVFDRMPLRDVVSWNKMINGYAKSNDMAKANSFFDMMPV--RDVVSWNSMLSGY  155



>gb|KCW59311.1| hypothetical protein EUGRSUZ_H01992 [Eucalyptus grandis]
Length=628

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 60/119 (50%), Gaps = 6/119 (5%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            I R  A  Y+  LQ C       A       +HA+M  +GF P   I NRLID+Y K  +
Sbjct  17   IERPSALVYSTLLQACLRQRDVGAGK----MVHAHMGRAGFTPGVVISNRLIDMYTKCDS  72

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            L  AR  FDE+P  D+ +  TM++ Y+ +G  + A  +FD  P   RD   + A ++ +
Sbjct  73   LVDARKTFDEMPHRDLCSWNTMISGYARAGRLSDARRLFDEMP--ERDNFSWTAMMSGY  129


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+ +    AA  +   +H  M+ SGF P +   + L+ +Y K  N+  A  +F
Sbjct  259  FAGVLNACADH----AAEEVGKQVHGYMMRSGFDPSSFAESALVHMYAKCGNMESAERVF  314

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
             E+P PD+V+ T+++  ++ +G    A + FD
Sbjct  315  REMPHPDLVSWTSLIVGFAQNGLFREALKYFD  346



>ref|XP_006362924.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like 
[Solanum tuberosum]
Length=576

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
            S   +IHA +   GF    ++   L+D Y K  N+ +AR +F+E+ + +IV+  ++L  Y
Sbjct  121  SGGISIHAQVYKYGFCNVVYVQTALVDFYSKVGNMDFARSIFNEMVEKNIVSWNSLLGGY  180

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              SGD  +A  +FD  P   +D + +N+ ++ +
Sbjct  181  VKSGDLTMAQSVFDEMP--EKDVISWNSMVSGY  211



>ref|XP_002522543.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF39843.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=530

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 59/111 (53%), Gaps = 2/111 (2%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            Y+  L+  +S  +   + +L + +H  ++ S  +P   +   L+D Y KS  + YAR +F
Sbjct  146  YSMILKASTSGDNVTLSCNLGSVVHGQILKSEVEPDDVLYTALVDSYVKSGRVGYARKVF  205

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            D + + +++  T+M++ Y   G    A EIF+RT    +D V +NA I  +
Sbjct  206  DMMMEKNVICSTSMISGYMNRGSVEDAEEIFERT--VEKDVVVFNAMIEGY  254


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASG  518
            IHA+++ +GF P  ++  +L+ +Y K   L YAR +FDE+PQ  + A   ++  Y   G
Sbjct  64   IHAHIVKTGFIPNTNVSIKLLILYLKCGCLKYARQMFDELPQRTLSAYNYLIGGYLKLG  122



>ref|XP_009362610.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Pyrus x bretschneideri]
Length=734

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
            +  T +HA+ I SG K   H+ N L+ +Y K+ +L+  + +FD I  PD+ + TT+L+A 
Sbjct  74   AFGTQLHAHAIQSGLKAYPHVANTLLSLYAKAEDLTSVKWVFDMIENPDVYSWTTLLSAC  133

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            S  G  + A E+FD+ P        +NA IT 
Sbjct  134  SKLGHVDYACEVFDKMP-QKGSVAIWNAMITG  164



>ref|XP_010070499.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Eucalyptus grandis]
Length=722

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 60/119 (50%), Gaps = 6/119 (5%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            I R  A  Y+  LQ C       A       +HA+M  +GF P   I NRLID+Y K  +
Sbjct  111  IERPSALVYSTLLQACLRQRDVGAGK----MVHAHMGRAGFTPGVVISNRLIDMYTKCDS  166

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            L  AR  FDE+P  D+ +  TM++ Y+ +G  + A  +FD  P   RD   + A ++ +
Sbjct  167  LVDARKTFDEMPHRDLCSWNTMISGYARAGRLSDARRLFDEMP--ERDNFSWTAMMSGY  223


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+ +    AA  +   +H  M+ SGF P +   + L+ +Y K  N+  A  +F
Sbjct  353  FAGVLNACADH----AAEEVGKQVHGYMMRSGFDPSSFAESALVHMYAKCGNMESAERVF  408

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
             E+P PD+V+ T+++  ++ +G    A + FD
Sbjct  409  REMPHPDLVSWTSLIVGFAQNGLFREALKYFD  440



>ref|XP_006366808.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Solanum tuberosum]
Length=894

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI SGF+P   + N LI +Y K SNL YA  +FD++P  D V+   M+  YS   + 
Sbjct  71   HARMIISGFQPTVFVTNCLIQMYIKCSNLGYADKVFDKMPLRDTVSWNAMIFGYSMVSEL  130

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A  +FD  P   RD + +N+ I+ +
Sbjct  131  EKAQLMFDLMP--ERDAISWNSLISGY  155



>ref|XP_003610927.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=802

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            L   +HA+   S F P   I NRLI +Y K  +L  A+ LFDEIPQ D+ +  TM++ Y+
Sbjct  81   LGKRVHAHTKASNFIPGIVISNRLIHMYAKCGSLVDAQMLFDEIPQKDLCSWNTMISGYA  140

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              G    A ++FD  P   RD   +NA I+ +
Sbjct  141  NVGRIEQARKLFDEMP--HRDNFSWNAVISGY  170


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            AA  +   +H  M   G+ P +   + L+ +Y K  N   AR +F+++P+PD+V+ T+++
Sbjct  311  AAEQMGKEVHGYMTRVGYDPFSFAASALVHVYSKCGNTETARRVFNQMPRPDLVSWTSLI  370

Query  498  AAYSASGDPNLAAEIFD  548
              Y+ +G P++A + F+
Sbjct  371  VGYAQNGQPDMALQFFE  387



>ref|XP_009113933.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Brassica rapa]
Length=667

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 64/111 (58%), Gaps = 8/111 (7%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMIT-SGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            ++A L+ C S        SL    HA     SGF    ++ N +ID+Y K  ++  AR +
Sbjct  162  FSALLKACGS----VGDLSLGRQFHAQTFRLSGF-CSVYVGNTMIDVYVKCGSMECARKV  216

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            FDE+P+ D+++ T ++AAY+ +GD + AAE+F+R P   +D V + A +T 
Sbjct  217  FDEMPERDVISWTELIAAYAKAGDMDSAAELFERLP--KKDMVAWTAIVTG  265



>ref|XP_004309485.2| PREDICTED: pentatricopeptide repeat-containing protein At5g61800 
[Fragaria vesca subsp. vesca]
Length=527

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 54/97 (56%), Gaps = 2/97 (2%)
 Frame = +3

Query  315  PAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTM  494
            P++  ++ A+H+  +  GF   + + N LI +Y    NL++AR LFDE P  D+V+   M
Sbjct  127  PSSFPISQALHSQALKFGFASHSFVANTLIHVYSVCHNLNHARQLFDESPHKDMVSYNAM  186

Query  495  LAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            L A+   G+ + A E+FD  P   RD+V +   +  +
Sbjct  187  LDAFVKGGEMDNAREVFDEMP--ERDSVSWGTVLAGY  221



>gb|AES93885.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=880

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            L   +HA+   S F P   I NRLI +Y K  +L  A+ LFDEIPQ D+ +  TM++ Y+
Sbjct  81   LGKRVHAHTKASNFIPGIVISNRLIHMYAKCGSLVDAQMLFDEIPQKDLCSWNTMISGYA  140

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              G    A ++FD  P   RD   +NA I+ +
Sbjct  141  NVGRIEQARKLFDEMP--HRDNFSWNAVISGY  170


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            AA  +   +H  M   G+ P +   + L+ +Y K  N   AR +F+++P+PD+V+ T+++
Sbjct  311  AAEQMGKEVHGYMTRVGYDPFSFAASALVHVYSKCGNTETARRVFNQMPRPDLVSWTSLI  370

Query  498  AAYSASGDPNLAAEIFD  548
              Y+ +G P++A + F+
Sbjct  371  VGYAQNGQPDMALQFFE  387



>ref|XP_010278229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
 ref|XP_010278231.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
 ref|XP_010278232.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
 ref|XP_010278233.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
 ref|XP_010278234.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X1 [Nelumbo nucifera]
Length=713

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            A+ Y+A LQLC        A      +HA+   SGF P   I NRL+D+Y K  +L+ AR
Sbjct  107  AAIYSALLQLCLQQ----RALEDGRKVHAHFKVSGFVPGIFISNRLLDLYSKCESLADAR  162

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             LFDE+ + D+ +  TM++ Y+ +G    A  +F+  P   +D   ++  I+A+
Sbjct  163  KLFDEMTERDLCSWNTMISGYAKAGQLEEARLLFEGVP--GKDNFSWSTMISAY  214


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  CS++    AA      +HA M   GF P +   + L+ +Y K  N+  AR +F
Sbjct  344  FAGILNACSAD----AAEDTGKQVHAYMTRIGFDPFSFAASALVHMYSKCGNIDSARRVF  399

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
            + +PQPD+V+ T+M++ Y+ +G P  A   F+
Sbjct  400  EGMPQPDLVSWTSMISGYAQNGQPEEAIRYFE  431


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            L   IH +++ +G    A + + L D+Y K  ++  ARH+FD++   DIVA TTM+  Y 
Sbjct  258  LGKEIHGHIMRTGLASDAVVWSALSDMYGKCGSVEEARHVFDKMLDRDIVAWTTMVGRYF  317

Query  510  ASGDPNLAAEIF  545
             SG      E+F
Sbjct  318  ESGRRKEGFELF  329



>ref|XP_010278235.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
isoform X2 [Nelumbo nucifera]
Length=710

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            A+ Y+A LQLC        A      +HA+   SGF P   I NRL+D+Y K  +L+ AR
Sbjct  104  AAIYSALLQLCLQQ----RALEDGRKVHAHFKVSGFVPGIFISNRLLDLYSKCESLADAR  159

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             LFDE+ + D+ +  TM++ Y+ +G    A  +F+  P   +D   ++  I+A+
Sbjct  160  KLFDEMTERDLCSWNTMISGYAKAGQLEEARLLFEGVP--GKDNFSWSTMISAY  211


