BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS126B04

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1       97.1    1e-19   Nicotiana sylvestris
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1       92.4    3e-18   Nicotiana tomentosiformis
ref|XP_011094236.1|  PREDICTED: BEL1-like homeodomain protein 1       83.6    4e-15   
ref|XP_006348466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  80.9    3e-14   Solanum tuberosum [potatoes]
emb|CDP10596.1|  unnamed protein product                              80.5    4e-14   Coffea canephora [robusta coffee]
gb|KEH41936.1|  BEL1-related homeotic protein                         76.6    7e-13   Medicago truncatula
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  76.3    1e-12   Glycine max [soybeans]
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  76.3    1e-12   Glycine max [soybeans]
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1       73.9    6e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004228612.1|  PREDICTED: BEL1-like homeodomain protein 1       73.9    7e-12   Solanum lycopersicum
ref|XP_004497655.1|  PREDICTED: BEL1-like homeodomain protein 1-like  73.2    1e-11   Cicer arietinum [garbanzo]
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor           72.8    1e-11   Trifolium pratense [peavine clover]
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1       70.9    6e-11   
gb|EPS74374.1|  hypothetical protein M569_00381                       70.1    6e-11   Genlisea aurea
gb|KDP36113.1|  hypothetical protein JCGZ_08757                       70.5    7e-11   Jatropha curcas
ref|XP_009404911.1|  PREDICTED: BEL1-like homeodomain protein 1       70.5    9e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  67.8    7e-10   
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1        66.6    1e-09   
emb|CBI24428.3|  unnamed protein product                              65.5    3e-09   Vitis vinifera
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1       65.5    4e-09   Vitis vinifera
ref|XP_008449596.1|  PREDICTED: BEL1-like homeodomain protein 1       65.1    5e-09   
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1       64.7    6e-09   Vitis vinifera
emb|CAN69527.1|  hypothetical protein VITISV_027380                   64.7    6e-09   Vitis vinifera
emb|CAN63083.1|  hypothetical protein VITISV_015358                   64.7    6e-09   Vitis vinifera
ref|XP_010912386.1|  PREDICTED: BEL1-like homeodomain protein 1       64.3    9e-09   
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1       63.2    2e-08   Phoenix dactylifera
ref|XP_004494251.1|  PREDICTED: BEL1-like homeodomain protein 1-like  62.8    2e-08   Cicer arietinum [garbanzo]
ref|XP_002524053.1|  bel1 homeotic protein, putative                  62.8    3e-08   Ricinus communis
ref|XP_004140170.1|  PREDICTED: BEL1-like homeodomain protein 1-like  62.4    4e-08   
ref|XP_010107002.1|  hypothetical protein L484_016932                 60.5    4e-08   
gb|KJB62029.1|  hypothetical protein B456_009G396900                  60.8    1e-07   Gossypium raimondii
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g           60.8    1e-07   Phaseolus vulgaris [French bean]
gb|KJB55565.1|  hypothetical protein B456_009G082700                  60.1    2e-07   Gossypium raimondii
ref|XP_011467196.1|  PREDICTED: BEL1-like homeodomain protein 1       60.1    2e-07   Fragaria vesca subsp. vesca
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1       58.9    5e-07   Cucumis melo [Oriental melon]
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  58.2    7e-07   Glycine max [soybeans]
gb|KJB36260.1|  hypothetical protein B456_006G149100                  58.2    7e-07   Gossypium raimondii
gb|KJB35453.1|  hypothetical protein B456_006G115600                  58.2    9e-07   Gossypium raimondii
ref|XP_009403681.1|  PREDICTED: BEL1-like homeodomain protein 1       57.8    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1       57.8    1e-06   Phoenix dactylifera
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g           57.4    1e-06   Phaseolus vulgaris [French bean]
gb|KJB09137.1|  hypothetical protein B456_001G125400                  57.4    1e-06   Gossypium raimondii
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                     57.0    2e-06   
gb|KHG11906.1|  BEL1-like homeodomain protein 1                       56.6    2e-06   Gossypium arboreum [tree cotton]
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like  55.8    4e-06   
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like  55.8    5e-06   
gb|KHG12856.1|  BEL1-like homeodomain protein 1                       55.5    6e-06   Gossypium arboreum [tree cotton]
gb|KHG12855.1|  BEL1-like homeodomain protein 1                       55.5    6e-06   Gossypium arboreum [tree cotton]
gb|KHF99976.1|  BEL1-like homeodomain protein 1                       55.5    6e-06   Gossypium arboreum [tree cotton]
gb|KHG11905.1|  BEL1-like homeodomain protein 1                       55.1    9e-06   Gossypium arboreum [tree cotton]
gb|KHN08605.1|  BEL1-like homeodomain protein 1                       54.7    1e-05   Glycine soja [wild soybean]
gb|KEH24245.1|  BEL1-related homeotic protein                         54.7    1e-05   Medicago truncatula
ref|XP_003554466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  54.7    1e-05   Glycine max [soybeans]
gb|KHG01894.1|  BEL1-like homeodomain protein 1                       53.1    3e-05   Gossypium arboreum [tree cotton]
ref|XP_011090301.1|  PREDICTED: BEL1-like homeodomain protein 1       53.1    4e-05   Sesamum indicum [beniseed]
ref|XP_010031566.1|  PREDICTED: BEL1-like homeodomain protein 1       52.8    5e-05   Eucalyptus grandis [rose gum]
ref|XP_004978737.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  51.6    1e-04   
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg           51.6    1e-04   
ref|XP_002450321.1|  hypothetical protein SORBIDRAFT_05g003750        51.2    2e-04   Sorghum bicolor [broomcorn]
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1       51.2    2e-04   Nicotiana tomentosiformis
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1       50.4    2e-04   Prunus mume [ume]
emb|CDP15553.1|  unnamed protein product                              50.4    3e-04   Coffea canephora [robusta coffee]
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1       50.4    3e-04   
gb|EYU25630.1|  hypothetical protein MIMGU_mgv11b017830mg             50.1    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1       49.3    7e-04   Eucalyptus grandis [rose gum]
ref|XP_010931060.1|  PREDICTED: BEL1-like homeodomain protein 1       49.3    7e-04   Elaeis guineensis
ref|XP_006481599.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  48.9    0.001   Citrus sinensis [apfelsine]
gb|KDO70617.1|  hypothetical protein CISIN_1g005514mg                 48.9    0.001   Citrus sinensis [apfelsine]



>ref|XP_009787672.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787673.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787674.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=707

