BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS125H04

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    313   9e-104   Nicotiana tomentosiformis
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    310   1e-102   Nicotiana sylvestris
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    309   4e-102   Nicotiana benthamiana
gb|AFH57998.1|  chloroplast PsbO2 precursor                             309   4e-102   Nicotiana benthamiana
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   1e-101   Sesamum indicum [beniseed]
gb|AFH57997.1|  chloroplast PsbO1 precursor                             308   1e-101   Nicotiana benthamiana
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   1e-101   Sesamum indicum [beniseed]
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    307   3e-101   Nicotiana tomentosiformis
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    306   4e-101   Populus euphratica
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    306   5e-101   Nicotiana sylvestris
gb|KDP31833.1|  hypothetical protein JCGZ_12294                         306   5e-101   Jatropha curcas
gb|AFH58000.1|  chloroplast PsbO4 precursor                             306   5e-101   Nicotiana benthamiana
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      306   8e-101   Litchi chinensis [litchi]
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            306   1e-100   Populus trichocarpa [western balsam poplar]
gb|ABK96748.1|  unknown                                                 304   3e-100   Populus trichocarpa x Populus deltoides
ref|XP_007047093.1|  Photosystem II subunit O-2                         304   4e-100   
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    303   1e-99    Malus domestica [apple tree]
gb|AFH57999.1|  chloroplast PsbO3 precursor                             303   1e-99    Nicotiana benthamiana
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    303   1e-99    Pyrus x bretschneideri [bai li]
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    301   5e-99    Pyrus x bretschneideri [bai li]
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          301   9e-99    Dimocarpus longan [longan]
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    300   1e-98    Vitis vinifera
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    300   2e-98    Pyrus x bretschneideri [bai li]
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    300   3e-98    Prunus mume [ume]
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    299   5e-98    Solanum tuberosum [potatoes]
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    298   6e-98    
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    298   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001239736.1|  uncharacterized protein LOC100798485               297   2e-97    Glycine max [soybeans]
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             297   2e-97    Prunus persica
gb|ADR71223.1|  chloroplast manganese stabilizing protein               296   3e-97    Solanum tuberosum [potatoes]
gb|KJB43586.1|  hypothetical protein B456_007G208000                    297   3e-97    Gossypium raimondii
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            296   4e-97    Populus trichocarpa [western balsam poplar]
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    296   4e-97    Ricinus communis
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    296   4e-97    Nelumbo nucifera [Indian lotus]
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    296   4e-97    Populus euphratica
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               295   1e-96    Gossypium arboreum [tree cotton]
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    295   2e-96    Solanum tuberosum [potatoes]
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     295   2e-96    Solanum tuberosum [potatoes]
gb|ABG25041.1|  33kDa precursor protein of oxygen-evolving complex      289   2e-96    Nicotiana tabacum [American tobacco]
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    293   8e-96    Fragaria vesca subsp. vesca
ref|XP_006856169.1|  hypothetical protein AMTR_s00059p00176390          293   9e-96    Amborella trichopoda
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           292   2e-95    Bruguiera gymnorhiza [Burma mangrove]
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    292   3e-95    Solanum tuberosum [potatoes]
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    292   3e-95    Elaeis guineensis
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    291   5e-95    Nicotiana sylvestris
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    291   7e-95    
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                291   7e-95    Erythranthe guttata [common monkey flower]
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             290   9e-95    Phaseolus vulgaris [French bean]
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                   288   1e-94    
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    290   1e-94    Nelumbo nucifera [Indian lotus]
emb|CDP02430.1|  unnamed protein product                                290   2e-94    Coffea canephora [robusta coffee]
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   289   3e-94    Citrus sinensis [apfelsine]
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    289   4e-94    Arabis alpina [alpine rockcress]
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             288   1e-93    Citrus clementina [clementine]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   287   1e-93    
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    287   1e-93    Brassica rapa
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    287   2e-93    Tarenaya hassleriana [spider flower]
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      287   2e-93    Phaseolus vulgaris [French bean]
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            286   2e-93    Solanum tuberosum [potatoes]
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II            285   3e-93    Solanum tuberosum [potatoes]
ref|XP_002877774.1|  photosystem II subunit O-2                         286   3e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    286   5e-93    Eucalyptus grandis [rose gum]
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             286   5e-93    Capsella rubella
ref|NP_001241522.1|  uncharacterized protein LOC100820458               286   6e-93    Glycine max [soybeans]
gb|ABG25040.1|  33kDa precursor protein of oxygen-evolving complex      280   7e-93    Solanum lycopersicum
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  285   8e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             285   9e-93    Phaseolus vulgaris [French bean]
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             285   1e-92    Eutrema salsugineum [saltwater cress]
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 285   2e-92    Morus notabilis
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    285   2e-92    Brassica rapa
gb|AAS55410.1|  photosystem II protein                                  281   2e-92    Brassica rapa
emb|CDX81388.1|  BnaC09g07990D                                          285   2e-92    
emb|CDY30764.1|  BnaC07g16640D                                          284   2e-92    Brassica napus [oilseed rape]
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    284   3e-92    Cucumis sativus [cucumbers]
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             284   3e-92    Eutrema salsugineum [saltwater cress]
emb|CBI19622.3|  unnamed protein product                                281   4e-92    Vitis vinifera
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    283   5e-92    Camelina sativa [gold-of-pleasure]
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    283   5e-92    Glycine max [soybeans]
ref|NP_001043134.1|  Os01g0501800                                       283   6e-92    
ref|NP_001240871.1|  uncharacterized protein LOC100811386               283   7e-92    Glycine max [soybeans]
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    283   1e-91    Brassica rapa
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    283   1e-91    Cucumis melo [Oriental melon]
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        282   1e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             283   2e-91    
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    282   2e-91    Arabis alpina [alpine rockcress]
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    282   2e-91    Camelina sativa [gold-of-pleasure]
emb|CDY50981.1|  BnaC02g48890D                                          282   2e-91    Brassica napus [oilseed rape]
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    281   3e-91    Brassica rapa
gb|AAT65501.1|  photosystem II protein                                  282   4e-91    Brassica oleracea
gb|EEC70714.1|  hypothetical protein OsI_02088                          281   4e-91    Oryza sativa Indica Group [Indian rice]