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  CS++    AA      +HA M   GF P +   + L+ +Y K  N+  AR +F
Sbjct  341  FAGILNACSAD----AAEDTGKQVHAYMTRIGFDPFSFAASALVHMYSKCGNIDSARRVF  396

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
            + +PQPD+V+ T+M++ Y+ +G P  A   F+
Sbjct  397  EGMPQPDLVSWTSMISGYAQNGQPEEAIRYFE  428


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            L   IH +++ +G    A + + L D+Y K  ++  ARH+FD++   DIVA TTM+  Y 
Sbjct  255  LGKEIHGHIMRTGLASDAVVWSALSDMYGKCGSVEEARHVFDKMLDRDIVAWTTMVGRYF  314

Query  510  ASGDPNLAAEIF  545
             SG      E+F
Sbjct  315  ESGRRKEGFELF  326



>gb|EMT10346.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=860

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = +3

Query  267  SRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARH  446
            S ++  LQLC+      AA     A HA M+ SGF P A + N L+ +Y + ++ + AR 
Sbjct  14   STFSHLLQLCARG--GRAALDAGRAAHARMLVSGFVPTAFVSNCLLQMYARCADAACARR  71

Query  447  LFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +FD +P  D V+  T+L AYS SGD   A  +FD  P   +D V +N  ++++
Sbjct  72   VFDAMPHRDTVSWNTLLTAYSHSGDITTAVSLFDAMP--NQDVVSWNTLVSSY  122



>ref|XP_002454518.1| hypothetical protein SORBIDRAFT_04g032600 [Sorghum bicolor]
 gb|EES07494.1| hypothetical protein SORBIDRAFT_04g032600 [Sorghum bicolor]
Length=834

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 39/116 (34%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = +3

Query  261  LASRYAAHL-QLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSY  437
            LA+   +H+ QLC+S  H+  A+    A HA M+ SGF P   + N L+ +Y +    ++
Sbjct  27   LATATFSHVYQLCASAGHSALAT--GQAAHARMLVSGFVPTMFVSNCLLQMYARCGGAAH  84

Query  438  ARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            A  +FD +P  D V+  TML AY+  GD  +A  +    P    D V +NA ++ +
Sbjct  85   AHGVFDTMPHRDTVSWNTMLTAYAHMGDTGMATSLLCVMPDP--DVVSWNALLSGY  138



>gb|KCW47309.1| hypothetical protein EUGRSUZ_K01097 [Eucalyptus grandis]
Length=518

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 59/111 (53%), Gaps = 7/111 (6%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHAN-MITSGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            + A L+ C + I      +L   +HA  M+  GF    ++ N LI +Y    +L   R +
Sbjct  13   FTALLKACGAAIDL----NLGRQVHAQTMLIGGFGSDLYVGNSLIGMYVSCGDLGSGRKV  68

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            FDE+   D+++ TT++ AY+ +GD   A ++FD  P+  +D V + A +T 
Sbjct  69   FDEMLHRDVISWTTLIVAYTKTGDMASAGDLFDGLPV--KDMVAWTAMVTG  117



>ref|XP_010551347.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Tarenaya hassleriana]
Length=743

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 61/114 (54%), Gaps = 5/114 (4%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            ++ YA+HL+LC   I     S     IH ++I +   P   +LN +++ Y K S+  YAR
Sbjct  3    SNYYASHLKLC---IGRRNQSRHVKRIHGHIIRTLPDPETFLLNVIVNAYGKISDSKYAR  59

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +FD IP P+I +   +L+AYS SGD +     F + P   RD V +N  I  +
Sbjct  60   GVFDGIPLPNIYSWNALLSAYSNSGDISELEGTFSKLPC--RDHVSWNLLIKGY  111


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            IHA +I +  +    + + L+D+YCK +N+ YA  +F+ + Q ++V+ T ML  Y  +G 
Sbjct  292  IHAFIIRTNHQDNIFVASALVDMYCKCNNIVYAETVFNRMEQKNVVSWTAMLGGYGKTGQ  351

Query  522  PNLAAEIF  545
               A EIF
Sbjct  352  FEEAFEIF  359



>ref|XP_006844125.1| hypothetical protein AMTR_s00006p00257350 [Amborella trichopoda]
 gb|ERN05800.1| hypothetical protein AMTR_s00006p00257350 [Amborella trichopoda]
Length=668

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 7/115 (6%)
 Frame = +3

Query  261  LASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYA  440
            L   Y+  LQ C+        S      HA+MITSGFKP   + N LI++Y KSSN   A
Sbjct  15   LRKTYSHILQECAIR-----RSEAGREAHAHMITSGFKPSIFVFNCLINMYLKSSNTHDA  69

Query  441  RHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             ++F ++P  D+V+  +M+  YS +     A  +F+  P+  +D + +N+ +  +
Sbjct  70   LNVFKQMPHKDLVSYNSMIYQYSFTNSMPSALSLFNSMPI--KDAISWNSLMAGY  122



>ref|XP_007207552.1| hypothetical protein PRUPE_ppa017672mg [Prunus persica]
 gb|EMJ08751.1| hypothetical protein PRUPE_ppa017672mg [Prunus persica]
Length=745

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            IH +++ +GF    ++ N LI+IY    N+S AR+LFDEIP  + V+  ++LA Y  +GD
Sbjct  100  IHNHILKTGFDSDVYVQNTLINIYAVCENMSDARNLFDEIPVLNPVSWNSILAGYVRAGD  159

Query  522  PNLAAEIFDRTPLSMRDTVFYNARI  596
               A  I+DR P   R+T+  N+ I
Sbjct  160  AEKAKLIYDRMP--ERNTIASNSMI  182



>ref|XP_010923534.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like 
[Elaeis guineensis]
Length=787

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 34/92 (37%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            L   +H  +  +G     ++ N L+++Y K   +  AR LFD++P+ DIV+RTT+L+ Y+
Sbjct  259  LGKWVHQYIKENGVPLCLNLRNALMNMYAKFGEMGEARRLFDQMPEHDIVSRTTLLSGYA  318

Query  510  ASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            + G   LA EIFD+ P   R+ V +NA I  +
Sbjct  319  SMGHLTLAHEIFDKMP--DRNVVAWNAMIAGY  348



>gb|KDP36109.1| hypothetical protein JCGZ_08753 [Jatropha curcas]
Length=602

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 54/97 (56%), Gaps = 4/97 (4%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            ++   RY+  L+ C+S            AIH NMI SG +P +H+L  LI+ Y K  +L 
Sbjct  74   KEELKRYSGMLRECASK----KTFVEGKAIHGNMIRSGLEPDSHLLVSLINFYVKCGSLV  129

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
             AR +FD++P+ D+V+ T ++A   + G  +  A ++
Sbjct  130  SARKVFDDMPEQDVVSWTALIAGCVSEGFGSDGASLY  166



>ref|XP_011028231.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
isoform X2 [Populus euphratica]
Length=540

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +3

Query  399  LIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTV  578
            L+D+YCK   LS AR +FDE+P  +++  T+M++ Y   G+ + A E+F+R+P+  RD V
Sbjct  151  LLDMYCKCGCLSVARKIFDEMPHKNVICWTSMVSGYVNYGELDKARELFERSPV--RDVV  208

Query  579  FYNARITAH  605
             + A I  +
Sbjct  209  LWTAMINGY  217



>ref|XP_003524199.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230-like 
[Glycine max]
Length=617

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHAN-MITSGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            ++A    C++  H    S+L   +HA  ++  GF    ++ N +ID+Y K  +L  AR +
Sbjct  112  FSALFSACAAVRH----SALGAQLHAQTLLLGGFSSDLYVNNAVIDMYVKCGSLRCARMV  167

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            FDE+P+ D+++ T ++ AY+  GD   A ++FD  P+  +D V + A +T +
Sbjct  168  FDEMPERDVISWTGLIVAYTRIGDMRAARDLFDGLPV--KDMVTWTAMVTGY  217



>ref|XP_008789842.1| PREDICTED: pentatricopeptide repeat-containing protein At3g51320-like 
[Phoenix dactylifera]
Length=287

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA  I  G     H+ N LI +Y     L YAR LFDE+P  D+++  +M+  Y+ +GD 
Sbjct  162  HAQAIKRGVDAVLHVRNSLIHVYSVCGLLEYARVLFDEMPHRDVISWNSMVDGYAEAGDL  221

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
            + A E+FD  P   R+ V +N  I+ +
Sbjct  222  DAARELFDMMP--ERNVVSWNVMISGY  246



>gb|AAG12601.1|AC068900_7 hypothetical protein; 7123-4412 [Arabidopsis thaliana]
Length=861

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             A  L    HA+MI SGF+P   +LN L+ +Y  S +   A  +FD++P  D+V+   M+
Sbjct  20   GALELGKQAHAHMIISGFRPTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNKMI  79

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              YS S D   A   F+  P+  RD V +N+ ++ +
Sbjct  80   NGYSKSNDMFKANSFFNMMPV--RDVVSWNSMLSGY  113



>ref|XP_004976211.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g23330-like isoform X1 [Setaria italica]
 ref|XP_004976212.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g23330-like isoform X2 [Setaria italica]
Length=644

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            A+      +HA +I  GF+    I + LID+YCK   +S AR +FD +P PDIV+RT M+
Sbjct  286  ASLRFGKQLHAYVIQGGFEDNVFISSSLIDMYCKCGEISIARCIFDRMPSPDIVSRTAMI  345

Query  498  AAYSASGDPNLAAEIFDRTPL  560
              Y+  G    A  +F++  L
Sbjct  346  MGYALHGPAREALVLFEKMEL  366



>ref|XP_004137118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Cucumis sativus]
 ref|XP_004171015.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330-like 
[Cucumis sativus]
 gb|KGN43953.1| hypothetical protein Csa_7G074860 [Cucumis sativus]
Length=868