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 72/108 (67%), Gaps = 14/108 (13%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ----PAAGTNFAFLNSITSGGN  431
            MA YF GNSEIQGG DGLQTLILMNPAGY  VGFS+TQ    PA G+N  F NS    GN
Sbjct  1    MAAYFPGNSEIQGGNDGLQTLILMNPAGY--VGFSETQHHQPPAGGSNLVFFNS-NPPGN  57

Query  432  AVTLSHAppppsqsqqFVGIPLATAA----GSHQEAHASAVHSQQHDI  563
            ++ LSHA  PPS  QQFVGIPLAT+A     S        VHS QHDI
Sbjct  58   SLNLSHA--PPSSQQQFVGIPLATSAFTAPSSQDGTTTPTVHS-QHDI  102



>ref|XP_009628712.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628714.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628715.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=700

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 69/106 (65%), Gaps = 10/106 (9%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ--PAAGTNFAFLNSITSGGNAV  437
            MA YF GNSEIQGG DGLQTLILMNPAGY  VGFS+TQ  PA G+N  F NS    GN++
Sbjct  1    MAAYFDGNSEIQGGNDGLQTLILMNPAGY--VGFSETQQPPAGGSNLVFFNS-NPLGNSL  57

Query  438  TLSHAppppsqsqqFVGIPLA----TAAGSHQEAHASAVHSQQHDI  563
             L HA  P SQ QQFVGIPLA    TA  S  +   +     QHDI
Sbjct  58   NLPHA-RPSSQQQQFVGIPLATSVFTAPSSFPDGTTTPTVHSQHDI  102



>ref|XP_011094236.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=710

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +3

Query  264  MATYFHGNSEIQGGG-DGLQTLILMNPAGYVNVGFSDT---QPAAGTNFAFLNSITSGGN  431
            MATYFHGNSEIQGGG DGLQTLILMNPA    VG+SDT   QP   +NF FLNS +SG N
Sbjct  1    MATYFHGNSEIQGGGGDGLQTLILMNPA---YVGYSDTQQQQPPPSSNFVFLNSNSSGNN  57

Query  432  AVTLSHAppppsqsqqFVGIPL  497
               + HA  PP+Q+Q FVG PL
Sbjct  58   GHNIPHA--PPTQTQHFVGFPL  77



>ref|XP_006348466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348467.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Solanum 
tuberosum]
Length=704

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 64/91 (70%), Gaps = 13/91 (14%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ------PAAGT--NFAFLNSIT  419
            MA+YFHGNSEIQ G DGLQTLILMNP GY  VGFS+TQ      P  G+  N  F NS  
Sbjct  1    MASYFHGNSEIQEGNDGLQTLILMNP-GY--VGFSETQHHHAPPPPGGSSNNIVFFNS-N  56

Query  420  SGGNAVTLSHAppppsqsqq-FVGIPLATAA  509
              GN++ LSHAPPPP   QQ FVGIPLATAA
Sbjct  57   PLGNSINLSHAPPPPPPPQQHFVGIPLATAA  87



>emb|CDP10596.1| unnamed protein product [Coffea canephora]
Length=680

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 76/115 (66%), Gaps = 22/115 (19%)
 Frame = +3

Query  264  MATYFHGNSEIQGGG--DGLQTLILMNPAGYVNVGFSDT-QPA--------AGTNFAFLN  410
            MATYFHGNSEIQGGG   GLQTLILMN AGYV  G+SDT QP           +NF FLN
Sbjct  1    MATYFHGNSEIQGGGGDHGLQTLILMNHAGYVG-GYSDTHQPPPHVQVQVQPPSNFVFLN  59

Query  411  SITS-------GGNAVTLSHAppppsqsqqFVGIPL-ATAAGSHQ--EAHASAVH  545
            S  +       G N++ + HAPPPPS +QQFVGIPL ATAA S Q  + HA++V 
Sbjct  60   SSNTPGPSAAPGANSLNVHHAPPPPSPTQQFVGIPLTATAATSSQDHQPHAASVQ  114



>gb|KEH41936.1| BEL1-related homeotic protein [Medicago truncatula]
Length=649

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 53/97 (55%), Gaps = 3/97 (3%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFH NSEIQGG DGLQTLI MNP+GY+N   +   P    N  FLNS  +     +L
Sbjct  1    MATYFHNNSEIQGGSDGLQTLIFMNPSGYINYSDAPQPPPHAGNLVFLNSAANHPGNTSL  60

Query  444  SHAppppsq--sqqFVGIPLATAAGS-HQEAHASAVH  545
             H           QFVG+PL+    S H     SA+H
Sbjct  61   HHQQQQSLSHAPPQFVGVPLSAEQQSVHAHHDVSALH  97



>ref|XP_003535815.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006588872.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=661

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 56/83 (67%), Gaps = 6/83 (7%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-GTNFAFLNSITSGGNAVT  440
            MATYFH NSEIQ G DGLQTL+LMNP GYV   +SDT P   G N  FLNS     +  +
Sbjct  1    MATYFHSNSEIQAGADGLQTLVLMNP-GYVQ--YSDTPPPPHGGNLVFLNSAAGNASLQS  57

Query  441  LSHAppppsqsqqFVGIPLATAA  509
            L HA  PP  +QQFVG+PL+ AA
Sbjct  58   LPHA--PPPHTQQFVGVPLSAAA  78



>ref|XP_003519115.1| PREDICTED: BEL1-like homeodomain protein 1-like isoformX1 [Glycine 
max]
 ref|XP_006575286.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006575287.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=664

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 63/101 (62%), Gaps = 9/101 (9%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-GTNFAFLNSITSGGNAVT  440
            MATYFH NSEIQ G DGLQTL+LMNP GYV   +SDT P   G N  FLNS     +   
Sbjct  1    MATYFHSNSEIQAGADGLQTLVLMNP-GYVQ--YSDTPPPPHGGNLVFLNSAAGNASLQN  57

Query  441  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
            LSHA  PP  +QQFVG+PL+ AA        +++H   HD+
Sbjct  58   LSHA--PPPHTQQFVGVPLSAAAAHEPPPPPASMH---HDV  93



>ref|XP_010263012.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010263013.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=739

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 64/103 (62%), Gaps = 16/103 (16%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG SEIQ   DGLQTL LMNP GY  VG+SDTQP +  N  FLNS  +  N  +L
Sbjct  1    MATYFHGTSEIQ--ADGLQTLYLMNP-GY--VGYSDTQPPS--NMVFLNSAGNTLNPASL  53