emb|CAN79166.1|  hypothetical protein VITISV_019248                     281   4e-91    Vitis vinifera
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    281   4e-91    Vitis vinifera
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    281   5e-91    Phoenix dactylifera
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    281   5e-91    Pisum sativum [garden pea]
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    280   1e-90    Elaeis guineensis
emb|CDY33308.1|  BnaA01g19750D                                          281   1e-90    Brassica napus [oilseed rape]
gb|ADB07372.1|  chloroplast managanese stabilizing protein              278   2e-90    Capsicum annuum
emb|CDY26519.1|  BnaC01g23800D                                          281   2e-90    Brassica napus [oilseed rape]
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    279   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    278   7e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       278   8e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            278   8e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           278   9e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   277   1e-89    Medicago truncatula
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    277   1e-89    
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    277   2e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AAL08257.1|  AT5g66570/K1F13_25                                      276   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    276   5e-89    Setaria italica
ref|NP_001130585.1|  uncharacterized protein LOC100191684               276   6e-89    Zea mays [maize]
gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       275   7e-89    Genlisea aurea
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    275   8e-89    Camelina sativa [gold-of-pleasure]
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    275   8e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    275   9e-89    Oryza brachyantha
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    275   9e-89    Phoenix dactylifera
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    275   9e-89    Camelina sativa [gold-of-pleasure]
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      276   2e-88    
gb|AAD38521.1|AF139818_1  33 kDa oxygen evolving protein of photo...    272   3e-88    Brassica napus [oilseed rape]
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    273   3e-88    
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    273   6e-88    Camelina sativa [gold-of-pleasure]
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         273   9e-88    Arabidopsis thaliana [mouse-ear cress]
gb|AEN02470.1|  oxygen-evolving enhancer protein                        272   2e-87    Camellia sinensis [black tea]
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             268   3e-86    Arabidopsis lyrata subsp. lyrata
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    268   3e-86    Fritillaria agrestis
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       268   8e-86    Triticum urartu
dbj|BAJ89638.1|  predicted protein                                      267   1e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    266   4e-85    Salicornia europaea [chicken-claws]
gb|AFK43771.1|  unknown                                                 266   4e-85    Lotus japonicus
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          266   5e-85    Leymus chinensis
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          265   7e-85    Saccharum hybrid cultivar [sugarcane]
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         265   1e-84    
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    264   2e-84    
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    264   2e-84    Tarenaya hassleriana [spider flower]
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    264   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    264   2e-84    
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    264   2e-84    Camelina sativa [gold-of-pleasure]
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    263   3e-84    Helianthus annuus
emb|CAA29062.1|  unnamed protein product                                261   2e-83    Spinacia oleracea
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    261   2e-83    Spinacia oleracea
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    260   7e-83    Triticum aestivum [Canadian hard winter wheat]
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    257   1e-82    Morus nigra
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    258   3e-82    Brachypodium distachyon [annual false brome]
gb|KJB43585.1|  hypothetical protein B456_007G208000                    258   4e-82    Gossypium raimondii
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             255   5e-81    Eutrema salsugineum [saltwater cress]
emb|CAN61828.1|  hypothetical protein VITISV_027630                     254   1e-80    Vitis vinifera
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    247   6e-78    
ref|XP_009387680.1|  PREDICTED: oxygen-evolving enhancer protein ...    241   9e-78    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX72613.1|  BnaC07g46350D                                          245   3e-77    
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        239   7e-76    Allium cepa
emb|CDY42709.1|  BnaA03g53620D                                          240   4e-75    Brassica napus [oilseed rape]
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      237   7e-74    Pinus sylvestris [Scotch pine]
gb|ACN40581.1|  unknown                                                 228   3e-70    Picea sitchensis
gb|ABR17376.1|  unknown                                                 228   3e-70    Picea sitchensis
gb|ABK23365.1|  unknown                                                 228   3e-70    Picea sitchensis
gb|ABK24541.1|  unknown                                                 228   3e-70    Picea sitchensis
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     215   2e-66    Eucalyptus grandis [rose gum]
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   214   1e-65    Citrus sinensis [apfelsine]
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             213   2e-65    Phaseolus vulgaris [French bean]
gb|ACE98011.1|  putative protein                                        207   2e-64    Populus tremula [European aspen]
gb|AIS72812.1|  oxygen evolving activity                                206   2e-64    Rhizophora apiculata
gb|KJB43587.1|  hypothetical protein B456_007G208000                    208   2e-63    Gossypium raimondii
prf||2002393A  oxygen-evolving complex protein 1                        206   6e-63 
prf||1204192A  photosystem II protein 33kD                              194   3e-58 
ref|XP_001756893.1|  predicted protein                                  186   4e-54    
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    178   3e-52    
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    175   6e-51    Tarenaya hassleriana [spider flower]
gb|ABV57472.1|  chloroplast PsbO                                        170   5e-50    Phyllostachys edulis [kikko-chiku]
ref|XP_001763258.1|  predicted protein                                  173   3e-49    
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        171   4e-48    Chara braunii
ref|XP_001781590.1|  predicted protein                                  169   9e-48    
ref|NP_001140815.1|  hypothetical protein                               162   6e-46    
gb|ACT83791.1|  putative photosystem II oxygen evolving system 33...    157   7e-45    Lemna minor
ref|XP_004243178.1|  PREDICTED: oxygen-evolving enhancer protein ...    157   1e-44    Solanum lycopersicum
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             155   2e-42    Selaginella moellendorffii
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        153   2e-41    Closterium peracerosum-strigosum-littorale complex
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             153   2e-41    
ref|XP_001784751.1|  predicted protein                                  150   4e-41    
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             148   2e-40    
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             131   2e-33    Ostreococcus tauri
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    131   3e-33    Coccomyxa subellipsoidea C-169
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    130   6e-33    Ostreococcus lucimarinus CCE9901
gb|ADC54897.1|  oxygen-evolving enhancer protein                        127   2e-32    Cladophora coelothrix
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              128   2e-32    Chlorella variabilis
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    125   4e-31    Micromonas pusilla CCMP1545
gb|ADC54902.1|  oxygen-evolving enhancer protein                        120   5e-31    Klebsormidium flaccidum