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA+MI SGF P   + N LI +Y K   L YA  +F+E+PQ DIV+  TM+   + +G  
Sbjct  47   HAHMILSGFTPTVFVTNCLIQMYVKCCALEYAYKVFEEMPQRDIVSWNTMVFGCAGAGRM  106

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             LA  +F+  P    D V +N+ I+ +
Sbjct  107  ELAQAVFNSMP-HHGDVVSWNSLISGY  132



>ref|XP_007135284.1| hypothetical protein PHAVU_010G116300g [Phaseolus vulgaris]
 gb|ESW07278.1| hypothetical protein PHAVU_010G116300g [Phaseolus vulgaris]
Length=510

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 2/93 (2%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
            SL   +H + I SGF+P       L+D+YCK   L  AR LFDE+P   +     M++ Y
Sbjct  100  SLGQMLHTHFIKSGFEPDLFAATALLDMYCKVGTLGLARQLFDEMPVRGVPTWNAMMSGY  159

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +  GD   A E+F   P   R+ V +   I+ +
Sbjct  160  AKFGDMEGALELFGLMP--TRNLVSWTTMISGY  190



>ref|NP_186882.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9FWA6.2|PP207_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g02330 
[Arabidopsis thaliana]
 gb|AEE73793.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=903

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             A  L    HA+MI SGF+P   +LN L+ +Y  S +   A  +FD++P  D+V+   M+
Sbjct  62   GALELGKQAHAHMIISGFRPTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNKMI  121

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              YS S D   A   F+  P+  RD V +N+ ++ +
Sbjct  122  NGYSKSNDMFKANSFFNMMPV--RDVVSWNSMLSGY  155



>ref|XP_009619976.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
 ref|XP_009619977.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
 ref|XP_009619979.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
 ref|XP_009619980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
 ref|XP_009619981.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Nicotiana tomentosiformis]
Length=730

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 51/95 (54%), Gaps = 2/95 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            A +S    +HA  I +G K   H+ N L+  Y KS +LS  + +F EI   D+ + TT+L
Sbjct  68   APTSFGNQLHAFAINAGLKEYPHVSNSLLSFYAKSKDLSSVKRVFSEIENADVYSWTTLL  127

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            +A +  G+   A ++FD  P   R+   +NA IT 
Sbjct  128  SACAKLGEVEYACQMFDEMP--QRNLAVWNAMITG  160



>ref|XP_002991963.1| hypothetical protein SELMODRAFT_134528, partial [Selaginella 
moellendorffii]
 gb|EFJ06931.1| hypothetical protein SELMODRAFT_134528, partial [Selaginella 
moellendorffii]
Length=304

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 7/101 (7%)
 Frame = +3

Query  318  AASSLATAIHANMI-----TSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVA  482
            A SSL +  H  +       SG +    + N LI +Y +  ++  AR  FD+I  P +V+
Sbjct  186  ACSSLKSLYHGKIARMKIHESGLESDVSVGNVLITMYGRCGSIQDARDCFDKIKDPSVVS  245

Query  483  RTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             T +L AY+  GD   AA +FDR PL  ++ V + A ITAH
Sbjct  246  WTALLTAYAQRGDLQEAAMVFDRMPL--KNEVSWTAMITAH  284



>ref|XP_010429126.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 
[Camelina sativa]
Length=786

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 35/111 (32%), Positives = 59/111 (53%), Gaps = 6/111 (5%)
 Frame = +3

Query  285  LQLCSSNIHTPAASS----LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            L+LC++ +      S     A  +H  +I SG     +++N L+++Y K+    +AR LF
Sbjct  13   LELCTNLLQKSVNKSNGRFTAQLVHCRVIKSGLFFSVYLINNLMNVYSKTGYALHARKLF  72

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            DE+PQ    +  T+L+AY+  GD +   E FDR P   +D+V +   I  +
Sbjct  73   DEMPQRTAFSWNTVLSAYAKRGDMDSTCEFFDRLP--QKDSVSWTTMIVGY  121



>ref|XP_007203614.1| hypothetical protein PRUPE_ppa002292mg [Prunus persica]
 gb|EMJ04813.1| hypothetical protein PRUPE_ppa002292mg [Prunus persica]
Length=691

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 6/119 (5%)
 Frame = +3

Query  249  ICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSN  428
            I R  AS Y+  LQLC        A      +HA+   SGF P   I NRLID+Y K  +
Sbjct  80   IDRPSASIYSTLLQLCLQQ----RALVQGKLVHAHTKVSGFVPGLFICNRLIDLYAKCGS  135

Query  429  LSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            L  A+ +FDE+ + D+ +  TM++ Y+  G    A ++FD  P   +D   + A I+ +
Sbjct  136  LVDAQKVFDEMSERDLCSWNTMISGYAKVGLLGEARKLFDEMP--EKDNFSWTAMISGY  192


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+ +    AA +L   +H  M   GF P +   + L+ +Y K  N   A  +F
Sbjct  322  FAGVLNACAHH----AAENLGKQVHGYMTRIGFDPLSFASSALVHMYSKCGNTVNANMVF  377

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
              +P PD+V+ T+++  Y+ +G P  A ++F+
Sbjct  378  KGMPHPDVVSWTSLIVGYAQNGQPYEALQLFE  409



>ref|XP_006451257.1| hypothetical protein CICLE_v10010361mg [Citrus clementina]
 ref|XP_006494315.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g09950-like [Citrus sinensis]
 gb|ESR64497.1| hypothetical protein CICLE_v10010361mg [Citrus clementina]
Length=696

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHIL-NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
            LA  + ++M  + ++P    L NRL+  Y KS  LSYAR LFD++P  DI++   +L+A+
Sbjct  41   LAKRLQSHMDLNFYEPNTTFLHNRLLHFYAKSGKLSYARDLFDKMPLRDIISWNALLSAH  100

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            + SG       +FD+ P+  RD+V YN  I  
Sbjct  101  ARSGSVQDLRALFDKMPI--RDSVSYNTAIAG  130



>ref|XP_009140477.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Brassica rapa]
Length=685

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 36/114 (32%), Positives = 58/114 (51%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            AS Y   +Q+C+       A      +H ++I SGF P   I NRL+ +Y K  +L  AR
Sbjct  79   ASTYCNLIQICTQR----RALEEGKKVHEHIIASGFVPGVVICNRLMGMYAKCGSLVDAR  134

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +FDE+P  D+ +   M+  Y+ +G    A ++FD  P   RD+  + A +  +
Sbjct  135  KVFDEMPHRDVCSWNVMVNGYAEAGLVEEARKVFDEMP--ERDSYSWTAMVNGY  186


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H  M   G+ P +   + L+D+Y K  N+  A+ + D  P+PD+ + T+++  Y+ +G+
Sbjct  335  VHGYMTRVGYDPYSFASSSLVDMYTKCGNMESAKRVVDGCPRPDLFSWTSLIGGYAQNGE  394

Query  522  PNLAAEIFD  548
            P  A + FD
Sbjct  395  PEKALKYFD  403



>ref|XP_008802431.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like 
[Phoenix dactylifera]
Length=508

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            +A S   AIHA ++  GF    +I + L+ +Y +   +  ARHLFD IP+ D+V   +M+
Sbjct  44   SAVSTGKAIHARILQLGFSFDPYIQSGLVRMYSEFDEVGTARHLFDGIPERDVVLWNSMI  103

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
              Y   G+ + A E+F+  P   ++   YNA I  H
Sbjct  104  GGYVKCGNLDSARELFEEMP--AKNVGTYNALIGGH  137



>ref|XP_010098972.1| hypothetical protein L484_025631 [Morus notabilis]
 gb|EXB76274.1| hypothetical protein L484_025631 [Morus notabilis]
Length=564

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = +3

Query  366  GFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            GF  R  I N L+D+Y K   LS AR +FDE+P  +++  T+M++ Y   G  + A E+F
Sbjct  195  GFTDR--INNVLLDMYAKCGWLSVAREIFDEMPTKNVICWTSMVSGYVKFGKLDEAIELF  252

Query  546  DRTPLSMRDTVFYNARITAH  605
            DR+P+  RD V + A I  +
Sbjct  253  DRSPV--RDVVLWTAMINGY  270



>ref|XP_006843375.1| hypothetical protein AMTR_s00053p00090700 [Amborella trichopoda]
 gb|ERN05050.1| hypothetical protein AMTR_s00053p00090700 [Amborella trichopoda]
Length=522

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 52/95 (55%), Gaps = 4/95 (4%)
 Frame = +3

Query  267  SRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARH  446
             RY+  LQ C+ N+      S    +HA++I    KP +HILN L+++Y K    + AR 
Sbjct  46   KRYSTMLQTCALNLSLKQGQS----VHAHVIKGDTKPDSHILNSLVNLYVKCRKPNCARK  101

Query  447  LFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDR  551
            +FDE+ Q D+V+  +++A Y A G+      +F  
Sbjct  102  VFDEMYQRDVVSYNSLIAGYIAQGECEKGLFLFQE  136



>ref|XP_008342174.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49740 
[Malus domestica]
Length=734

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
            +  T +HA+ I +G K   H+ N L+ +Y K+ +L+  + +FD I  PD+ + TT+ +A 
Sbjct  74   AFGTQLHAHAIRTGLKAYPHVANTLLSLYAKAEDLTSVKWVFDGIENPDVYSWTTLFSAC  133

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            +  G  + A E+FD+ P        +NA IT 
Sbjct  134  TKLGHVDYACEVFDKMP-QKGSVAIWNAMITG  164



>emb|CAN67492.1| hypothetical protein VITISV_035978 [Vitis vinifera]
Length=814

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA MI + FKP   + N LI +Y K S+L +A  +FD +PQ D V+   ML  Y+  GD 
Sbjct  65   HARMILTEFKPTVFVTNCLIQMYIKCSDLGFAFKVFDGMPQRDTVSWNAMLFGYAGRGDI  124

Query  525  NLAAEIFDRTP  557
             +A ++FD  P
Sbjct  125  GVAQKLFDAMP  135



>ref|XP_008389431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
 ref|XP_008350909.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like 
[Malus domestica]
Length=536