Query  444  SHAppppsqsqqFVGIPL------ATAAGSHQEAHASAVHSQQ  554
            SHA      SQ  VGIPL      A AA + Q+ +  +VHSQQ
Sbjct  54   SHA---AQTSQHLVGIPLQATAVAAGAAAASQDPNRPSVHSQQ  93



>ref|XP_004228612.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=700

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 64/93 (69%), Gaps = 15/93 (16%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSD----------TQPAAGTNFAFLNS  413
            MA+YFHGNSEIQ G DGLQTLILMNP GY  VGFS+           Q   G+N  F NS
Sbjct  1    MASYFHGNSEIQEGNDGLQTLILMNP-GY--VGFSEAQHHHAPPPPPQGGGGSNIVFFNS  57

Query  414  ITSGGNAVTLSHA-ppppsqsqqFVGIPLATAA  509
                GN++ LSHA PPPPSQ QQFVGIPLATAA
Sbjct  58   -NPLGNSINLSHAPPPPPSQQQQFVGIPLATAA  89



>ref|XP_004497655.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=667

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 57/99 (58%), Gaps = 13/99 (13%)
 Frame = +3

Query  264  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGT---NFAFLNSITSGGN  431
            MATYFH NSEIQGG  DGLQTLI MNP+GY+N  +SDT P       N  FLNS      
Sbjct  1    MATYFHNNSEIQGGSADGLQTLIFMNPSGYIN--YSDTPPQQSQHAGNLVFLNSA-----  53

Query  432  AVTLSHAppppsqsqqFVGIPLATAAGSHQEAH-ASAVH  545
            A T  H         QFVG+PL TA  S Q  H  SA+H
Sbjct  54   ANTSIHQQNLSHAPPQFVGVPL-TAEQSVQAHHDISALH  91



>dbj|BAE71188.1| BEL1-like homeodomain transcription factor [Trifolium pratense]
Length=651

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 55/103 (53%), Gaps = 15/103 (15%)
 Frame = +3

Query  264  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNS-ITSGGNAV  437
            MATYFH NSEIQGG  DGLQTLI MNP+GY+N   +   P    N  FLNS  T  GN  
Sbjct  1    MATYFHNNSEIQGGSADGLQTLIFMNPSGYINYSDTPQPPPHAGNLVFLNSAATLAGNGN  60

Query  438  T-------LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVH  545
            T       LSHA        QFVG+PL+           SA+H
Sbjct  61   TSIQQQHNLSHA------PPQFVGVPLSAEQSVQAHHDISALH  97



>ref|XP_010247184.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247191.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247201.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247208.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247219.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247226.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247233.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=729

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 65/105 (62%), Gaps = 17/105 (16%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG SEIQ   DGLQTL LMNP GY  VG++DTQP   +N  FLNS  +  N  +L
Sbjct  1    MATYFHGTSEIQ--ADGLQTLYLMNP-GY--VGYTDTQPP--SNMVFLNSTGNTLNPASL  53

Query  444  SHAppppsqsqqFVGIPLA-------TAAGSHQEAHASAVHSQQH  557
             +A   P Q+Q  VGIPL        +AA + Q+ +  +VH+QQ 
Sbjct  54   VNA---PQQNQHLVGIPLQAAAVPPGSAAAAAQDPNRPSVHNQQE  95



>gb|EPS74374.1| hypothetical protein M569_00381 [Genlisea aurea]
Length=404

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 54/86 (63%), Gaps = 13/86 (15%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-------GTNFAFLNS-IT  419
            M TY+HG+SEIQGGGDGLQTLILMNPA    VG+ D Q A        G NF FLNS   
Sbjct  1    MGTYYHGDSEIQGGGDGLQTLILMNPA---FVGYGDGQQAPPSGAVAQGNNFVFLNSGSA  57

Query  420  SGGNAVTLSHAppppsqsqqFVGIPL  497
            + G    LSH    P Q+Q FVGIPL
Sbjct  58   AAGVGNNLSHG--APPQTQHFVGIPL  81



>gb|KDP36113.1| hypothetical protein JCGZ_08757 [Jatropha curcas]
Length=676

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 60/98 (61%), Gaps = 17/98 (17%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT-  440
            MATYFHGN EIQ   +GLQTL+LMNP  YV   +SDT P    N  FLN   SG N ++ 
Sbjct  1    MATYFHGNPEIQASAEGLQTLVLMNPT-YVQ--YSDTPPPPSNNLVFLN---SGTNHLSP  54

Query  441  ---LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVH  545
               LSHA   P  +QQFVGIPL     SH +  ASA+H
Sbjct  55   PPHLSHA---PPNTQQFVGIPLDPT--SHHD--ASALH  85



>ref|XP_009404911.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 59/101 (58%), Gaps = 9/101 (9%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG  EIQ   DGLQTL LMNP+    VG+SD   AA  N   LNS  +  N + L
Sbjct  1    MATYFHGAPEIQP--DGLQTLYLMNPS---YVGYSDA--AAPANMVLLNSTLNSMNPINL  53

Query  444  SHApppps-qsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
            + A  P   Q QQFVGIPL TAA  H+      +H+  HD+
Sbjct  54   AQASQPNHHQQQQFVGIPLQTAAQPHESYRPPPIHA-PHDL  93



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 58/100 (58%), Gaps = 12/100 (12%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG  EIQ   DGLQTL LMNP+    VG++D   AA  N  FLNS  +  N++ L
Sbjct  1    MATYFHGAPEIQ--PDGLQTLYLMNPS---YVGYTDA--AAPANMVFLNSTMNSVNSINL  53

Query  444  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
            +       Q Q FVGIPL +AA  H    +  +H+  HD+
Sbjct  54   AQT----GQQQHFVGIPLQSAAQPHDSHRSQPIHA-SHDV  88



>ref|XP_007027982.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027983.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027984.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08484.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08485.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08486.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
Length=668

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 60/100 (60%), Gaps = 19/100 (19%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    N  FLNS     N+++ 
Sbjct  1    MATYFHGNPEIQ-APDGLQTLVLMNPA-YVQ--YSDTAPPPANNLVFLNS-----NSLS-  50

Query  444  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
             HA  P   +QQFVGIPL   + ++Q+  +       HDI
Sbjct  51   PHA--PSPHTQQFVGIPLPATSSANQDPSS-------HDI  81



>emb|CBI24428.3| unnamed protein product [Vitis vinifera]
Length=573

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  444  SHAppppsqsqqFVGIPLATA-AGSHQEAHASAVHSQ  551
             +      Q+Q FVGIPL    + +  + + S++H+Q
Sbjct  56   PN---MSLQNQHFVGIPLPNMGSANSDDQNRSSLHAQ  89