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          124   5e-31    Chlamydomonas incerta
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    124   8e-31    Chlamydomonas reinhardtii
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    124   9e-31    Chlamydomonas reinhardtii
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        124   1e-30    Oedogonium obesum
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                      121   2e-30    Oryza sativa Indica Group [Indian rice]
gb|AGI15739.1|  collinsiaXIII-like protein                              119   6e-30    Collinsia rattanii
gb|AGI15740.1|  collinsiaXIII-like protein                              117   2e-29    Collinsia rattanii
gb|AGI15761.1|  collinsiaXIII-like protein                              117   3e-29    Collinsia linearis
gb|AGI15756.1|  collinsiaXIII-like protein                              117   3e-29    Collinsia linearis
gb|AGI15742.1|  collinsiaXIII-like protein                              117   3e-29    Collinsia rattanii
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        120   3e-29    Hafniomonas montana
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        120   4e-29    Pyramimonas parkeae
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II        117   2e-28    Nephroselmis olivacea
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...    118   2e-28    Auxenochlorella protothecoides
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...    117   2e-28    Micromonas commoda
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...    117   2e-28    Volvox carteri f. nagariensis
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...    117   3e-28    Volvox carteri
gb|AEW08532.1|  hypothetical protein CL304Contig1_01                    112   3e-28    Pinus radiata
gb|ADC54900.1|  oxygen-evolving enhancer protein                        113   5e-28    Entransia fimbriata
ref|XP_007513615.1|  predicted protein                                  117   5e-28    Bathycoccus prasinos
gb|AFB34200.1|  hypothetical protein CL304Contig1_01                    111   6e-28    Abies alba [abete-blanco]
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II        116   1e-27    Lepidodinium chlorophorum
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                      114   5e-27    Monoraphidium neglectum
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II        113   1e-26    Tetraselmis cordiformis
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    112   2e-26    Euglena stellata
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    111   2e-26    Euglena pseudostellata
ref|XP_003082811.1|  photosystem II oxygen-evolving complex prote...    110   2e-26    
gb|ADC54905.1|  oxygen-evolving enhancer protein                        108   3e-26    Ostreococcus tauri
gb|ADC54906.1|  oxygen-evolving enhancer protein                        108   5e-26    Phyllodictyon orientale
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    110   7e-26    Monomorphina pyrum
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II        111   7e-26    Chlorarachnion reptans
gb|ADC54893.1|  oxygen-evolving enhancer protein                        106   2e-25    Boodlea composita
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    108   3e-25    Cryptoglena skujai
gb|AFK37254.1|  unknown                                                 103   4e-25    Medicago truncatula
ref|XP_010550781.1|  PREDICTED: oxygen-evolving enhancer protein ...    107   4e-25    Tarenaya hassleriana [spider flower]
gb|ADC54913.1|  oxygen-evolving enhancer protein                        105   4e-25    Valonia utricularis
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1       109   5e-25    Gymnochlora stellata
emb|CCI69514.1|  oxygen-evolving enhancer protein                       106   5e-25    Scotinosphaera sp. CAUP H5307
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor           109   7e-25    Euglena gracilis
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II        108   7e-25    Bryopsis plumosa
gb|ACU65446.1|  putative oxygen-evolving enhancer                       102   1e-24    Tragopogon dubius [yellow salsify]
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...    108   1e-24    Euglena gracilis
gb|AAP79149.1|  photosystem II protein PsbO                             106   4e-24    Bigelowiella natans
gb|ADC54908.1|  oxygen-evolving enhancer protein                        103   4e-24    Siphonocladus tropicus
gb|ACU65447.1|  putative oxygen-evolving enhancer                       100   6e-24    Tragopogon pratensis [Jack-go-to-bed-at-noon]
gb|AGI15762.1|  collinsiaXIII-like protein                              102   6e-24    Collinsia linearis
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                     106   7e-24    Cyanophora paradoxa
gb|ADC54904.1|  oxygen-evolving enhancer protein                        102   9e-24    Nephroselmis olivacea
emb|CCI69513.1|  oxygen-evolving enhancer protein                       101   2e-23    Chlorochytrium lemnae
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    103   2e-23    Discoplastis spathirhyncha
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    102   3e-23    Euglena archaeoplastidiata
gb|ADC54894.1|  oxygen-evolving enhancer protein                      99.8    8e-23    Bornetella sphaerica
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    101   1e-22    Euglena granulata
gb|KIY92168.1|  Oxygen-evolving enhancer protein 1,chloroplastic      98.6    3e-22    Monoraphidium neglectum
gb|ADC54903.1|  oxygen-evolving enhancer protein                      97.8    4e-22    Mesostigma viride
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II      99.8    1e-21    Eutreptiella gymnastica
gb|ADC54890.1|  oxygen-evolving enhancer protein                      94.7    5e-21    Acetabularia acetabulum
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II  95.9    2e-20    Coccomyxa subellipsoidea C-169
gb|ADC54912.1|  oxygen-evolving enhancer protein                      93.6    2e-20    Ulva intestinalis
gb|ADC54901.1|  oxygen-evolving enhancer protein                      93.2    2e-20    Ignatius tetrasporus
gb|ADC54891.1|  oxygen-evolving enhancer protein                      91.7    7e-20    Ulvella repens
gb|ADC54898.1|  oxygen-evolving enhancer protein                      91.7    9e-20    Codium sp. HEC 15711
gb|ADC54899.1|  oxygen-evolving enhancer protein                      89.0    7e-19    Derbesia sp. 2773-1
gb|ADC54895.1|  oxygen-evolving enhancer protein                      88.6    1e-18    Bryopsis sp. EE4
ref|XP_002894679.1|  predicted protein                                87.0    1e-18    
gb|ADE06500.1|  oxygen-evolving enhancer                              85.9    2e-18    Tragopogon porrifolius [oyster plant]
gb|ADC54907.1|  oxygen-evolving enhancer protein                      87.0    4e-18    Tetradesmus obliquus
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                     87.4    2e-17    Porphyridium purpureum
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...  87.0    2e-17    cyanobacterium PCC 7702
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide      87.0    3e-17    Tolypothrix bouteillei VB521301
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...  86.7    5e-17    Guillardia theta
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                     86.7    5e-17    Pyrenomonas helgolandii
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111            86.3    6e-17    Guillardia theta CCMP2712
gb|EWM24380.1|  oxygen-evolving enhancer protein                      85.9    6e-17    Nannochloropsis gaditana
gb|ADC54896.1|  oxygen-evolving enhancer protein                      83.6    8e-17    Parachlorella kessleri
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...  85.9    8e-17    Nannochloropsis gaditana CCMP526
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...  85.5    9e-17    Scytonema hofmannii
gb|EWM24379.1|  oxygen-evolving enhancer protein                      85.5    1e-16    Nannochloropsis gaditana
gb|ADC54909.1|  oxygen-evolving enhancer protein                      82.8    1e-16    Tetraselmis striata
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...  84.7    2e-16    Synechococcus sp. PCC 6312
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...  84.3    2e-16    Fischerella muscicola
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...  84.3    2e-16    Emiliania huxleyi CCMP1516
emb|CAH25340.1|  oxygen-evolving enhancer                             84.3    2e-16    Guillardia theta
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...  84.0    3e-16    Chlorogloeopsis fritschii
gb|KEI69285.1|  PsbO                                                  83.6    5e-16    Planktothrix agardhii NIVA-CYA 126/8
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...  83.2    5e-16    Fischerella sp. PCC 9339
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...  83.2    5e-16    Planktothrix agardhii