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +3

Query  324  SSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAA  503
            S L   +H   +  GF     + N L+  YC S ++  AR++FDE+P   +V+ T M++ 
Sbjct  126  SCLGELVHGLCLKLGFVSDIFVGNSLVVXYCASDDMKGARYVFDEMPSLSVVSWTVMISG  185

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            ++  GD N+A   FD  P+  RD   + A I+ +
Sbjct  186  FAKVGDLNMARLFFDEAPV--RDRGIWGAMISGY  217



>ref|XP_010095360.1| hypothetical protein L484_010890 [Morus notabilis]
 gb|EXB59779.1| hypothetical protein L484_010890 [Morus notabilis]
Length=775

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 6/113 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            ++R A  LQ C        A      IHA +  +G      + NRLI++Y K SN++YA 
Sbjct  5    SARLANFLQFCIDK----KAHLAGKLIHAYIFRNGLIFNTFLSNRLIELYSKCSNIAYAH  60

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            H FD+IP+ D+ +   +L A+  +G+   A E+F + P   R+ V +N  I+A
Sbjct  61   HTFDKIPKKDVFSWNAILGAHCKAGNLQDAHELFVKMP--DRNIVSWNNVISA  111



>ref|XP_008790796.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial isoform X3 [Phoenix dactylifera]
Length=420

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 4/97 (4%)
 Frame = +3

Query  270  RYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            R  A LQ CS       AS+   A+HA +I  G      + N LI++Y K +N   A  +
Sbjct  7    RLGALLQQCSK----TKASNHGAAVHAVIIKMGLGSDLVLSNHLINMYAKCNNFKAAHKV  62

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPL  560
            FDE+P  ++V+ + M+A Y  SG+P +A  +F R  L
Sbjct  63   FDEMPNRNLVSWSAMIAGYDQSGNPLMALNLFARMQL  99



>ref|XP_008221533.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like 
[Prunus mume]
Length=526

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 51/95 (54%), Gaps = 2/95 (2%)
 Frame = +3

Query  321  ASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            +S L   +H   +  GF     + N LI +YC   ++  ARH+FDEIP  + V+ T M++
Sbjct  125  SSCLGELVHGCSLKLGFVSDIFVGNSLIVMYCAFDDMKAARHIFDEIPSLNAVSWTVMIS  184

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +S +GD + A   FD  P+  RD   + A I+ +
Sbjct  185  GHSKAGDLDTARLFFDEAPV--RDRGIWGAMISGY  217



>ref|XP_010920669.1| PREDICTED: pentatricopeptide repeat-containing protein ELI1, 
chloroplastic-like [Elaeis guineensis]
Length=626

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA ++  G      + N L+D+Y K    + AR LFDE+P  D+V+  T+++ YS+ GD 
Sbjct  113  HAFVLKRGLDANLFVHNSLVDMYFKFGCPAVARRLFDEMPGRDVVSWNTLISGYSSCGDI  172

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A E+FDR P   R  V ++A I  H
Sbjct  173  TAAREVFDRMP--ERSMVSWSAMIAGH  197



>ref|XP_007038671.1| Tetratricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY23172.1| Tetratricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=546

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 87/187 (47%), Gaps = 41/187 (22%)
 Frame = +3

Query  75   LNCQHPKYGFMVNKSFRLSSMENEASFFLTS*LLQIAMTMKNGA----------AAAKSF  224
            ++CQ  K GF        SS E   S F     +Q ++ +K G            + K  
Sbjct  123  VHCQILKSGFE-------SSFEVSNSLFNMYLKMQASLEVKKGERRDARKVFDDMSVKPV  175

Query  225  ESWAQGIYICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLI  404
            + W Q IY C            +C+ N+   +A  L  ++    + S         N +I
Sbjct  176  QVWNQMIYQC------------VCNGNV--SSAIDLFVSMPVKDVIS--------WNIMI  213

Query  405  DIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFY  584
              Y +   LS ARHLF+ IP+ ++V+ T+M+ AY+ +GD + A +IF++ P   R+ V +
Sbjct  214  LGYTRVGELSKARHLFERIPEKNVVSWTSMIGAYADAGDLDTARKIFEKMPC--RNVVSW  271

Query  585  NARITAH  605
            N+ I+++
Sbjct  272  NSMISSY  278



>gb|KJB77362.1| hypothetical protein B456_012G134100 [Gossypium raimondii]
Length=525

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
             L  AIH + + +GF+    I N LI +Y    ++ YAR +FDE+P  +IV+   ML  Y
Sbjct  119  ELGGAIHGHALKNGFQLDKFINNSLIHMYSSCHDIVYARRVFDEMPMKNIVSWNAMLDGY  178

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +  GD   A ++FD  P   RD V ++  I  +
Sbjct  179  AKCGDMASARQVFDLMP--QRDVVSWSCLIDGY  209



>gb|KDO53133.1| hypothetical protein CISIN_1g0032732mg, partial [Citrus sinensis]
Length=261

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +3

Query  321  ASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQP---DIVARTT  491
            +S   +++HA + +SGF     + N L+ +Y +   LSYAR LFDE+ QP   DIV+  T
Sbjct  150  SSRCGSSVHAVICSSGFDSNVFVCNALMAMYARCDTLSYARQLFDEMFQPGICDIVSWNT  209

Query  492  MLAAYSASGDPNLAAEIFDR  551
            ++AAY+ SGD      +F R
Sbjct  210  IVAAYAQSGDAEGGLMLFAR  229



>ref|XP_004298334.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Fragaria vesca subsp. vesca]
Length=743

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 60/114 (53%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            ++ Y   L+LC  +       S A  IH+++I +   P   +LN LI  Y K  NL YAR
Sbjct  5    SNHYCNLLKLCCQS----GNHSQAKTIHSHIIRTLPSPETFLLNNLITTYGKLGNLKYAR  60

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            H+FD+IP P++ +  ++L+ YS S   +    +F+  P   RD V + + I  +
Sbjct  61   HVFDQIPHPNLFSYNSLLSVYSKSRRVSDMQSLFNCMP--SRDAVSWCSFIAGY  112



>gb|KGN51874.1| hypothetical protein Csa_5G604190 [Cucumis sativus]
Length=535

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            +A     A+H  +I  GF+   H+ + LI +Y + S LS    +F+ + +PD+V +TTM+
Sbjct  45   SACEAGPAVHGALIKHGFEYDPHVESGLIFMYAEMSCLSSCHRVFESVQKPDLVCQTTMV  104

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +A +  GD   A  +FD  P   RD V +NA I  +
Sbjct  105  SACAKCGDIGFARNLFDSMP--QRDFVSWNAMIAGY  138



>gb|EYU42356.1| hypothetical protein MIMGU_mgv1a022159mg, partial [Erythranthe 
guttata]
Length=549

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 49/91 (54%), Gaps = 0/91 (0%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
              A+HA+++  GF    ++   L+D+Y K   + +AR LFDE+ +   V+ T ++  Y  
Sbjct  93   GMAVHAHVVKYGFSSNLYVATALVDMYGKLGQMGFARKLFDEMLERSPVSWTALMTGYIR  152

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            SGD + A  +F   P + RDT  +N  I  +
Sbjct  153  SGDMDDAESLFQTIPCNERDTASFNVMIDGY  183



>ref|XP_006430120.1| hypothetical protein CICLE_v10011370mg [Citrus clementina]
 gb|ESR43360.1| hypothetical protein CICLE_v10011370mg [Citrus clementina]
Length=574

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
             TAIHA +I  G      +   LID+Y K   +S AR +FDE+P+ ++V+ T M+  Y++
Sbjct  155  GTAIHAAVIRWGVDEDVFVGTSLIDLYGKRKEISCARKVFDEMPERNVVSWTAMIVGYAS  214

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
             GD   A  +FD  P   R  V +NA I  
Sbjct  215  VGDLVEAKTVFDLMP--ERSNVSWNALIGG  242


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +3

Query  324  SSLATAIHANMITSGFKPRAHI-LNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            +S+   + A  +      R+++  N LI    K  +L  AR LFDE+P+ ++V+ TTM+ 
Sbjct  213  ASVGDLVEAKTVFDLMPERSNVSWNALIGGLVKIGDLRSARQLFDEMPERNVVSYTTMID  272

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             Y+  GD   A  +F+  P   RD V ++A I+ +
Sbjct  273  GYAKVGDMTSARSLFEAAP--DRDVVAWSALISGY  305



>gb|KDO70550.1| hypothetical protein CISIN_1g046956mg [Citrus sinensis]
Length=574

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
             TAIHA +I  G      +   LID+Y K   +S AR +FDE+P+ ++V+ T M+  Y++
Sbjct  155  GTAIHAAVIRWGVDEDVFVGTSLIDLYGKRKEISCARKVFDEMPERNVVSWTAMIVGYAS  214

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
             GD   A  +FD  P   R  V +NA I  
Sbjct  215  VGDLVEAKTVFDLMP--ERSNVSWNALIGG  242


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +3

Query  324  SSLATAIHANMITSGFKPRAHI-LNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            +S+   + A  +      R+++  N LI    K  +L  AR LFDE+P+ ++V+ TTM+ 
Sbjct  213  ASVGDLVEAKTVFDLMPERSNVSWNALIGGLVKIGDLRSARQLFDEMPERNVVSYTTMID  272

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             Y+  GD   A  +F+  P   RD V ++A I+ +
Sbjct  273  GYAKVGDMTSARSLFEAAP--DRDVVAWSALISGY  305



>ref|XP_007047157.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOX91314.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=684

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/114 (32%), Positives = 63/114 (55%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            AS Y+  +QLC  N     A +   ++H ++  SGF     I NRL+D+Y K  +L+ A+
Sbjct  78   ASLYSTLIQLCCQN----RALNEGKSVHQHIKISGFSAGLVICNRLLDMYAKCGSLADAQ  133

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            ++FDE+ + D+ +  T+++ Y+  G    A ++FD  P   RD   + A I+ +
Sbjct  134  NVFDEMSERDLCSWNTLMSGYAKMGMLKEANKLFDEMP--ERDNFSWTAMISGY  185