>ref|XP_002275098.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=728

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  444  SHAppppsqsqqFVGIPLAT-AAGSHQEAHASAVHSQ  551
             +      Q+Q FVGIPL    + +  + + S++H+Q
Sbjct  56   PN---MSLQNQHFVGIPLPNMGSANSDDQNRSSLHAQ  89



>ref|XP_008449596.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
 ref|XP_008449597.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=693

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 49/90 (54%), Gaps = 7/90 (8%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLN-SITSGGNAVT  440
            MATYFHG SEIQ   DG+ TL LMNP  Y  V +SDT   +  N  FLN S T   N  T
Sbjct  1    MATYFHGGSEIQTNSDGIHTLYLMNP-NY--VPYSDTHSQSSHNMLFLNPSSTHALNPST  57

Query  441  LSHAppppsqsqqFVGIPLATAAGSHQEAH  530
            L HA   P  +  FVGIPL T   S    H
Sbjct  58   LPHA---PPSNNHFVGIPLPTTDSSRPSFH  84



>ref|XP_002266838.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653287.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653288.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653289.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653290.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653292.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=696

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 53/81 (65%), Gaps = 9/81 (11%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAG--TNFAFLNSITSGGNAV  437
            MATYFHGNSEIQ   DGLQTLILMNPA    VG+SD  P      NF FLNS  +     
Sbjct  1    MATYFHGNSEIQ--ADGLQTLILMNPA---YVGYSDAPPPPPLHPNFVFLNSAAASLAPS  55

Query  438  TLSHAppppsqsqqFVGIPLA  500
             LSHA  PP Q+QQFV IPL+
Sbjct  56   NLSHA--PPPQTQQFVSIPLS  74



>emb|CAN69527.1| hypothetical protein VITISV_027380 [Vitis vinifera]
Length=728

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 58/97 (60%), Gaps = 9/97 (9%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  444  SHAppppsqsqqFVGIPLAT-AAGSHQEAHASAVHSQ  551
             +      Q+Q FVGIPL    + +  + + S +H+Q
Sbjct  56   PN---MXLQNQHFVGIPLPNMGSANSDDQNRSXLHAQ  89



>emb|CAN63083.1| hypothetical protein VITISV_015358 [Vitis vinifera]
Length=709

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 53/81 (65%), Gaps = 9/81 (11%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAG--TNFAFLNSITSGGNAV  437
            MATYFHGNSEIQ   DGLQTLILMNPA    VG+SD  P      NF FLNS  +     
Sbjct  1    MATYFHGNSEIQ--ADGLQTLILMNPA---YVGYSDAPPPPPLHPNFVFLNSAAASLAPS  55

Query  438  TLSHAppppsqsqqFVGIPLA  500
             LSHA  PP Q+QQFV IPL+
Sbjct  56   NLSHA--PPPQTQQFVSIPLS  74



>ref|XP_010912386.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=663

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 54/100 (54%), Gaps = 14/100 (14%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG  EIQ   DGLQTL LMNP  Y  VG+SDT  AA  N   LNS+ S      +
Sbjct  1    MATYFHGTPEIQ--TDGLQTLYLMNP-NY--VGYSDTAAAAPANMVLLNSMNSLN---PI  52

Query  444  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
            +H      Q Q FVGIPL     SH+ +    +    HD+
Sbjct  53   NH-----QQQQHFVGIPLQPTVASHESSRPQPIEV-PHDV  86



>ref|XP_008784116.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784117.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784118.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=660

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 54/100 (54%), Gaps = 13/100 (13%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG  EIQ   DGLQTL LMNP  Y  VG+SDT  A G N   LNS+ S      +
Sbjct  1    MATYFHGAPEIQ--PDGLQTLYLMNP-NY--VGYSDTAAAQG-NMVLLNSMNSLN---PM  51

Query  444  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
            +H      Q Q FVGIPL     SH+      + +  HD+
Sbjct  52   NH----HQQQQHFVGIPLQPTVASHESNRPQPIQAPAHDV  87



>ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=686

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 61/107 (57%), Gaps = 14/107 (13%)
 Frame = +3

Query  264  MATYFHGN--SEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT-----NFAFLNSITS  422
            MATYFHGN  S+  GG DGLQTL+LMNP  Y+    +  QP   +     N  FLNS T+
Sbjct  1    MATYFHGNNNSDQSGGADGLQTLVLMNPT-YIQYSDTTQQPPPPSHSSTGNLVFLNSTTT  59

Query  423  GGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
              N+ +  HA  PPS +QQFVGIPL T +      H+   H   HD+
Sbjct  60   NNNSYS-PHA--PPSHTQQFVGIPLTTNSQDINNQHSIHAH---HDV  100



>ref|XP_002524053.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF38263.1| bel1 homeotic protein, putative [Ricinus communis]
Length=679

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = +3

Query  264  MATYFHGNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQPA-AGTNFAFLNSITSGGNAV  437
            MATYFHGN EIQ    +GLQTL+LMNP  YV   +SDT P    +N  FLNS  S  N  
Sbjct  1    MATYFHGNPEIQAAAAEGLQTLVLMNPT-YVQ--YSDTPPPQPSSNLVFLNSAAS--NLT  55

Query  438  TLSHAppppsqsqqFVGIPL  497
               H    P  +QQFVGIPL
Sbjct  56   PPPHFSHAPPSTQQFVGIPL  75



>ref|XP_004140170.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 ref|XP_004156066.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN48050.1| hypothetical protein Csa_6G426360 [Cucumis sativus]
Length=698

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLN-SITSGGNAVT  440
            MATYFHG SEIQ   DG+ TL LMNP  Y  V +SDT   +  N  FLN S T   N  T
Sbjct  1    MATYFHGGSEIQNNSDGIHTLYLMNP-NY--VPYSDTHSQSSHNMLFLNPSSTHALNPST  57

Query  441  LSHAppppsqsqqFVGIPLAT  503
            L H    P  +  FVGIPL T
Sbjct  58   LPHP---PPSNNHFVGIPLPT  75



>ref|XP_010107002.1| hypothetical protein L484_016932 [Morus notabilis]
 gb|EXC13000.1| hypothetical protein L484_016932 [Morus notabilis]
Length=241

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 8/56 (14%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGD-GLQTLILMNPAGYVNVGFSDTQP-----AAGTNFAFLNS  413
            MATYFHGNSEIQ   D GLQTL+LMNP GY+   +SD+ P     AA  N  FLNS
Sbjct  1    MATYFHGNSEIQAATDGGLQTLVLMNPTGYIP--YSDSPPPPHSAAAQGNLFFLNS  54