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...  83.2    5e-16    Planktothrix
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...  83.2    6e-16    Hapalosiphonaceae
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722            82.8    8e-16    Chlorella variabilis
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                     82.8    1e-15    Botrydium granulatum
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...  82.4    1e-15    Dolichospermum circinale
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...  82.0    1e-15    Cyanothece sp. PCC 7425
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...  82.0    1e-15    Fischerella sp. PCC 9605
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...  81.6    2e-15    Oscillatoria sp. PCC 10802
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...  81.6    2e-15    
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...  81.3    2e-15    
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...  81.3    3e-15    
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...  81.3    3e-15    
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...  80.9    3e-15    
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...  80.5    4e-15    
gb|ABF59672.1|  photosystem II extrinsic protein O                    80.1    7e-15    
gb|ADC54892.1|  oxygen-evolving enhancer protein                      78.2    9e-15    
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                     80.1    9e-15    
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...  79.7    9e-15    
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...  79.7    1e-14    
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...  79.3    1e-14    
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...  79.3    1e-14    
gb|ABR26133.1|  oxygen-evolving enhancer protein 1                    78.6    1e-14    
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...  79.3    1e-14    
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...  79.0    1e-14    
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...  79.0    1e-14    
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...  79.0    1e-14    
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II      79.3    1e-14    
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...  79.0    1e-14    
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...  79.0    2e-14    
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...  79.0    2e-14    
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...  78.6    2e-14    
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...  78.6    2e-14    
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...  78.2    3e-14    
gb|ADC54911.1|  oxygen-evolving enhancer protein                      76.6    3e-14    
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1               77.8    4e-14    
ref|WP_019500685.1|  hypothetical protein                             77.8    4e-14    
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...  77.4    4e-14    
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...  77.4    4e-14    
ref|WP_017286598.1|  hypothetical protein                             77.8    4e-14    
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...  77.4    5e-14    
gb|ADC54910.1|  oxygen-evolving enhancer protein                      75.1    8e-14    
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...  76.6    9e-14    
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...  76.6    9e-14    
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...  76.6    1e-13    
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...  76.3    1e-13    
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...  76.3    1e-13    
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...  76.3    1e-13    
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...  76.3    1e-13    
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...  75.9    2e-13    
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                     76.3    2e-13    
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                     75.9    3e-13    
dbj|BAJ61708.1|  oxygen-evolving enhancer protein                     74.3    3e-13    
ref|XP_005536430.1|  manganese-stabilzing protein precursor           75.5    4e-13    
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...  75.1    4e-13    
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...  74.3    6e-13    
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                     75.1    6e-13    
ref|WP_011318645.1|  photosystem II manganese-stabilizing protein...  74.3    7e-13    
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...  74.3    7e-13    
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor         73.9    7e-13    
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor          74.7    8e-13    
ref|WP_010997995.1|  manganese-stabilzing protein                     73.9    8e-13    
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...  73.9    9e-13    
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                     74.7    9e-13    
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...  73.9    1e-12    
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...  73.6    1e-12    
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...  73.6    1e-12    
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein          73.6    1e-12    
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                  73.6    1e-12    
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...  73.2    2e-12    
ref|WP_016922728.1|  hypothetical protein                             73.2    2e-12    
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...  73.2    2e-12    
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...  72.8    2e-12    
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...  72.8    2e-12    
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...  72.4    3e-12    
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...  72.0    5e-12    
ref|XP_005706438.1|  photosystem II PsbO protein                      72.8    5e-12    
gb|AAN11311.1|  oxygen-evolving enhancer 1                            72.0    6e-12    
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide      71.2    7e-12    
ref|WP_037222014.1|  Photosystem II manganese-stabilizing protein...  71.2    9e-12    
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...  70.5    1e-11    
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)   70.5    1e-11    
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...  70.5    2e-11    
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...  70.1    2e-11    
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...  70.1    2e-11    
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor          70.5    2e-11    
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor     70.5    2e-11    
dbj|BAG85210.1|  extrinsic protein in photosystem II                  70.5    2e-11    
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...  69.7    2e-11    
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...  69.7    2e-11    
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...  69.7    3e-11    
emb|CBN78902.1|  manganese stabilising protein                        70.5    3e-11    
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...  69.7    3e-11    
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                     69.7    3e-11    
ref|WP_006616815.1|  MULTISPECIES: photosystem II manganese-stabi...  69.3    4e-11    
gb|EKD06931.1|  photosystem II manganese-stabilizing protein PsbO     69.3    4e-11    
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                     69.7    4e-11    
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...  68.9    5e-11    
sp|P83504.1|PSBO_BRACM  RecName: Full=Oxygen-evolving enhancer pr...  64.7    6e-11    
ref|WP_015170887.1|  photosystem II manganese-stabilizing protein...  68.6    7e-11    
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)  68.6    7e-11    
ref|WP_027841041.1|  Photosystem II manganese-stabilizing polypep...  68.6    8e-11    
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein     68.2    8e-11    
ref|WP_008313000.1|  Manganese-stabilising protein / photosystem ...  68.6    8e-11    
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...  68.2    8e-11    
gb|ADJ93800.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  67.4    8e-11    
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...  68.2    9e-11    
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...  67.8    1e-10    
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide      67.8    1e-10    
ref|WP_017662186.1|  hypothetical protein                             67.8    1e-10    
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...  67.4    2e-10    
ref|WP_018399127.1|  hypothetical protein                             67.4    2e-10    
ref|WP_010873097.1|  photosystem II manganese-stabilizing polypep...  67.0    3e-10    