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 4/92 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+ +    AA  +   +H  M   GF P +   + L+ +Y K  N+  A+ +F
Sbjct  315  FAGVLNACADH----AAEEIGKQVHGCMTRLGFNPFSFAASALVHMYSKCGNVENAKRVF  370

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
            + +P PD+V+ T+++  Y+ +G P  A E F+
Sbjct  371  NGMPLPDLVSWTSLITGYAQNGQPEEALEYFE  402



>ref|XP_008790794.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial isoform X1 [Phoenix dactylifera]
Length=590

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 4/97 (4%)
 Frame = +3

Query  270  RYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            R  A LQ CS       AS+   A+HA +I  G      + N LI++Y K +N   A  +
Sbjct  7    RLGALLQQCSK----TKASNHGAAVHAVIIKMGLGSDLVLSNHLINMYAKCNNFKAAHKV  62

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPL  560
            FDE+P  ++V+ + M+A Y  SG+P +A  +F R  L
Sbjct  63   FDEMPNRNLVSWSAMIAGYDQSGNPLMALNLFARMQL  99



>ref|XP_010432112.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Camelina sativa]
Length=692

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 37/117 (32%), Positives = 61/117 (52%), Gaps = 6/117 (5%)
 Frame = +3

Query  255  RQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLS  434
            +Q AS Y   +Q+CS       A      +H ++ TSGF P   I NRL+ +Y K  +L 
Sbjct  82   KQPASTYCNLIQVCSQT----RALEEGKKVHEHIRTSGFVPGIVIWNRLLGMYAKCGSLV  137

Query  435  YARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             AR +FD++P+ D+ +   M+  Y+  G  + A ++FD  P   RD+  +   +T +
Sbjct  138  DARKVFDDMPKRDVCSWNLMVNGYAEVGLVDEARKLFDEMP--ERDSYSWTGMVTGY  192


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/115 (28%), Positives = 54/115 (47%), Gaps = 13/115 (11%)
 Frame = +3

Query  231  WAQGIYICRQLASR---------YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRA  383
            W QG  +  +L            +A  L  C+          L   +H  M   GF P +
Sbjct  300  WRQGFSLFSELVGSSCERPNEYTFAGVLNACAD----LTKEELGKQVHGYMTRIGFDPYS  355

Query  384  HILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
               + L+D+Y K  N+  A+H+ D  P+PD+V+ T+++  Y+ +G P+ A + FD
Sbjct  356  FASSSLVDMYTKCGNIESAKHVVDGCPKPDLVSWTSLIGGYAQNGQPDEALKYFD  410



>ref|XP_006354595.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like isoform X1 [Solanum tuberosum]
 ref|XP_006354596.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like isoform X2 [Solanum tuberosum]
 ref|XP_006354597.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like isoform X3 [Solanum tuberosum]
 ref|XP_006354598.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like isoform X4 [Solanum tuberosum]
 ref|XP_006354599.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like isoform X5 [Solanum tuberosum]
 ref|XP_006354600.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like isoform X6 [Solanum tuberosum]
Length=624

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/122 (30%), Positives = 64/122 (52%), Gaps = 14/122 (11%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLAT-----------AIHANMITSGFKPRAHILNRLIDIYCK  419
            Y  ++Q+ + NI  P A + +T           A+H   +  G++   ++   L+D+Y +
Sbjct  110  YVLYIQMLTQNIE-PNAFTFSTLLKTCPLESGKALHCQALKLGYESDTYVRTALVDVYAR  168

Query  420  SSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARIT  599
             S++  AR LFD +P+  +V+ TTM+  Y+ +G    A E+FD   +  RD V +NA I 
Sbjct  169  GSDIVSARKLFDTMPERSLVSLTTMITGYAKNGHVQEARELFD--GMEDRDVVCWNAMID  226

Query  600  AH  605
             +
Sbjct  227  GY  228



>ref|XP_009353870.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 
[Pyrus x bretschneideri]
Length=776

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 51/88 (58%), Gaps = 3/88 (3%)
 Frame = +3

Query  342  IHANMITS-GFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASG  518
            IHA ++ S G      + NRL+++Y K  N+ YA  +FD++P PD+ +   +LA YS  G
Sbjct  27   IHAFLVRSNGLFSNTFLSNRLVELYSKCGNIEYADRVFDKMPHPDVYSWNAILAGYSKFG  86

Query  519  DPNLAAEIFDRTPLSMRDTVFYNARITA  602
                A E+F R P   R+TV +N  I+A
Sbjct  87   SLGDAQELFLRMP--ERNTVSWNTLISA  112



>ref|XP_008246374.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like 
[Prunus mume]
Length=745

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            IH +++ +GF    ++ N LI++Y    N+S AR+LFDEIP  + V+  ++LA Y  +GD
Sbjct  100  IHNHILKTGFDSDVYVQNTLINMYAVCENMSDARNLFDEIPVLNPVSWNSILAGYVRAGD  159

Query  522  PNLAAEIFDRTPLSMRDTVFYNARI  596
               A  I+DR P   R+T+  N+ I
Sbjct  160  AEKAKLIYDRMP--ERNTIASNSMI  182



>ref|XP_002869013.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45272.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=693

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +3

Query  330  LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYS  509
            L   +H  M   GF P +   + LID+Y K  N+  ARH+ D  P+PD+V+ T+++  Y+
Sbjct  339  LGRQVHGYMTRVGFDPYSFASSSLIDMYTKCGNIESARHVVDGCPKPDLVSLTSLIGGYA  398

Query  510  ASGDPNLAAEIFD  548
             +G P+ A + FD
Sbjct  399  QNGKPDEALKYFD  411


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 58/114 (51%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            AS Y   +Q+CS       A      +H ++ TSGF P   I NR++ +Y K  +L  AR
Sbjct  87   ASTYCNLIQVCSQT----RALEEGKKVHEHIRTSGFVPGIVIWNRILGMYAKCGSLVDAR  142

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +FDE+P+ D+ +   M+  Y+  G    A  +FD  P   RD+  + A +T +
Sbjct  143  KVFDEMPERDVCSWNVMVNGYAEVGLLEEARNLFDEMP--ERDSYSWTAMVTGY  194



>gb|KJB21916.1| hypothetical protein B456_004G021000 [Gossypium raimondii]
Length=494

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 5/89 (6%)
 Frame = +3

Query  321  ASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP-----QPDIVAR  485
            A SL T IH+  I +G +   H+++ LI +Y   + +S AR +FDE+P       D+V  
Sbjct  117  AMSLGTQIHSQAICAGLESNVHVVSALIQMYSSCARISDARKVFDEMPLASVCSDDVVVW  176

Query  486  TTMLAAYSASGDPNLAAEIFDRTPLSMRD  572
              M+A Y   GDP+ A ++  R P +  D
Sbjct  177  MAMIAGYVKVGDPDTAMDLLSRMPRTQTD  205



>ref|XP_006411944.1| hypothetical protein EUTSA_v10026762mg [Eutrema salsugineum]
 gb|ESQ53397.1| hypothetical protein EUTSA_v10026762mg [Eutrema salsugineum]
Length=694

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 38/114 (33%), Positives = 57/114 (50%), Gaps = 6/114 (5%)
 Frame = +3

Query  264  ASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            AS Y   +Q+CS       A      +H ++  SGF P   I NRL+ +Y K  +L  AR
Sbjct  88   ASTYCNLIQVCSQK----RALEEGKKVHEHIKNSGFVPGVVICNRLLGMYAKCGSLIDAR  143

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             LFDE+P  D+ +   M+  Y+  G    A ++FD  P   RD+  + A +T +
Sbjct  144  KLFDEMPNKDVCSWNIMVNGYAEVGLLEEARKLFDEMP--ERDSYSWTAMVTGY  195


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 12/114 (11%)
 Frame = +3

Query  231  WAQGIYICRQLASR--------YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAH  386
            W +G  +  +L S         +A  L  C+          L   +H  M   G+ P + 
Sbjct  303  WREGFCLFSELVSSCERPNEYTFAGVLNACTD----LTTEELGKQVHGYMTRIGYDPYSF  358

Query  387  ILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFD  548
              + L+D+Y K  N+  A+H+ D  P+PD+ + T+++  Y+ +G+P  A + FD
Sbjct  359  ASSSLVDMYTKCGNIQSAKHVVDGCPKPDLFSWTSLIGGYAQNGEPEKALKYFD  412



>ref|XP_008454910.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 
isoform X1 [Cucumis melo]
Length=886

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA+MI SGF P   + N LI +Y K   L YA  +F+E+P  DIV+  TM+   + +G  
Sbjct  65   HAHMILSGFTPTVFVTNCLIQMYVKCCALEYAFKVFEEMPHRDIVSWNTMVFGCAGAGRM  124

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             LA  +FD  P    D V +N+ I+ +
Sbjct  125  ELAQAVFDSMP-HHGDVVSWNSLISGY  150



>ref|XP_002971568.1| hypothetical protein SELMODRAFT_96189 [Selaginella moellendorffii]
 gb|EFJ27317.1| hypothetical protein SELMODRAFT_96189 [Selaginella moellendorffii]
Length=542

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 54/88 (61%), Gaps = 2/88 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H  +  +G    A ++N LI +Y +   L  AR LFD++ + ++V+ TTM+AAY+ +G 
Sbjct  197  VHRTVADAGVSLDARVVNMLIHLYGRCGALREARSLFDKLDERNVVSWTTMVAAYAQNGY  256

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
            P+ A  IFD  P   R+ V +NA +TA+
Sbjct  257  PDEARAIFDEMP--RRNLVSWNAMVTAY  282



>emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera]
Length=622

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +3

Query  285  LQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP  464
            L+ CSS     +AS     IHA++I  GF    +  N L+++Y KS ++  AR LFD++ 
Sbjct  125  LKACSSM----SASEETQQIHAHIIKMGFGSEIYTTNSLLNVYSKSGDIKSARLLFDQVD  180

Query  465  QPDIVARTTMLAAYSASGDPNLAAEIFDRTP  557
            Q D V+  +M+  Y+  G+  +A EIF+  P
Sbjct  181  QRDTVSWNSMIDGYTKCGEIEMAYEIFNHMP  211