>gb|KJB62029.1| hypothetical protein B456_009G396900 [Gossypium raimondii]
Length=653

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 49/87 (56%), Gaps = 16/87 (18%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-GTNFAFLNSITSGGNAVT  440
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    +N  F N      N+++
Sbjct  1    MATYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPQASNLLFFNP-----NSLS  52

Query  441  LSHAppppsqsqqFVGIPLATAAGSHQ  521
                       QQ VGIPL   + ++Q
Sbjct  53   PPQT-------QQLVGIPLPATSAANQ  72



>ref|XP_007162972.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
 gb|ESW34966.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
Length=679

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 65/105 (62%), Gaps = 12/105 (11%)
 Frame = +3

Query  264  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQPA---AGTNFAFLNS-ITSG  425
            MATYFH GNSEIQ G  DGLQTL+LMNP GY++   + +QP    A  N  FLNS   +G
Sbjct  1    MATYFHHGNSEIQSGAADGLQTLVLMNP-GYIHYSDAPSQPPPSHAAGNLVFLNSAAVAG  59

Query  426  GNAVTLSHAppppsqsqqFVGIPLATAAG-SHQEAHA----SAVH  545
             N+    +   PPS +QQFVGIPL+ +   +H   HA    SA+H
Sbjct  60   TNSNNSFNPHAPPSHTQQFVGIPLSASQDLNHHSMHAHHDVSALH  104



>gb|KJB55565.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
 gb|KJB55566.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
Length=721

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 9/84 (11%)
 Frame = +3

Query  264  MATYFHGNSEIQGG---GDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGGN  431
            MATY HG+SE Q      DG+QTL LMNP  YV   +SDT QPA  TN  FLN   +  N
Sbjct  1    MATYIHGSSEFQAAPAASDGMQTLYLMNP-NYV--PYSDTHQPATATNMFFLNPAGNSLN  57

Query  432  AVTLSHAppppsqsqqFVGIPLAT  503
             ++L HA  PPS    F+G+PL +
Sbjct  58   PISLPHA--PPSNYNHFLGLPLPS  79



>ref|XP_011467196.1| PREDICTED: BEL1-like homeodomain protein 1 [Fragaria vesca subsp. 
vesca]
Length=704

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 58/95 (61%), Gaps = 19/95 (20%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSD------TQPAAGTN--FAFLNSIT  419
            MATY+HGNSEIQ    GLQTL+LMN  GY  V +SD      +  AA TN    FLNS  
Sbjct  1    MATYYHGNSEIQSPDGGLQTLVLMNHGGY--VPYSDATQQQHSPSAAATNQQLVFLNS--  56

Query  420  SGGN-----AVTLSHAppppsqsqqFVGIPLATAA  509
            +G N     A TL HA  PPS +QQFVGIPL T +
Sbjct  57   AGANNQLAQASTLPHA--PPSHTQQFVGIPLPTVS  89



>ref|XP_008442920.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=713

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 57/108 (53%), Gaps = 11/108 (10%)
 Frame = +3

Query  264  MATYFHGNS-EIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT-----NFAFLNSITSG  425
            MATY HGNS + Q    GLQTL+LMNP  YV   FSDT P         N  F NS TS 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTPPPPPPPPSHPNLVFFNSPTSA  57

Query  426  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDI  563
             N  T     PP S +QQFVGIPL T  AA    + H S   +  HDI
Sbjct  58   ANTFTALTQAPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDI  105



>ref|XP_003521496.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006577097.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006577098.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006577099.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=679

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 67/109 (61%), Gaps = 20/109 (18%)
 Frame = +3

Query  264  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQPAAGT------NFAFLN-SI  416
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD  P          N  FLN + 
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPPPQQQTSQTAGNLVFLNPAA  57

Query  417  TSGGNAVTLS-HAppppsqsqqFVGIPLATAAG-SHQEAHA----SAVH  545
             +GGN  + + HA  PPS +QQFVGIPL  +   +H   HA    SA+H
Sbjct  58   VAGGNNNSFNPHA--PPSHTQQFVGIPLPNSQDLNHHSMHAHHDVSALH  104



>gb|KJB36260.1| hypothetical protein B456_006G149100 [Gossypium raimondii]
Length=644

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 55/92 (60%), Gaps = 13/92 (14%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  F+NS++    +   
Sbjct  1    MATYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFVNSLSPNAPS---  55

Query  444  SHAppppsqsqqFVGIPL-ATAAGSHQEAHAS  536
            SH+       QQ VGIPL A  +GS+Q+A +S
Sbjct  56   SHS-------QQLVGIPLPAVTSGSNQDAISS  80



>gb|KJB35453.1| hypothetical protein B456_006G115600 [Gossypium raimondii]
Length=717

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 49/85 (58%), Gaps = 10/85 (12%)
 Frame = +3

Query  264  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT  440
            MATYFHG+S+ Q    DGLQTL LMNP  YV    +  QP+A TN  FLN  TS   A  
Sbjct  1    MATYFHGSSDFQAASADGLQTLYLMNP-NYVPYADTHQQPSAATNMFFLNP-TSLPQAPP  58

Query  441  LSHAppppsqsqqFVGIPLATAAGS  515
             +H        Q+F+G+PL T + S
Sbjct  59   PNH-------HQRFLGLPLPTPSTS  76



>ref|XP_009403681.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=540

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 52/101 (51%), Gaps = 12/101 (12%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGNAV  437
            MAT+ HG  E+Q   DGLQTL LMNP  AGY++        AA  N   LNS  +  N +
Sbjct  1    MATFIHGAPEVQP--DGLQTLFLMNPGYAGYMDA-------AAPANMVLLNSTMNSLNPI  51

Query  438  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHD  560
             L+ A  P  Q Q FVGIPL  AA          +H+  HD
Sbjct  52   ILAQAGQPNQQQQDFVGIPLQPAARLRDSDRPLPIHA-SHD  91



>ref|XP_008799712.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008799713.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=673

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 53/101 (52%), Gaps = 10/101 (10%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHG  E Q   DGLQTL LMNP  Y  VG+SDT  AA  N   LNS  +  N V L
Sbjct  1    MATYFHGAPEFQ--ADGLQTLYLMNP-NY--VGYSDT--AAPANMILLNSAMNSLNPVNL  53

Query  444  SH--AppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHD  560
             H  A   P+Q Q   GIP      SH+    S + +  HD
Sbjct  54   GHCAAMAQPNQQQHLAGIPPQPTVASHESNRLSFIQA-SHD  93