ref|WP_008233010.1|  Photosystem II manganese-stabilizing protein...  66.6    3e-10    
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                   67.4    3e-10    
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                  67.4    4e-10    
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                  67.0    4e-10    
ref|WP_019506429.1|  hypothetical protein                             66.6    4e-10    
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678            66.6    4e-10    
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                  67.0    4e-10    
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...  66.2    5e-10    
gb|AAF13997.1|  photosystem II manganese stabilizing protein          66.2    5e-10    
ref|WP_039726071.1|  MULTISPECIES: Photosystem II manganese-stabi...  65.9    6e-10    
ref|WP_015956866.1|  photosystem II manganese-stabilizing protein...  65.9    7e-10    
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor        66.2    7e-10    
gb|ACU19823.1|  unknown                                               64.3    8e-10    
ref|WP_015192867.1|  photosystem II manganese-stabilizing protein...  65.5    9e-10    
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein     65.5    1e-09    
gb|ABO47876.1|  plastid oxygen-evolving enhancer 1-2 precursor        65.5    1e-09    
ref|WP_044204234.1|  Photosystem II manganese-stabilizing polypep...  65.1    1e-09    
gb|EDX78335.1|  Manganese-stabilizing protein / photosystem II po...  65.1    1e-09    
gb|ABK95838.1|  unknown                                               63.5    1e-09    
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...  64.7    2e-09    
ref|WP_011243530.1|  MULTISPECIES: photosystem II PsbO protein        64.7    2e-09    
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                  65.1    2e-09    
gb|ACN35184.1|  unknown                                               62.8    3e-09    
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...  64.3    3e-09    
gb|AFK46831.1|  unknown                                               62.8    3e-09    
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...  63.9    3e-09    
gb|ACJ84218.1|  unknown                                               62.0    4e-09    
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...  63.5    4e-09    
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...  63.5    5e-09    
ref|WP_013323533.1|  photosystem II manganese-stabilizing protein...  63.5    5e-09    
ref|WP_006456861.1|  Manganese-stabilizing protein / photosystem ...  63.5    5e-09    
ref|WP_008186133.1|  manganese-stabilising protein/ photosystem I...  63.2    7e-09    
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...  63.2    7e-09    
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO     63.2    8e-09    
ref|WP_015133089.1|  photosystem II manganese-stabilizing protein...  62.4    1e-08    
emb|CDX73783.1|  BnaC08g22200D                                        60.5    1e-08    
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...  62.4    1e-08    
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...  61.6    2e-08    
gb|AHJ27766.1|  Photosystem II manganese-stabilizing protein (PsbO)   60.8    2e-08    
ref|WP_015785306.1|  MULTISPECIES: photosystem II manganese-stabi...  61.6    2e-08    
ref|WP_026072511.1|  Photosystem II manganese-stabilizing protein...  61.2    3e-08    
ref|WP_024544659.1|  Photosystem II manganese-stabilizing polypep...  61.6    3e-08    
ref|WP_035985606.1|  hypothetical protein                             61.2    3e-08    
gb|ABQ85434.1|  33 kDa OEC protein                                    59.3    4e-08    
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein     60.8    4e-08    
ref|WP_015151496.1|  Manganese-stabilising protein / photosystem ...  60.8    4e-08    
ref|WP_023065168.1|  photosystem II manganese-stabilizing polypep...  60.8    5e-08    
ref|WP_007100705.1|  photosystem II manganese-stabilizing polypep...  60.5    6e-08    
gb|ACF28689.1|  oxygen evolving complex protein variant               58.5    6e-08    
gb|ACF28695.1|  oxygen evolving complex protein variant               58.5    6e-08    
gb|EJK75097.1|  hypothetical protein THAOC_03193                      60.1    7e-08    
gb|ACF28693.1|  oxygen evolving complex protein variant               58.2    8e-08    
gb|ACF28701.1|  oxygen evolving complex protein variant               58.2    9e-08    
gb|ACF28690.1|  oxygen evolving complex protein variant               57.8    9e-08    
ref|WP_036480960.1|  Photosystem II manganese-stabilizing polypep...  59.7    1e-07    
ref|WP_011613279.1|  photosystem II manganese-stabilizing protein...  59.7    1e-07    
ref|WP_025782239.1|  Photosystem II manganese-stabilizing polypep...  58.9    2e-07    
gb|EDX87597.1|  Manganese-stabilizing protein / photosystem II po...  58.9    2e-07    
ref|WP_038016162.1|  Photosystem II manganese-stabilizing polypep...  58.9    2e-07    
ref|WP_038542990.1|  Photosystem II manganese-stabilizing polypep...  58.5    3e-07    
gb|ACF28700.1|  oxygen evolving complex protein variant               57.4    3e-07    
ref|WP_006510630.1|  Manganese-stabilising protein / photosystem ...  58.2    3e-07    
ref|WP_011932278.1|  photosystem II manganese-stabilizing protein...  57.8    4e-07    
ref|WP_002791059.1|  Photosystem II manganese-stabilizing polypep...  57.8    5e-07    
ref|WP_002800587.1|  Photosystem II manganese-stabilizing polypep...  57.4    7e-07    
ref|XP_002291225.1|  oxygen-evolving enhancer protein 1 precursor     57.4    8e-07    
ref|WP_002773425.1|  Photosystem II manganese-stabilizing polypep...  57.4    8e-07    
ref|WP_043737375.1|  Photosystem II manganese-stabilizing polypep...  57.0    9e-07    
ref|WP_011618325.1|  photosystem II manganese-stabilizing protein     57.0    1e-06    
emb|CAK29098.1|  Photosystem II manganese-stabilizing protein PsbO    57.0    1e-06    
gb|ABH09263.1|  photosystem II manganese-stabilizing protein          56.6    1e-06    
ref|WP_015219672.1|  photosystem II manganese-stabilizing protein...  56.6    1e-06    
ref|YP_002049183.1|  Photosystem II manganese-stabilizing polypep...  56.6    1e-06    
ref|WP_010314562.1|  photosystem II manganese-stabilizing protein     56.6    1e-06    
ref|WP_028953543.1|  Photosystem II manganese-stabilizing polypep...  56.6    1e-06    
ref|WP_008199011.1|  Photosystem II manganese-stabilizing polypep...  56.6    1e-06    
ref|WP_015223075.1|  photosystem II manganese-stabilizing protein...  56.2    2e-06    
ref|WP_004162736.1|  Photosystem II manganese-stabilizing polypep...  56.2    2e-06    
ref|WP_006853634.1|  photosystem II manganese-stabilizing protein...  56.2    2e-06    
ref|WP_015109468.1|  Manganese-stabilising protein / photosystem ...  56.2    2e-06    
ref|WP_002738218.1|  photosystem II manganese-stabilizing polypep...  56.2    2e-06    
ref|WP_004160298.1|  Photosystem II manganese-stabilizing polypep...  55.8    2e-06    
ref|WP_002761031.1|  Photosystem II manganese-stabilizing polypep...  55.8    2e-06    
ref|WP_011360791.1|  photosystem II manganese-stabilizing polypep...  55.8    2e-06    
ref|WP_002741980.1|  photosystem II manganese-stabilizing polypep...  55.8    2e-06    
ref|WP_030006064.1|  Photosystem II manganese-stabilizing polypep...  55.5    3e-06    
gb|ACF28688.1|  oxygen evolving complex protein variant               53.5    3e-06    
ref|WP_009788842.1|  photosystem II manganese-stabilizing polypep...  55.5    4e-06    
ref|WP_035832498.1|  Photosystem II manganese-stabilizing polypep...  55.1    4e-06    
ref|WP_011127177.1|  photosystem II manganese-stabilizing polypep...  54.7    5e-06    
gb|ACF28697.1|  oxygen evolving complex protein variant               52.4    9e-06    
gb|ACF28698.1|  oxygen evolving complex protein variant               52.4    9e-06    
gb|ACF28692.1|  oxygen evolving complex protein variant               52.4    9e-06    
ref|WP_012305903.1|  photosystem II manganese stabilizing protein...  53.5    2e-05    
ref|WP_038551339.1|  Photosystem II manganese-stabilizing polypep...  53.1    2e-05    
ref|WP_017293645.1|  hypothetical protein                             53.1    2e-05    
gb|ACF28691.1|  oxygen evolving complex protein variant               51.2    2e-05    
gb|ACF28699.1|  oxygen evolving complex protein variant               51.2    3e-05    
gb|ADD94884.1|  photosystem II manganese stabilizing polypeptide      52.4    3e-05    
gb|AHF62713.1|  photosystem II manganese-stabilizing polypeptide      52.4    3e-05    
ref|WP_006172331.1|  photosystem II manganese-stabilizing polypep...  52.4    3e-05    
ref|WP_011363327.1|  photosystem II manganese-stabilizing polypep...  52.4    4e-05    
ref|WP_043694690.1|  Photosystem II manganese-stabilizing polypep...  52.0    6e-05    
ref|WP_044259457.1|  Photosystem II manganese-stabilizing protein...  51.2    7e-05    
ref|WP_033373963.1|  Photosystem II manganese-stabilizing polypep...  51.2    1e-04    