>gb|KDO57645.1| hypothetical protein CISIN_1g042265mg, partial [Citrus sinensis]
Length=490

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 10/106 (9%)
 Frame = +3

Query  288  QLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQ  467
            QLCS         SLA  IH+ ++  GF     +LN L+ +YC    L  A+ LFDEI  
Sbjct  123  QLCSH--------SLAQTIHSQVLKLGFICDVFVLNSLMHVYCVFHRLRDAQELFDEILY  174

Query  468  PDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             D+V+  T++  Y  +GD   A ++FDR P   RD V +   +  +
Sbjct  175  RDVVSCNTLIDGYVKAGDLAHARQLFDRMPF--RDAVSWGTLVAGY  218



>ref|XP_003559929.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g23330 [Brachypodium distachyon]
Length=646

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 5/87 (6%)
 Frame = +3

Query  315  PAASSLAT-----AIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIV  479
            PA  +LA+      +HA +I  GF     I + LID+YCK  N+S AR +FD I  PDIV
Sbjct  282  PACGNLASLLLGKQLHAYVIRGGFDGNVFISSSLIDMYCKCGNVSIARRIFDRIQSPDIV  341

Query  480  ARTTMLAAYSASGDPNLAAEIFDRTPL  560
            + T M+  ++  G    A  +FDR  L
Sbjct  342  SWTAMIMGHALHGPAREALVLFDRMEL  368



>ref|XP_004485929.1| PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like 
[Cicer arietinum]
Length=548

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +HA +   GF+    I N LID+YCK  ++SYA  +F+E+P+ D+ + T+M+  +   GD
Sbjct  135  VHAMIYEMGFQNDVSIGNGLIDMYCKCGSISYACRVFEEMPERDVASWTSMICGFCNVGD  194

Query  522  PNLAAEIFDRTPLS  563
               A  +F+R  L 
Sbjct  195  IEQALVLFERMKLE  208



>ref|XP_010234956.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g02330-like [Brachypodium distachyon]
Length=868

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +3

Query  354  MITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLA  533
            M+ SGF P A + N L+ +Y + ++ +YAR +FD +P  D V+  TML AYS SGD   A
Sbjct  49   MLVSGFVPTAFVSNCLLQMYARCADAAYARSVFDAMPSRDTVSWNTMLTAYSHSGDIATA  108

Query  534  AEIFDRTPLSMRDTVFYNARITAH  605
              +F   P    D V +N  ++++
Sbjct  109  VSLFHEMPNP--DVVSWNTLVSSY  130



>ref|XP_006348632.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930-like [Solanum tuberosum]
Length=746

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H  ++ +   P   +LN LI+ Y K +N  YAR +F+EIPQP+  +  T+L+ YS SG+
Sbjct  30   LHCFILKTIANPETFLLNNLINAYSKLNNTGYARQVFEEIPQPNQFSWNTILSVYSKSGN  89

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +   ++F+R P   RD V  N  I+ +
Sbjct  90   LSRMLDVFNRMP--KRDGVSCNLIISGY  115



>ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 
[Vitis vinifera]
 emb|CBI23551.3| unnamed protein product [Vitis vinifera]
Length=580

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRA---HILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAA  503
              +IH  +   GF       ++   L+D YCK  ++  AR +FDE+ + ++V+  +MLA 
Sbjct  124  GLSIHGQVQKFGFSGGGDGIYVETALVDFYCKLGDMEIARKMFDEMAERNVVSWNSMLAG  183

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            Y  SGD  +A  +FD  P   +D + +N+ I+ +
Sbjct  184  YLKSGDLVVAQRVFDEIP--QKDVISWNSMISGY  215


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  393  NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRD  572
            N ++  Y KS +L  A+ +FDEIPQ D+++  +M++ Y+ +GD   A  +F + P   R+
Sbjct  178  NSMLAGYLKSGDLVVAQRVFDEIPQKDVISWNSMISGYARAGDMEKALSLFQQMP--ERN  235

Query  573  TVFYNARITAH  605
               +NA I+ +
Sbjct  236  FASWNAMISGY  246



>ref|XP_010252400.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Nelumbo nucifera]
 ref|XP_010252401.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Nelumbo nucifera]
 ref|XP_010252402.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430 
[Nelumbo nucifera]
Length=661

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +3

Query  387  ILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSM  566
            I N L+D+Y K   LS AR +FDE+P  ++++ T+M++ Y   G  + A E+FDRTP+  
Sbjct  269  IRNALLDMYSKCGYLSLARQIFDEMPDKNVISWTSMVSGYVNCGQLDEARELFDRTPV--  326

Query  567  RDTVFYNARITAH  605
            RD + + A I  +
Sbjct  327  RDVILWTAMINGY  339



>ref|XP_009132312.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310 
[Brassica rapa]
Length=543

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H+  + SGF    H++  LI +YC    L  AR +FDE+P  D+     +LA Y   G+
Sbjct  150  VHSQTVVSGFDSSVHVVTSLIQMYCSCEVLGDARKVFDEMPVRDVTVWNALLAGYGKVGE  209

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
             + A  + +  P  +R+ V +   I+A+
Sbjct  210  VDEARRLLEMMPCWVRNVVSWTCVISAY  237



>ref|XP_009347240.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Pyrus x bretschneideri]
Length=692

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            +A  L  C+ +    AA +L   +H  M   GF P +   + L+ +Y K  N+  A  +F
Sbjct  323  FAGVLNACAQH----AAENLGKQVHGYMTRIGFHPLSFAASALVHMYSKCGNIENANKVF  378

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIF  545
            +E+P PD+V+ T+++A Y+ +G PN A ++F
Sbjct  379  NEMPCPDVVSWTSLIAGYAQNGQPNEALQLF  409


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +3

Query  246  YICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSS  425
            +I +  AS Y+  L LC   +H  A +     +HA+   SGF P   I NRLI++Y K  
Sbjct  80   HIDKPSASIYSTLLLLC---LHQRALAH-GKLVHAHTRASGFVPGMFICNRLIEMYAKCG  135

Query  426  NLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            ++  A+ +FDE+P+ D+ +  TM++ ++  G    A ++FD  P   RD   + A I+ +
Sbjct  136  SIVDAQMVFDEMPERDLCSWNTMISGHAKVGQLAEARKLFDEMP--QRDNFSWTAMISGY  193



>ref|XP_007032935.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
[Theobroma cacao]
 gb|EOY03861.1| Pentatricopeptide repeat (PPR) superfamily protein, putative 
[Theobroma cacao]
Length=860

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            H  MI SGF P   + N LI +Y K  NL YA  +FD + Q DIV+   ++  Y+++G  
Sbjct  65   HCQMIISGFIPTIFVANCLIQLYIKCGNLGYANKVFDRMSQRDIVSWNALVFGYASNGMM  124

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
             +A   FD  P   +D V +N+ I+ +
Sbjct  125  GIAKSYFDEMP--EKDVVSWNSLISGY  149



>ref|XP_006485061.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61800-like 
[Citrus sinensis]
Length=523

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 10/106 (9%)
 Frame = +3

Query  288  QLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQ  467
            QLCS         SLA  IH+ ++  GF     +LN L+ +YC    L  A+ LFDEI  
Sbjct  123  QLCSH--------SLAQTIHSQVLKLGFICDVFVLNSLMHVYCVFHRLRDAQELFDEILY  174

Query  468  PDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             D+V+  T++  Y  +GD   A ++FDR P   RD V +   +  +
Sbjct  175  RDVVSCNTLIDGYVKAGDLAHARQLFDRMPF--RDAVSWGTLVAGY  218



>ref|XP_002878586.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH54845.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=786

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/111 (32%), Positives = 59/111 (53%), Gaps = 6/111 (5%)
 Frame = +3

Query  285  LQLCSSNIHTPAASS----LATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            L+LC++ +      S     A  +H  +I SG     +++N L+++Y K+    +AR LF
Sbjct  13   LELCTNLLQKSVNKSNGRFTAQLVHCRVIKSGLVFSVYLMNNLMNVYSKTGYALHARKLF  72

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            DE+P     +  T+L+AY+  GD + + E FDR P   RD+V +   I  +
Sbjct  73   DEMPLRTAFSWNTVLSAYAKRGDMDSSCEFFDRLP--QRDSVSWTTMIVGY  121



>ref|XP_010488060.1| PREDICTED: pentatricopeptide repeat-containing protein At3g20730-like 
[Camelina sativa]
Length=572

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = +3

Query  267  SRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARH  446
            S Y   L+LCS  I           IH + +T+GF     + N LID+Y K  ++ +AR 
Sbjct  20   SLYLKALKLCSFQI----VKKQLLLIHGDTVTNGFGSNLQLNNTLIDLYSKQGDMKHARK  75

Query  447  LFDEIPQPDIVARTTMLAAYSASG  518
            LFD IP+ D+V+ T M++ +S  G
Sbjct  76   LFDRIPKRDVVSWTVMISGFSRCG  99



>ref|XP_008242522.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Prunus mume]
Length=695

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHIL-NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAA  503
            S A  + ++M    F+P    L NR++ +Y KS NL  AR LFD++P+ D+ +   ML+A
Sbjct  39   SQAKRLQSHMDLHLFQPTKTFLHNRILQLYAKSGNLGDARDLFDKMPKKDVYSWNAMLSA  98

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            Y+ SG       IFD+ P   RD V YN  I  
Sbjct  99   YAKSGSVEELGTIFDQMP--SRDLVSYNTVIAG  129



>ref|XP_004239007.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Solanum lycopersicum]
 ref|XP_010320815.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Solanum lycopersicum]
 ref|XP_010320816.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Solanum lycopersicum]
 ref|XP_010320817.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Solanum lycopersicum]
 ref|XP_010320818.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Solanum lycopersicum]
 ref|XP_010320819.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g68930 [Solanum lycopersicum]
Length=743

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H  ++ +   P   +LN LI+ Y K +N  YAR +F+EIPQP+  +  T+L+ YS  G+
Sbjct  27   LHCFILKTIANPETFLLNNLINAYSKLNNTGYARQVFEEIPQPNQFSWNTVLSVYSKCGN  86