>ref|XP_007145789.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
 gb|ESW17783.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
Length=649

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 49/84 (58%), Gaps = 5/84 (6%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPA-AGTNFAFLNS-ITSGGNAV  437
            MATYF  N +IQ G DGLQTL+LMN + YV   +SD  P   G N  FLNS  T   N  
Sbjct  1    MATYFQSNPKIQSGADGLQTLVLMN-SDYVQ--YSDAPPPHHGGNHLFLNSAATVANNTS  57

Query  438  TLSHAppppsqsqqFVGIPLATAA  509
             L+    P   +QQFVG+PL+  A
Sbjct  58   LLNLPHAPSPHTQQFVGVPLSATA  81



>gb|KJB09137.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09138.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09139.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
Length=693

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 53/99 (54%), Gaps = 10/99 (10%)
 Frame = +3

Query  264  MATYFHGNSEIQGGG----DGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGG  428
            MATYFHG+SE Q       DG+QTL LMNP  Y  + +SDT QP A TN  FLN   +  
Sbjct  1    MATYFHGSSEFQAASVASPDGMQTLYLMNP-NY--IPYSDTNQPFAATNLFFLNPAGNAL  57

Query  429  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVH  545
            N  +  H   PP      +G+PL T   S   A+++  H
Sbjct  58   NPSSFPHT--PPPNYHHLLGLPLPTPTASIVPANSNETH  94



>ref|XP_007015671.1| BEL1 homeodomain 1, putative [Theobroma cacao]
 gb|EOY33290.1| BEL1 homeodomain 1, putative [Theobroma cacao]
Length=732

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 58/105 (55%), Gaps = 16/105 (15%)
 Frame = +3

Query  264  MATYFHGNSEIQGGG----DG-LQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSG  425
            MATYFHG+SE Q       DG +QTL LMNP  YV   +SDT QPAA TN  FLN   + 
Sbjct  1    MATYFHGSSEFQAASAAAPDGTMQTLYLMNP-NYV--PYSDTHQPAAATNMFFLNPAGNA  57

Query  426  GNAVTLSHAppppsqsqqFVGIPLATAA-----GSHQEAHASAVH  545
             N  +L HA  PP      +G+PL T A     GS  + H  ++H
Sbjct  58   LNPTSLHHA--PPPNHHHLLGLPLPTPAASIGPGSSDDPHRPSLH  100



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 51/93 (55%), Gaps = 19/93 (20%)
 Frame = +3

Query  255  QRK---MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITS  422
            QRK   M+TYFHGN EIQ   DGLQTL+LMNPA YV   +SDT  P    N  F N    
Sbjct  22   QRKQHPMSTYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPPANNLLFFNP---  75

Query  423  GGNAVTLSHAppppsqsqqFVGIPLATAAGSHQ  521
              N+++           QQ VGIPL   + ++Q
Sbjct  76   --NSLSPPQT-------QQLVGIPLPATSAANQ  99



>ref|XP_004171976.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN59214.1| hypothetical protein Csa_3G782620 [Cucumis sativus]
Length=716

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 59/108 (55%), Gaps = 11/108 (10%)
 Frame = +3

Query  264  MATYFHGNS-EIQGGGDGLQTLILMNPAGYVNVGFSDT-----QPAAGTNFAFLNSITSG  425
            MATY HGNS + Q    GLQTL+LMNP  YV   FSDT      P +  N  F NS +S 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTTPPPPPPPSHPNLLFFNSPSST  57

Query  426  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDI  563
             N  T    PPP S +QQFVGIPL T  AA    + H S   +  HDI
Sbjct  58   ANTFTTLVQPPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDI  105



>ref|XP_004136516.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
Length=716

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 59/108 (55%), Gaps = 11/108 (10%)
 Frame = +3

Query  264  MATYFHGNS-EIQGGGDGLQTLILMNPAGYVNVGFSDT-----QPAAGTNFAFLNSITSG  425
            MATY HGNS + Q    GLQTL+LMNP  YV   FSDT      P +  N  F NS +S 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTTPPPPPPPSHPNLLFFNSPSST  57

Query  426  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDI  563
             N  T    PPP S +QQFVGIPL T  AA    + H S   +  HDI
Sbjct  58   ANTFTTLVQPPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDI  105



>gb|KHG12856.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=763

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 13/92 (14%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MA YFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  FLNS++    +   
Sbjct  120  MAAYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFLNSLSPNAPS---  174

Query  444  SHAppppsqsqqFVGIPL-ATAAGSHQEAHAS  536
            SH+       QQ VGIPL A  + S+Q+A +S
Sbjct  175  SHS-------QQLVGIPLPAVTSRSNQDAISS  199



>gb|KHG12855.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=644

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 13/92 (14%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MA YFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  FLNS++    +   
Sbjct  1    MAAYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFLNSLSPNAPS---  55

Query  444  SHAppppsqsqqFVGIPL-ATAAGSHQEAHAS  536
            SH+       QQ VGIPL A  + S+Q+A +S
Sbjct  56   SHS-------QQLVGIPLPAVTSRSNQDAISS  80



>gb|KHF99976.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=693

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 52/99 (53%), Gaps = 10/99 (10%)
 Frame = +3

Query  264  MATYFHGNSEIQGGG----DGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGG  428
            MATY HG+SE Q       DG+QTL LMNP  Y+   +SDT QP A TN  FLN   +  
Sbjct  1    MATYSHGSSEFQAASVAAPDGMQTLYLMNP-NYI--PYSDTNQPVAATNLLFLNPAGNAL  57

Query  429  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVH  545
            N  +  H   PP      +G+PL T   S   A+++  H
Sbjct  58   NPSSFPHT--PPPNYHHLLGLPLPTPTASIVPANSNETH  94



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 48/87 (55%), Gaps = 16/87 (18%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGGNAVT  440
            M+TYFHGN EIQ   DGLQTL+LMNPA YV   +SDT  P    N  F N      N+++
Sbjct  1    MSTYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPPANNLLFFNP-----NSLS  52

Query  441  LSHAppppsqsqqFVGIPLATAAGSHQ  521
                       QQ VGIPL   + ++Q
Sbjct  53   PPQT-------QQLVGIPLPATSAANQ  72



>gb|KHN08605.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=679

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 64/109 (59%), Gaps = 20/109 (18%)
 Frame = +3

Query  264  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQPA------AGTNFAFLN--S  413
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD          A  N  FLN  +
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPQQQQQSSLAAGNLVFLNPAA  57