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   313 bits (803),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 171/188 (91%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA  F+DA
Sbjct  6    QAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQKFTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV +FA
Sbjct  66   AKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVASFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   310 bits (795),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FA
Sbjct  66   AKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   309 bits (792),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 169/188 (90%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FA
Sbjct  66   AKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDG+
Sbjct  126  FKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   309 bits (792),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 169/188 (90%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FA
Sbjct  66   AKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDG+
Sbjct  126  FKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   308 bits (789),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AATLMQPTKVG T    RS QT+GKA GV+P+ AR+TCSLQ+ +K+LAH  +DAAK+A
Sbjct  7    QAAATLMQPTKVGRTSLQLRSVQTLGKAFGVEPAGARMTCSLQADLKDLAHKLTDAAKIA  66

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV++FAFK G
Sbjct  67   GFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAFKAG  126

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGPF VS DG+VKFE
Sbjct  127  KYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFVVSEDGTVKFE  186

Query  543  EKDG  554
            EKDG
Sbjct  187  EKDG  190



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   308 bits (789),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 169/188 (90%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVAPARNNLQLRSAQSVCKAFGVEPAAARLTCSLQTELKDLAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FA
Sbjct  66   AKVAGFALATSALVVSGANAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   308 bits (789),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 170/187 (91%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV+ R     RS Q+VGK+ GV+P+ AR++CSLQ+ +K+LA   +DAA
Sbjct  6    QAAATLMQPTKVGVSARSSLQLRSVQSVGKSFGVEPASARLSCSLQADLKDLAQKCTDAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV++FAF
Sbjct  66   KIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DG+V
Sbjct  126  KPGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSQDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   307 bits (786),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 168/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV         RS Q+V KA GV+P+ A++TCSLQS +K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVVSARNNLQLRSSQSVSKAFGVEPAAAKLTCSLQSDLKDLAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL++SGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGVE+FA
Sbjct  66   AKIAGFALATSALVISGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVESFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   306 bits (785),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA    DA+
Sbjct  6    QAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQKCVDAS  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAF
Sbjct  66   KIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG++
Sbjct  126  KPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTI  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   306 bits (785),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 168/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV         RS Q++ KA GV+P+ AR+TCSLQS +K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVVSARNNLQLRSSQSLSKAFGVEPAAARLTCSLQSDLKDLAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FA
Sbjct  66   AKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   306 bits (785),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 165/187 (88%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  RI    RS Q V KA G++PS ARI+CSLQS +K+LA    DA 
Sbjct  6    QAAATLMQPTKVGVPSRISLQLRSSQNVSKAFGLEPSTARISCSLQSDLKDLAQKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV+ FA 
Sbjct  66   KIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVDKFAI  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+ DG+V
Sbjct  126  KPGKYNAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVAPDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   306 bits (785),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV         R  Q+V KA GV+P+ AR+TCSLQS +K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVVSARNNLQLRLSQSVSKAFGVEPAAARLTCSLQSDLKDLAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGVE+FA
Sbjct  66   AKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVESFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   306 bits (784),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 165/188 (88%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV+P       RS Q+V KA GVD +  RITCSLQS  K++A    DA
Sbjct  6    QAAATLMQPTKVGVSPARSTVQLRSSQSVSKAFGVDSAGGRITCSLQSDFKDMAQKCVDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FA
Sbjct  66   TKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG+
Sbjct  126  FKPGKYQAKKLCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   306 bits (783),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 167/187 (89%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA    DA+
Sbjct  6    QAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLARKCVDAS  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAF
Sbjct  66   KIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG++
Sbjct  126  KPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTI  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   304 bits (779),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 166/187 (89%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA    DA+
Sbjct  6    QAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLAQKCVDAS  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+ SGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAF
Sbjct  66   KIAGFALATSALIASGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG++
Sbjct  126  KPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTI  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   304 bits (779),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 165/187 (88%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  R     RS Q+V KA G++P  AR+TCSLQS +K+LA    DA 
Sbjct  6    QAAATLMQPTKVGVPSRTSVQLRSSQSVSKAFGLEPVGARLTCSLQSDLKDLAQKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY AKKFCLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS+DG+V
Sbjct  126  KPGKYYAKKFCLEPTSFTVKAEGVSKNAPPEFQRTKLMTRLTYTLDEIEGPFEVSTDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH   DA
Sbjct  6    QAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAHKCLDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            +K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG E FA
Sbjct  66   SKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGTEAFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+ DG+
Sbjct  126  FKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVAPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 164/188 (87%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV         RS Q V KA GV+P+ AR+ CS QS +K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVVSARNNLQLRSSQCVSKAFGVEPAAARLNCSFQSDLKDLAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGVE+FA
Sbjct  66   VKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVESFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   303 bits (775),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH   DA
Sbjct  6    QAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAHKCLDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            +K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG E FA
Sbjct  66   SKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGSEAFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+ DG+
Sbjct  126  FKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVAPDGT  185

Query  531  VKFEEKDG  554
            +KFEEKDG
Sbjct  186  IKFEEKDG  193



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH   DA
Sbjct  6    QAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAHKCLDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            +K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG E FA
Sbjct  66   SKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGSEAFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV+ DG+
Sbjct  126  FKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVAPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   301 bits (770),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 163/188 (87%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV+P       RS+Q+V KA G D +  RITCSLQ   K+LA   +DA
Sbjct  6    QAAATLMQPTKVGVSPARSTVQLRSFQSVSKAFGADSAGGRITCSLQPDFKDLAQKCADA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALAT AL+VSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FA
Sbjct  66   TKIAGFALATPALVVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY AKKFCLEPTSFTVKAE V+KN+PPEFQNTKLMTRLTYTLDEIEGPFEVSSDG+
Sbjct  126  FKPGKYQAKKFCLEPTSFTVKAEGVNKNSPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 164/187 (88%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K+LAH   DA 
Sbjct  6    QAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKDLAHKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KIAGFALATSALLVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG+V
Sbjct  126  KSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   300 bits (768),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH   DA
Sbjct  6    QAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAHKCLDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            +K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG E FA
Sbjct  66   SKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGSEAFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD+IEGPFEV+ DG+
Sbjct  126  FKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDQIEGPFEVAPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   300 bits (767),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 166/188 (88%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPR---IGRSYQTVGKALGVDPSP-ARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVG   R   + RS Q V KA G++PS  AR+TCSLQS +K+ AH   DA
Sbjct  6    QAAATLMQPTKVGAPARTSLLLRSSQNVSKAFGLEPSASARLTCSLQSDLKDFAHKCVDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            +K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+E FA
Sbjct  66   SKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLEAFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            +KFEEKDG
Sbjct  186  LKFEEKDG  193



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   299 bits (765),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            Q AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +DAAK+
Sbjct  6    QAAATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCTDAAKI  65

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKP
Sbjct  66   AGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKP  125

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKF
Sbjct  126  GKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKF  185

Query  540  EEKDG  554
            EEKDG
Sbjct  186  EEKDG  190



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   298 bits (764),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            Q AATLMQPTKVGV   +  RS Q+V KA GV+    R+TCSLQ++IKELA   +DAAK+
Sbjct  6    QAAATLMQPTKVGVRNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKI  65

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKP
Sbjct  66   AGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKP  125

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKF
Sbjct  126  GKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKF  185

Query  540  EEKDG  554
            EEKDG
Sbjct  186  EEKDG  190



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 167/189 (88%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPR-IG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQP+KVGV  R IG    RS   + +A G +P+ AR+TCSLQS +++LAH  SD
Sbjct  6    QAAATLMQPSKVGVASRSIGGQQLRSGSHLSRAFGFEPTTARLTCSLQSDLRDLAHKCSD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            AAKLAGFALATSAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  66   AAKLAGFALATSALVVAGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFKPGKY+AKKFCLEPTSFTVKAE VSKNAP EFQ TKLMTRLTYTLDEIEGPFEVS DG
Sbjct  126  AFKPGKYNAKKFCLEPTSFTVKAEGVSKNAPAEFQRTKLMTRLTYTLDEIEGPFEVSPDG  185