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +   ++F+R P   RD V +N  I+ +
Sbjct  87   ISRMLDVFNRMP--KRDGVSWNLIISGY  112



>ref|XP_006838888.1| hypothetical protein AMTR_s00002p00268120 [Amborella trichopoda]
 gb|ERN01457.1| hypothetical protein AMTR_s00002p00268120 [Amborella trichopoda]
Length=364

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
              +IH+++I SGF     +++ LI +Y K  ++  AR +FDE+ QP+IVA T M+  Y  
Sbjct  126  GNSIHSHLIRSGFDSNQFVMSSLIKLYTKGGSIVSARQIFDEMNQPEIVAWTAMINGYLT  185

Query  513  SGDPNLAAEIFDR  551
             G+ N A  +F R
Sbjct  186  QGELNEALALFKR  198



>emb|CDP00497.1| unnamed protein product [Coffea canephora]
Length=713

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
            A  +H  +I +   P   +LN LI  Y K  N+ YAR++FD+IP+P++ +  T+L+AYS 
Sbjct  24   AKKLHCIIIKTLENPETFLLNNLIHSYIKLHNVVYARNVFDKIPKPNLFSWNTILSAYSK  83

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            SG+ +   E+F   P   +D V +N  I+ +
Sbjct  84   SGNLSKMEEVFKLMP--KKDGVSWNLIISGY  112



>ref|XP_007204248.1| hypothetical protein PRUPE_ppa002250mg [Prunus persica]
 gb|EMJ05447.1| hypothetical protein PRUPE_ppa002250mg [Prunus persica]
Length=695

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHIL-NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAA  503
            S A  + ++M    F+P    L NR++ +Y KS NL  AR LFD++P+ D+ +   ML+A
Sbjct  39   SQAKRLQSHMDLHLFQPTKTFLHNRILQLYAKSGNLGDARDLFDKMPKKDVYSWNAMLSA  98

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            Y+ SG       IFD+ P   RD V YN  I  
Sbjct  99   YAKSGSVEELGTIFDQMP--SRDLVSYNTVIAG  129



>ref|XP_004135465.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405-like [Cucumis sativus]
Length=614

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            +A     A+H  +I  GF+   H+ + LI +Y + S LS    +F+ + +PD+V +TTM+
Sbjct  124  SACEAGPAVHGALIKHGFEYDPHVESGLIFMYAEMSCLSSCHRVFESVQKPDLVCQTTMV  183

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +A +  GD   A  +FD  P   RD V +NA I  +
Sbjct  184  SACAKCGDIGFARNLFDSMP--QRDFVSWNAMIAGY  217



>gb|KDO80373.1| hypothetical protein CISIN_1g007077mg [Citrus sinensis]
Length=619

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +3

Query  393  NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRD  572
            N L+D+YCK   LS AR LFDE+P  +++  T+M++ Y   G    A ++FDR+P+  RD
Sbjct  228  NALLDMYCKCGCLSEARELFDEMPNKNVICWTSMVSGYVNCGQLEKARDLFDRSPV--RD  285

Query  573  TVFYNARITAH  605
             V + A I  +
Sbjct  286  IVLWTAMINGY  296



>gb|EYU44257.1| hypothetical protein MIMGU_mgv1a021838mg [Erythranthe guttata]
Length=820

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 47/87 (54%), Gaps = 2/87 (2%)
 Frame = +3

Query  345  HANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDP  524
            HA +I SGFKP   + N LI +Y K S L  A  +FD + +PD V+   M+  YS SG  
Sbjct  18   HARLIISGFKPTTFVTNCLIQMYIKCSRLECACKVFDRMSEPDRVSWNAMIFGYSKSGKM  77

Query  525  NLAAEIFDRTPLSMRDTVFYNARITAH  605
              A   F+  P   RD + +N+ I+ +
Sbjct  78   GSAQSFFNSMP--ARDVISWNSLISGY  102



>ref|XP_004233728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g44230 
[Solanum lycopersicum]
Length=651

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 54/93 (58%), Gaps = 3/93 (3%)
 Frame = +3

Query  327  SLATAIHANMIT-SGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAA  503
            +L   IH   I   GF     + N LID+Y K   L Y R +FDE+ + D+++ T+++ A
Sbjct  159  NLGRQIHCQSIKLGGFCEDLFVHNILIDMYVKCGWLDYGRKVFDEMSERDVISWTSLIVA  218

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            YS +GD   AAE+F+R P+  +D V + A ++ 
Sbjct  219  YSKAGDMAAAAEMFERLPV--KDLVAWTAMVSG  249



>ref|XP_006475772.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like 
[Citrus sinensis]
Length=663

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +3

Query  393  NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRD  572
            N L+D+YCK   LS AR LFDE+P  +++  T+M++ Y   G    A ++FDR+P+  RD
Sbjct  272  NALLDMYCKCGCLSEARELFDEMPNKNVICWTSMVSGYVNCGQLEKARDLFDRSPV--RD  329

Query  573  TVFYNARITAH  605
             V + A I  +
Sbjct  330  IVLWTAMINGY  340



>ref|XP_006451021.1| hypothetical protein CICLE_v10007671mg [Citrus clementina]
 gb|ESR64261.1| hypothetical protein CICLE_v10007671mg [Citrus clementina]
Length=663

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/71 (41%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = +3

Query  393  NRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRD  572
            N L+D+YCK   LS AR LFDE+P  +++  T+M++ Y   G    A ++FDR+P+  RD
Sbjct  272  NALLDMYCKCGCLSEARELFDEMPNKNVICWTSMVSGYVNCGQLEKARDLFDRSPV--RD  329

Query  573  TVFYNARITAH  605
             V + A I  +
Sbjct  330  IVLWTAMINGY  340



>ref|XP_002523296.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF39012.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=353

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 58/114 (51%), Gaps = 12/114 (11%)
 Frame = +3

Query  294  CSSNIHT-----PAASSLATAIHANMI-----TSGFKPRAHILNRLIDIYCKSSNLSYAR  443
            C+ N HT      A +S  + +HA M+      SGF+     L  L+D+YCK   +++A 
Sbjct  78   CTGNQHTFTFLFAACASFFSPLHAQMLHTHFKKSGFESDVIALTALVDMYCKLGMVAFAH  137

Query  444  HLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +FDEIP  DI     ++A YS  GD   A +IF   P   R+ V + A I+ +
Sbjct  138  RVFDEIPVRDIPTWNALIAGYSRCGDMEGALKIFKLMP--DRNVVSWTAMISGY  189



>ref|XP_010508236.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880-like 
[Camelina sativa]
Length=597

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H+ +  SGF    ++   ++D+Y K   +  AR++FDE+PQ   V+ T ++  Y   G+
Sbjct  141  LHSQIWRSGFCADMYVSTGVVDMYAKFGRMGCARNVFDEMPQRSEVSWTALICGYVRCGE  200

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +LA+++FD  P  ++D V YNA +  +
Sbjct  201  LDLASKLFDEMP-QVKDVVIYNAMMDGY  227



>ref|XP_003632466.2| PREDICTED: pentatricopeptide repeat-containing protein At4g37170 
[Vitis vinifera]
Length=695

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 37/120 (31%), Positives = 65/120 (54%), Gaps = 6/120 (5%)
 Frame = +3

Query  246  YICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSS  425
            ++ R  A+ Y+  LQLC        A      +HA+  TSGF P   I NR++D+Y K +
Sbjct  83   HVDRPSAATYSTLLQLCLQ----LRALDEGMKVHAHTKTSGFVPGVVISNRILDMYIKCN  138

Query  426  NLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +L  A+ LFDE+ + D+ +   M++ Y+ +G    A ++FD+  ++ RD   + A  + +
Sbjct  139  SLVNAKRLFDEMAERDLCSWNIMISGYAKAGRLQEARKLFDQ--MTERDNFSWTAMTSGY  196


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            AA  L   +H  M   GF P +   + L+ +Y K  N+  AR +F+ +P+PD+V+ T+++
Sbjct  337  AAEELGKQVHGYMTRIGFDPSSFAASTLVHMYTKCGNIKNARRVFNGMPRPDLVSWTSLI  396

Query  498  AAYSASGDPNLAAEIFD  548
            + Y+ +G P+ A + F+
Sbjct  397  SGYAQNGQPDEALQFFE  413



>ref|XP_007222375.1| hypothetical protein PRUPE_ppa004015mg [Prunus persica]
 gb|EMJ23574.1| hypothetical protein PRUPE_ppa004015mg [Prunus persica]
Length=535

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 50/95 (53%), Gaps = 2/95 (2%)
 Frame = +3

Query  321  ASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            +S L   +H   +  GF     + N LI +YC   ++  ARH+FDEIP    V+ T M++
Sbjct  124  SSCLGELVHGCSLKLGFVSDIFVGNSLIVMYCAFDDMKAARHIFDEIPSLSAVSWTVMIS  183

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +S +GD + A   FD  P+  RD   + A I+ +
Sbjct  184  GHSKAGDLDTARLFFDEAPV--RDRGIWGAMISGY  216



>ref|XP_006483247.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At5g40405-like [Citrus sinensis]
Length=619

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = +3

Query  333  ATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSA  512
            A  +HA+++  GF    H+ + LI +Y +   L Y + +FD I +PD+V +T M++A + 
Sbjct  134  ALLVHASVLRRGFHNDPHVQSGLIFMYAELGCLGYCQKVFDGIHEPDVVCQTAMISACAK  193

Query  513  SGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             GD +LA ++FD  P   RD + +NA +  +
Sbjct  194  CGDVDLARKMFDEMP--ERDPIAWNAMLAGY  222



>ref|XP_003566841.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like 
[Brachypodium distachyon]
Length=815

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +HA ++ S   P   +L+ L+++YCK   L  AR +FD +P  DIVA T M++A++A+GD
Sbjct  72   LHARLLRSALHPDTFLLDSLLNMYCKCGRLVDARRVFDGMPHRDIVAWTAMISAHTAAGD  131