Query  414  ITSGGNAVTLSHAppppsqsqqFVGIPLATAAG-SHQEAHA----SAVH  545
            +  G N     HA  PPS +QQFVG+PL  +   +H   HA    SA+H
Sbjct  58   VAGGNNNSFNPHA--PPSHTQQFVGVPLPNSQDLNHHSMHAHHDVSALH  104



>gb|KEH24245.1| BEL1-related homeotic protein [Medicago truncatula]
Length=660

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%), Gaps = 20/92 (22%)
 Frame = +3

Query  264  MATYFHG-NSEIQ----GGGDGLQTLILMNPAGYVNVGFSD-------TQPAAGT--NFA  401
            MATY+HG NSEIQ    GG DGLQTL+LMNP+ Y+   +SD        QP+  T  N+ 
Sbjct  1    MATYYHGGNSEIQSSGGGGADGLQTLVLMNPS-YIQ--YSDASQQQQAQQPSHATAGNYV  57

Query  402  FLNSITSGGNAVTLSHAppppsqsqqFVGIPL  497
            FLNS  +  N+ +  HA  PPS +QQFVGIPL
Sbjct  58   FLNSTAAENNSFS-PHA--PPSNTQQFVGIPL  86



>ref|XP_003554466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006604654.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=680

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 67/111 (60%), Gaps = 23/111 (21%)
 Frame = +3

Query  264  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSD--------TQPAAGTNFAFLN-  410
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD        +  AAG N  FLN 
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPQQQQQQSSLAAG-NLVFLNP  56

Query  411  -SITSGGNAVTLSHAppppsqsqqFVGIPLATAAG-SHQEAHA----SAVH  545
             ++  G N     HA  PPS +QQFVG+PL  +   +H   HA    SA+H
Sbjct  57   AAVAGGNNNSFNPHA--PPSHTQQFVGVPLPNSQDLNHHSMHAHHDVSALH  105



>gb|KHG01894.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=634

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 47/87 (54%), Gaps = 18/87 (21%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  443
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    N           +A   
Sbjct  1    MATYFHGNPEIQ-APDGLQTLVLMNPA-YVQ--YSDTTPPPQPNNLVF-------HAPPP  49

Query  444  SHAppppsqsqqFVGIPLATAAGSHQE  524
             H        QQFVG+PL   + ++Q+
Sbjct  50   PHT-------QQFVGVPLTATSTANQD  69



>ref|XP_011090301.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
 ref|XP_011090302.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=629

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 55/101 (54%), Gaps = 16/101 (16%)
 Frame = +3

Query  273  YFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGG----NAVT  440
            YF G+SEIQ   D LQTL LMNP  Y  VG+SD       N  F NS T+      N   
Sbjct  2    YFQGSSEIQA--DALQTLYLMNP-NY--VGYSDNHHQPQPNILFSNSATAATVQALNPAL  56

Query  441  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
            + HA  PP+Q+Q FVGIPL     SH  +  S+V  QQ DI
Sbjct  57   MHHA--PPAQAQHFVGIPL-----SHDPSRPSSVLGQQEDI  90



>ref|XP_010031566.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW50924.1| hypothetical protein EUGRSUZ_J00574 [Eucalyptus grandis]
Length=693

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 53/105 (50%), Gaps = 19/105 (18%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLN---SITSGG  428
            MATYFHG+SEI+   DGLQTL ++NP    Y N     T P    N  FLN   S T   
Sbjct  1    MATYFHGSSEIE-ATDGLQTLYILNPNFIPYSNAAHDATAP----NTLFLNPMGSATQPA  55

Query  429  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
             +  L+H          FVGIPL+  A     A AS VH  +H+I
Sbjct  56   PSPQLNH--------NHFVGIPLSGPAAPFGPA-ASDVHPNRHEI  91



>ref|XP_004978737.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004978738.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Setaria 
italica]
 ref|XP_004978739.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Setaria 
italica]
 ref|XP_004978740.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Setaria 
italica]
 ref|XP_004978741.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X5 [Setaria 
italica]
 ref|XP_004978742.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X6 [Setaria 
italica]
 ref|XP_004978743.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X7 [Setaria 
italica]
 ref|XP_004978744.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X8 [Setaria 
italica]
Length=662

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 9/84 (11%)
 Frame = +3

Query  264  MATYFHGN--SEIQGGGDGLQTLILMNP---AGYVNVGFSDTQPAAGTNFAFLNSITSGG  428
            MA Y+HG   ++IQ   DGLQTL LMNP   AGY + G S   PA   N   LNS  S  
Sbjct  1    MAAYYHGGAGTDIQASTDGLQTLYLMNPSYTAGYADAGASPPGPA---NMMLLNSAVSTM  57

Query  429  NAVTLS-HAppppsqsqqFVGIPL  497
               +   H   P +  Q FVGIPL
Sbjct  58   TPASFGHHQQSPSAAQQHFVGIPL  81



>ref|XP_007204250.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 ref|XP_007204251.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05449.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05450.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
Length=707

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 56/94 (60%), Gaps = 20/94 (21%)
 Frame = +3

Query  264  MATYFH-GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQPAAGT----------NFAF  404
            MATYFH GNS EIQ   DG LQTL+LMNP GYV   +SDT P              N  F
Sbjct  1    MATYFHHGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPPHPQPHQPPSAGNLVF  57

Query  405  LNSITSG--GNAVTLSHAppppsqsqqFVGIPLA  500
            LNS T+    +  TLSHA  PPS  QQFVGIPL+
Sbjct  58   LNSPTNSLPHHPSTLSHA--PPSHPQQFVGIPLS  89



>ref|XP_002450321.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
 gb|EES09309.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
Length=690

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 47/91 (52%), Gaps = 14/91 (15%)
 Frame = +3

Query  264  MATYFHGN--SEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGN  431
            MA Y+HG   ++IQ   DGLQTL LMNP  AGY + G + T P A TN   LNS  +   
Sbjct  1    MAAYYHGGAGTDIQASTDGLQTLYLMNPSYAGYADDGGASTAPGA-TNMMLLNSAVTTMT  59

Query  432  AVTLSH---------AppppsqsqqFVGIPL  497
              + +H         +     Q Q FVGIPL
Sbjct  60   PASFAHHHQQQQSPSSAAHHQQQQHFVGIPL  90



>ref|XP_009629592.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009629593.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=730