Query  528  SVKFEEKDG  554
            +VKFEEKDG
Sbjct  186  AVKFEEKDG  194



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AAT MQPTKVG+  R  +S Q + KA G++P+ A++TCSLQ  +KE A    DA K+A
Sbjct  6    QAAATFMQPTKVGIASRNLKSTQCISKAFGLEPAAAKLTCSLQPDLKEFAQKCVDATKIA  65

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++FAFKPG
Sbjct  66   GFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAFKPG  125

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+A+K CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDG+VKFE
Sbjct  126  KYNAQKLCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFEVTSDGTVKFE  185

Query  543  EKDG  554
            EKDG
Sbjct  186  EKDG  189



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   297 bits (760),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 164/188 (87%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVG   R     R  Q V KA G++PS  AR+TCSLQS +K+ AH   DA
Sbjct  6    QAAATLMQPTKVGAPARTSLQLRPSQNVSKAFGLEPSASARLTCSLQSDLKDFAHKCVDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            +K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+E FA
Sbjct  66   SKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLEAFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            +KFEEKDG
Sbjct  186  LKFEEKDG  193



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   296 bits (759),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 163/183 (89%), Gaps = 1/183 (1%)
 Frame = +3

Query  9    AATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAG  185
            AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +DAAK+AG
Sbjct  2    AATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCTDAAKIAG  61

Query  186  FALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  365
            FALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGK
Sbjct  62   FALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGK  121

Query  366  YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEE  545
            Y+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEE
Sbjct  122  YTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEE  181

Query  546  KDG  554
            KDG
Sbjct  182  KDG  184



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   297 bits (760),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 163/187 (87%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA    DA 
Sbjct  6    QAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS+DG+V
Sbjct  126  KPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSTDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 167/187 (89%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA    DA+
Sbjct  6    QAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQKCVDAS  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+++FAF
Sbjct  66   KIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGLDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLDEIEGPFEVSSDG++
Sbjct  126  KPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGNI  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 164/189 (87%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQPTKVG  P        RS Q+V KA G++P+ ARITCSLQS +K+LA    D
Sbjct  6    QAAATLMQPTKVGGVPSSRATLQLRSSQSVSKAFGLEPASARITCSLQSDLKDLAQKCVD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG++ F
Sbjct  66   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGLDKF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            +FK GKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV  DG
Sbjct  126  SFKAGKYNAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVGPDG  185

Query  528  SVKFEEKDG  554
            +VKFEEKDG
Sbjct  186  TVKFEEKDG  194



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 164/187 (88%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV+ R G   RS Q+V KA G + S AR+TCSLQS +K+ A    DA+
Sbjct  6    QAAATLMQPTKVGVSSRSGQQLRSSQSVCKAFGFETSGARLTCSLQSDLKDFAQKCVDAS  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG+++F F
Sbjct  66   KIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGIDSFGF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K GKY+ KKFCLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLDEIEGPFEVS+DG+V
Sbjct  126  KSGKYNMKKFCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFEVSTDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 167/187 (89%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA    DA+
Sbjct  6    QAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQKCVDAS  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+++FAF
Sbjct  66   KIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGLDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLDEIEGPFEVSSDG++
Sbjct  126  KPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTI  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   295 bits (756),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 163/187 (87%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA    DA 
Sbjct  6    QAAATLMQPIKVAAPSRTNVPLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLALKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS+DG+V
Sbjct  126  KPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSTDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   295 bits (755),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DA
Sbjct  6    QAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FA
Sbjct  66   AKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   295 bits (755),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DA
Sbjct  5    QAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDA  64

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FA
Sbjct  65   AKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFA  124

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  125  FKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGT  184

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  185  VKFEEKDG  192



>gb|ABG25041.1| 33kDa precursor protein of oxygen-evolving complex [Nicotiana 
tabacum]
Length=179

 Score =   289 bits (740),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 155/165 (94%), Gaps = 0/165 (0%)
 Frame = +3

Query  60   RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  239
            RS Q+V KA GV+P+ AR+TCS Q+++K+LA  F+DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEPAAARLTCSSQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGV  62

Query  240  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  419
            PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKA 
Sbjct  63   PKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFAFKPGKYNAKKFCLEPTSFTVKAG  122

Query  420  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            SV+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDG
Sbjct  123  SVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDG  167



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   293 bits (750),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQT--VGKALGVDPSPA-RITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTK+GV  R     ++  V KA G++P+ + R+TCSLQ+ +KE AH   DA 
Sbjct  6    QAAATLMQPTKLGVPSRTSLQLRSSNVSKAFGLEPAASSRLTCSLQTDLKEFAHKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG E FAF
Sbjct  66   KIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGSEAFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+V
Sbjct  126  KPGKYVAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_006856169.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   293 bits (750),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTK+G + R G   RS   + KA G +PS AR+TCS+Q  ++ELAH   DA 
Sbjct  6    QAAATLMQPTKLGGSSRNGLQLRSSSQICKAFGFEPSSARLTCSIQEDLRELAHKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTY EVKG+GTANQCP I+GGV+ FAF
Sbjct  66   KLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYTEVKGTGTANQCPAIDGGVDKFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+ KKFCLEPTSFTVKAES++KNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DG+V
Sbjct  126  KPGKYNMKKFCLEPTSFTVKAESINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQP KVGV  R G   RS Q V +A G++P+ ARITCS Q+  K+LA    DA 
Sbjct  6    QAAATLMQPAKVGVPSRTGLQLRSSQIVSRAFGLEPAAARITCSSQTDFKDLAQKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV++FAF
Sbjct  66   KIAGFALATSALVVSGAGAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+ KK CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+V
Sbjct  126  KPGKYNVKKLCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTV  185

Query  534  KFEEKDG  554
            KF EKDG
Sbjct  186  KFVEKDG  192



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   292 bits (747),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 166/188 (88%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DA
Sbjct  6    QAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FA
Sbjct  66   AKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFA  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FK GKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKSGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   292 bits (747),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 162/189 (86%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRI--GRSYQT---VGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQP KVG T R   G+  +T   + KA G +P+ AR+TCSLQS +++LAH  +D
Sbjct  6    QAAATLMQPAKVGATGRTLAGQQLRTSSHLSKAFGFEPAGARLTCSLQSDLRDLAHKCAD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++F
Sbjct  66   ATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFKPGKY  KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS +G
Sbjct  126  AFKPGKYQMKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPNG  185

Query  528  SVKFEEKDG  554
            SV FEEKDG
Sbjct  186  SVTFEEKDG  194



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   291 bits (745),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 160/188 (85%), Gaps = 9/188 (5%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATL     +GV P       RS   V KA GV+PS AR+TCSLQ+  K+LA   SDA
Sbjct  6    QAAATL-----IGVIPSRNNLQFRSSHCVSKAFGVEPSSARLTCSLQADFKDLAQKCSDA  60

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGVE FA
Sbjct  61   AKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVETFA  120