Query  522  PNLAAEIFDR  551
             + A ++F R
Sbjct  132  SDQALDMFAR  141



>ref|XP_004248284.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 
[Solanum lycopersicum]
Length=577

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF-DEIPQPDIVARTTMLAA  503
            S   +IHA +   GF    ++   L+D Y K  N+ +AR +F DE+ + +IV+  ++L  
Sbjct  121  SGGISIHAQVFKYGFCNVVYVQTALVDFYSKVGNMDFARSIFDDEMVEKNIVSWNSVLGG  180

Query  504  YSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            Y  SGD  +A  +FD  P   +D + +N+ ++ +
Sbjct  181  YVKSGDLTMAQSVFDEMP--EKDVISWNSMVSGY  212



>ref|XP_009416454.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g01580 [Musa acuminata subsp. malaccensis]
 ref|XP_009416455.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g01580 [Musa acuminata subsp. malaccensis]
 ref|XP_009416456.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g01580 [Musa acuminata subsp. malaccensis]
 ref|XP_009416457.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g01580 [Musa acuminata subsp. malaccensis]
Length=831

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 7/106 (7%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLF  452
            Y+  L  CSS    P       A+H  ++ +G +P AH+ N L+++YCK  +L  AR LF
Sbjct  71   YSRMLHGCSSRGSLPRGK----AVHGRLLRAGIEPDAHLWNCLLNMYCKCGSLKGARLLF  126

Query  453  DEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNA  590
            + +P  D+VA T ++AA++ + D      +F      M D V+ NA
Sbjct  127  ELMPHRDVVAWTCLMAAHACANDGEEGMRMFCEM---MTDGVWPNA  169



>gb|KHN33415.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=988

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 2/95 (2%)
 Frame = +3

Query  321  ASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLA  500
            A  L   +H +   S F PR  I NRL+D+Y K  +L  A+ LFDE+   D+ +  TM+A
Sbjct  425  ALELGRRVHTHTKASSFVPRIFISNRLLDMYSKCGSLVDAQMLFDEMGHRDLCSWNTMIA  484

Query  501  AYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
             Y+  G    A ++FD  P   RD   +NA I+ +
Sbjct  485  GYAKLGRLEQARKLFDEMP--QRDNFSWNAAISGY  517


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/76 (33%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            AA  L   +H  M+ +G+ P +  ++ L+ +Y K  N   AR +F+E+ QPD+V+ T+++
Sbjct  618  AAEHLGKEVHRYMMRTGYGPFSFAISALVHMYSKCGNTRVARKVFNEMHQPDLVSWTSLI  677

Query  498  AAYSASGDPNLAAEIF  545
              Y+ +G P  A   F
Sbjct  678  VGYAQNGQPEEALHFF  693



>ref|XP_004139977.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Cucumis sativus]
 ref|XP_004154524.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like [Cucumis sativus]
Length=586

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
             A   A  +H ++ ++G++P+  ++N LI++Y K   L  AR+LFDE+P  ++V+ TTM+
Sbjct  30   GAVQQARLVHEHVFSNGYEPKTFLINTLINMYVKFGLLDEARNLFDEMPDRNVVSWTTMI  89

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTV  578
            +AYS S   NL  +  D   L +R+ V
Sbjct  90   SAYSNS---NLNHKALDFLILMLREGV  113



>ref|XP_004163116.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like 
[Cucumis sativus]
Length=442

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = +3

Query  327  SLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAY  506
             L  A+H +++ SG +    I N LI +Y    +++ AR +FDE+P+ ++V    ML  Y
Sbjct  130  ELGMAVHVHIVKSGHEIDKFIQNSLIHMYASCRDIASARKVFDEMPRKNLVTWNAMLDGY  189

Query  507  SASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +  GD N+A E+F+  P   +D V +++ I  +
Sbjct  190  AKCGDLNMAREVFNLMP--EKDVVSWSSLIDGY  220



>ref|XP_010506424.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880-like 
[Camelina sativa]
Length=597

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            +H+ +  SGF    ++   ++D+Y K   +  AR +FDE+PQ   V+ T ++  Y   G+
Sbjct  141  LHSQIWRSGFCADMYVSTGVVDMYAKFGKMGCARDVFDEMPQRSEVSWTALICGYVRCGE  200

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
             +LA+++FD  P  ++D V YNA +  +
Sbjct  201  LDLASKLFDEMP-QVKDVVVYNAMMDGY  227



>ref|XP_010104571.1| hypothetical protein L484_025549 [Morus notabilis]
 gb|EXC01172.1| hypothetical protein L484_025549 [Morus notabilis]
Length=763

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +3

Query  183  AMTMKNGAAAAKSFESWAQGIYICRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMIT  362
            ++T   G +   S   + + +   R+ AS  ++H            +SS A  +HA++I 
Sbjct  43   SITHLEGTSELSSSTDFREALSAMREGASTESSHYARLLKRCIDDNSSSTAETVHAHIIK  102

Query  363  SGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEI  542
            +GF   + +   L+++Y K   + YAR +FD +P+ ++VA TT++  Y  +  P LA  +
Sbjct  103  TGFHEDSFVSTFLVNVYVKCGVMEYARKVFDNLPRRNVVAWTTLMTGYVHNSQPELAIRV  162

Query  543  F  545
            F
Sbjct  163  F  163



>emb|CDY36989.1| BnaC09g18050D [Brassica napus]
Length=664

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 63/111 (57%), Gaps = 8/111 (7%)
 Frame = +3

Query  273  YAAHLQLCSSNIHTPAASSLATAIHANMIT-SGFKPRAHILNRLIDIYCKSSNLSYARHL  449
            ++A L+ C S        SL    HA     SGF    ++ N +ID+Y K  ++  AR +
Sbjct  159  FSALLKACGS----VGDLSLGRQFHAQTFRLSGF-CSVYVGNTMIDLYVKCGSMECARKV  213

Query  450  FDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
            FDE+P+ D+++ T ++AAY+ +GD + AAE+F+  P   +D V + A +T 
Sbjct  214  FDEMPERDVISWTELIAAYAKAGDMDSAAELFENLP--KKDIVAWTAMVTG  262



>ref|XP_008798789.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880-like 
[Phoenix dactylifera]
 ref|XP_008777031.1| PREDICTED: pentatricopeptide repeat-containing protein At2g44880-like 
[Phoenix dactylifera]
Length=626

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/104 (34%), Positives = 53/104 (51%), Gaps = 2/104 (2%)
 Frame = +3

Query  285  LQLCSSNIHTPAASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIP  464
            L+ C+S   +P  +S    +HA++I  GF         L+D+Y KS N+  AR +FD +P
Sbjct  149  LKSCASLAGSPKETSEGLQLHADVIKMGFCCNTFASTALVDMYSKSGNMGSARKVFDGMP  208

Query  465  QPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARI  596
                 + T+M   Y+ SGD   A E+F   P   +D   +NA I
Sbjct  209  HRSPASWTSMAVGYARSGDAGAAMELFTWMP--EKDMAAFNAMI  250


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +3

Query  390  LNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMR  569
             N +ID++ K  +L  AR LFDE+   ++V+ T++++ Y  +GD  +A  +FD  P   R
Sbjct  246  FNAMIDVFVKLGDLGSARRLFDEMQDRNVVSWTSLISGYCKAGDMEVARALFDDMP--ER  303

Query  570  DTVFYNARITAH  605
            +   +NA I  +
Sbjct  304  NLYSWNAMIGGY  315



>ref|XP_010096333.1| hypothetical protein L484_021080 [Morus notabilis]
 gb|EXB63808.1| hypothetical protein L484_021080 [Morus notabilis]
Length=615

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = +3

Query  318  AASSLATAIHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTML  497
            + S    ++H  +I  GF+   HI + LI +Y +   LS    +F  IP+P +V +T M+
Sbjct  125  SGSETGPSVHGAVIKQGFENDPHIQSGLIFMYAELGRLSSCHRVFGVIPEPGVVCQTAMV  184

Query  498  AAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITAH  605
            +A +  GD  LA ++FD  P   RD V +NA I  +
Sbjct  185  SACAKCGDVGLARDLFDEMP--QRDHVAWNAMIAGY  218



>ref|XP_002463110.1| hypothetical protein SORBIDRAFT_02g037960 [Sorghum bicolor]
 gb|EER99631.1| hypothetical protein SORBIDRAFT_02g037960 [Sorghum bicolor]
Length=802

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 61/121 (50%), Gaps = 10/121 (8%)
 Frame = +3

Query  252  CRQLASRYAAHLQLCSSNIHTPAASSLATAIHANMITSGF---KPRAHILNRLIDIYCKS  422
            C  L  R AA   L SS+            +HA ++TS      P  H+  RLI +Y  S
Sbjct  18   CSVLLRRLAASRSLTSSSF-----LRALRCLHARLLTSALLHAPPHPHLTLRLIHLYTLS  72

Query  423  SNLSYARHLFDEIPQPDIVARTTMLAAYSASGDPNLAAEIFDRTPLSMRDTVFYNARITA  602
             +L  A  LF   P P  VA T+++AAY+A+G    A   FD  P + RDTV +NA I+A
Sbjct  73   GDLPAAATLFRADPCP--VAATSLVAAYAAAGRLPAAVSFFDAVPQARRDTVLHNAVISA  130

Query  603  H  605
            +
Sbjct  131  Y  131



>ref|XP_008369504.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 
[Malus domestica]
Length=578

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = +3

Query  342  IHANMITSGFKPRAHILNRLIDIYCKSSNLSYARHLFDEIPQPDIVARTTMLAAYSASGD  521
            IHA +   GF    ++   L+D Y K  ++  AR +FD +P+ ++V+  ++L+ Y  SGD
Sbjct  128  IHAQVYKFGFCGCVYVQTALVDFYSKLGDMKTARKVFDGMPEKNVVSWNSVLSGYMKSGD  187

Query  522  PNLAAEIFDRTPLSMRDTVFYNARITAH  605
               A E+FD  P   +D V +N+ ++ +
Sbjct  188  MEEAQEVFDEIP--NKDVVSWNSMVSGY  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800