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 47/84 (56%), Gaps = 9/84 (11%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGNAV  437
            MA Y+ G+SEIQ   DGLQTL LMNP   GY +      Q     N  FLNS T+G    
Sbjct  1    MAMYYQGSSEIQ--ADGLQTLYLMNPNYIGYTDTQQQQQQHLQQANMFFLNSATAGN---  55

Query  438  TLSHAppppsq-sqqFVGIPLATA  506
             L+H P P    +Q FVG+PL T+
Sbjct  56   -LAHGPLPSQAHTQHFVGVPLPTS  78



>ref|XP_008241058.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241059.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241060.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241062.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=710

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 57/97 (59%), Gaps = 23/97 (24%)
 Frame = +3

Query  264  MATYFH-GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQPAAGT-------------N  395
            MATYFH GNS EIQ   DG LQTL+LMNP GYV   +SDT P                 N
Sbjct  1    MATYFHHGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPPHQQQQQPHQPPSAGN  57

Query  396  FAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLA  500
              FLNS T+    +  TLSHA  PPS +QQFVGIPL+
Sbjct  58   LVFLNSPTNSLPHHPSTLSHA--PPSHAQQFVGIPLS  92



>emb|CDP15553.1| unnamed protein product [Coffea canephora]
Length=725

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 53/98 (54%), Gaps = 20/98 (20%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSD--TQPAAGTNFAFLNSITSGGN  431
            MA Y+ G SEIQ   DGLQTL LMNP  AG    G+SD   QPA   N   LN  T  GN
Sbjct  1    MAMYYQGGSEIQA--DGLQTLYLMNPNYAG----GYSDAQQQPA---NMVILNYAT--GN  49

Query  432  AVTL-SHAppppsqsqqFVGIPLA----TAAGSHQEAH  530
             V L S A     Q+Q  VG+PL     +AA SH+  H
Sbjct  50   TVNLASLASNQQPQTQHLVGVPLQGSLGSAANSHELKH  87



>ref|XP_008387112.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387113.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387114.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=703

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 63/118 (53%), Gaps = 26/118 (22%)
 Frame = +3

Query  264  MATYFH---GNS-EIQGGGD-GLQTLILMNPAGYVNVGFSD-----------TQPAAGTN  395
            MATYFH   GNS EIQ   D  LQTL+LMNP+    V +SD             P A TN
Sbjct  1    MATYFHHHRGNSSEIQASSDSALQTLVLMNPS---YVPYSDTPPPPQQQQQPQTPPAATN  57

Query  396  FAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
              FLNS  +    +  TLSHA  PPS  QQFVGIPLA    S+    + ++H   HDI
Sbjct  58   LVFLNSAANSLTHHPSTLSHA--PPSHHQQFVGIPLAQDPNSNS---SQSMHHPHHDI  110



>gb|EYU25630.1| hypothetical protein MIMGU_mgv11b017830mg, partial [Erythranthe 
guttata]
Length=295

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 68/110 (62%), Gaps = 19/110 (17%)
 Frame = +3

Query  264  MATYFHGNSEIQ-----GGGDGLQTLILMNPAGYVNVGFSD---TQPAAGTNFAFLNSIT  419
            MATYFHGNSE Q     GGGDGLQTLILMNP GYV  G+SD    Q    +NF FLNS  
Sbjct  1    MATYFHGNSENQGGGGGGGGDGLQTLILMNP-GYVG-GYSDNNNNQHPPNSNFVFLNSNN  58

Query  420  SGGNAVT----LSHAppppsqsqqFVGIPL---ATAAGSH-QEAHASAVH  545
              GN       L HA PP SQ+Q FVGIPL   A+A+G   Q+   SA+H
Sbjct  59   ISGNNNNSSHHLPHA-PPSSQTQHFVGIPLQGTASASGQDPQQQDVSALH  107



>ref|XP_010059079.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW90459.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
 gb|KCW90460.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
Length=703

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 52/101 (51%), Gaps = 19/101 (19%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFA-FLNSITSGGNAVT  440
            MATY+H +S    G   LQTL+LMNPA YV+  +SD  P      A FLNS T+G  A  
Sbjct  1    MATYYHQSSSDPDGA--LQTLVLMNPASYVH--YSDAPPPHQQPSAIFLNSSTAGPPASQ  56

Query  441  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
                         FVGIPL    GS  ++  S++H   HD+
Sbjct  57   TQQ----------FVGIPL---PGSAADSQPSSMHV-NHDL  83



>ref|XP_010931060.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
 ref|XP_010931061.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=621

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 53/103 (51%), Gaps = 12/103 (12%)
 Frame = +3

Query  264  MATYFHG-NSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT  440
            MATYFHG  +E Q   DGLQTL LMNP  Y    +SDT  A   N   LNS+ S  N   
Sbjct  1    MATYFHGAPAEFQA--DGLQTLYLMNP-NY--AAYSDT--AVPANMILLNSVNS-LNPTN  52

Query  441  LSH--AppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDI  563
            L H  A   P+Q Q F GIPL     +H+     ++    HD+
Sbjct  53   LGHCAATAQPNQHQHFAGIPLQPPVAAHESNRLPSIQP-SHDV  94



>ref|XP_006481599.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481600.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Citrus 
sinensis]
Length=693

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 55/105 (52%), Gaps = 21/105 (20%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYV------NVGFSDTQ----PAAGTN-FAFLN  410
            MATYFHGN       DGLQTL+LMNP  YV      +  FSDT     PA   N   FLN
Sbjct  1    MATYFHGNPAEFQAPDGLQTLVLMNPTTYVQQQQQQHQQFSDTNHPPAPAPAHNSLIFLN  60

Query  411  SITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVH  545
            S      +    HAPPPPS +Q FVGIP      +HQ+   S +H
Sbjct  61   S------SAISPHAPPPPSHTQHFVGIPTT----AHQDDSISPLH  95



>gb|KDO70617.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70618.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70619.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70620.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
Length=693

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 55/105 (52%), Gaps = 21/105 (20%)
 Frame = +3

Query  264  MATYFHGNSEIQGGGDGLQTLILMNPAGYV------NVGFSDTQ----PAAGTN-FAFLN  410
            MATYFHGN       DGLQTL+LMNP  YV      +  FSDT     PA   N   FLN
Sbjct  1    MATYFHGNPAEFQAPDGLQTLVLMNPTTYVQQQQQQHQQFSDTNHPPAPAPAHNSLIFLN  60

Query  411  SITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVH  545
            S      +    HAPPPPS +Q FVGIP      +HQ+   S +H
Sbjct  61   S------SAISPHAPPPPSHTQHFVGIPTT----AHQDDSISPLH  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920