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAE V+KN+PPEFQ TKLMTRLTYTLDEIEGPFEVSSDG+
Sbjct  121  FKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPEFQKTKLMTRLTYTLDEIEGPFEVSSDGN  180

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  181  VKFEEKDG  188



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   291 bits (744),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTKVG V+ R     RS Q++ KA G++PS ++++CSLQ+ +K+ A   +DA
Sbjct  6    QAAATLMQPTKVGGVSARNNLPLRSAQSLSKAFGLEPSASKLSCSLQADLKDFAQKCTDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F+
Sbjct  66   AKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  126  FKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGT  185

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  186  VKFEEKDG  193



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   291 bits (744),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 163/187 (87%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV+ R     RS Q V ++ G +P+ +R+TCSLQS +K+LA   +DAA
Sbjct  6    QAAATLMQPTKVGVSARSSLQLRSAQNVSRSFGFEPAGSRLTCSLQSDLKDLAQKCTDAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+ SGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPT++GG ++FAF
Sbjct  66   KIAGFALATSALVASGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTLDGGSDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K GKY+AKKFCLEPTSFTVKAE VSKN+P EFQ TKLMTRLTYTLDEIEGPFEVS DG+V
Sbjct  126  KSGKYTAKKFCLEPTSFTVKAEGVSKNSPAEFQKTKLMTRLTYTLDEIEGPFEVSQDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   290 bits (743),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    DA KLA
Sbjct  6    QAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLDATKLA  65

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSALLVSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGVE+FAFKPG
Sbjct  66   GFALATSALLVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVESFAFKPG  125

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEV+ DG+VKFE
Sbjct  126  KYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVTPDGTVKFE  185

Query  543  EKDG  554
            EKDG
Sbjct  186  EKDG  189



>ref|XP_003637254.1| Oxygen-evolving enhancer protein, partial [Medicago truncatula]
Length=255

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +A+K+A
Sbjct  6    QAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVEASKIA  65

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F+FKPG
Sbjct  66   GFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPG  125

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE
Sbjct  126  KYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  185

Query  543  EKDG  554
            EKDG
Sbjct  186  EKDG  189



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATL QPTKVGV  + G   RS  TV K  G DPS AR+TCSLQS +KELA    DA 
Sbjct  6    QAAATLRQPTKVGVPVKGGLQLRSTPTVCKNFGFDPSCARLTCSLQSDLKELAQKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FAF
Sbjct  66   KIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K GKY+ KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DG+V
Sbjct  126  KTGKYNLKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 162/187 (87%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPR---IGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQP KVGV PR   + RS   + KA GV+ S AR+TCSLQ+ +K+LA   +DAA
Sbjct  6    QAAATLMQPAKVGVAPRNNVLLRSSPNLSKAFGVEQSSARLTCSLQADLKDLAQKCTDAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV+ FAF
Sbjct  66   KVAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGVDKFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY AKK CLEPTSFTVKAE  +KN+PPEFQ TKLMTRLTYTLDEIEGPFEV++DG++
Sbjct  126  KPGKYDAKKLCLEPTSFTVKAEGPNKNSPPEFQKTKLMTRLTYTLDEIEGPFEVNTDGTI  185

Query  534  KFEEKDG  554
            KF EKDG
Sbjct  186  KFVEKDG  192



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 164/189 (87%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQPTKVGV P        RS Q+V KA GVD + ARI+CSL + +K+LA    D
Sbjct  6    QAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCSLNNDLKDLAQKCVD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  66   ATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFEVS DG
Sbjct  126  AFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDG  185

Query  528  SVKFEEKDG  554
            ++KF EKDG
Sbjct  186  TIKFVEKDG  194



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 159/187 (85%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AAT +QP K+  +P      RS QTVGK+ G+D SPAR+TCSL S  K+     SDAA
Sbjct  6    QAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSPARLTCSLHSDFKDFVGKCSDAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+F
Sbjct  66   KIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSEAFSF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV SDGSV
Sbjct  126  KPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSV  185

Query  534  KFEEKDG  554
            KF+E+DG
Sbjct  186  KFKEEDG  192



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQPTKVGV P        RS Q+V KA GVD + ARI+C+L + +K+LA    D
Sbjct  6    QAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCTLNNDLKDLAQKCVD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  66   ATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFEVS DG
Sbjct  126  AFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDG  185

Query  528  SVKFEEKDG  554
            ++KF EKDG
Sbjct  186  TIKFVEKDG  194



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   287 bits (735),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +A+K+A
Sbjct  6    QAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVEASKIA  65

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F+FKPG
Sbjct  66   GFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPG  125

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE
Sbjct  126  KYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  185

Query  543  EKDG  554
            EKDG
Sbjct  186  EKDG  189



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   287 bits (735),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 159/188 (85%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A   SDA
Sbjct  6    QSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDIKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKV-GVTPRIG--RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
             +AAT +QPTK+   T R G  RS  +V K  G++ S AR+TCS+QS +++ A   +DAA
Sbjct  6    HSAATFLQPTKISAATSRYGHLRSSPSVAKTFGLESSSARLTCSIQSDLRDFAGKCTDAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG + FAF
Sbjct  66   KIAGFALATSALVSSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGSDEFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG+V
Sbjct  126  KPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGTV  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    DA KLA
Sbjct  6    QAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLDATKLA  65

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSALLVSGA+AEGVPKRLTFDEI+SKTY+EVKG+GTANQCPTI+GG+E+FAFKPG
Sbjct  66   GFALATSALLVSGASAEGVPKRLTFDEIRSKTYLEVKGTGTANQCPTIDGGLESFAFKPG  125

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEV+ DG+VKFE
Sbjct  126  KYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVTPDGTVKFE  185

Query  543  EKDG  554
            EKDG
Sbjct  186  EKDG  189



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 162/182 (89%), Gaps = 4/182 (2%)
 Frame = +3

Query  21   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  188
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  189  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  368
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  369  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  548
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  549  DG  554
            DG
Sbjct  181  DG  182



>gb|AFW90569.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=293

 Score =   285 bits (730),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 162/182 (89%), Gaps = 4/182 (2%)
 Frame = +3

Query  21   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  188
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  189  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  368
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  369  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  548
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  549  DG  554
            DG
Sbjct  181  DG  182



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   286 bits (733),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A   S+AA
Sbjct  6    QAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGKCSEAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+F
Sbjct  66   KIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV SDGSV
Sbjct  126  KPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSV  185

Query  534  KFEEKDG  554
            KF+E+DG
Sbjct  186  KFKEEDG  192



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   286 bits (732),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 163/186 (88%), Gaps = 2/186 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVG-VTPRIGRSYQTVGKALGVD-PSPARITCSLQSQIKELAHNFSDAAK  176
            Q AATLMQPTKVG ++    RS Q V K  G++  + +R+TCSLQ+ +K+LA   +DA K
Sbjct  6    QAAATLMQPTKVGRISSSQLRSSQNVSKTFGLECGAGSRVTCSLQADLKDLAQKCADATK  65

Query  177  LAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFK  356
            +AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG+++FAFK
Sbjct  66   IAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLDSFAFK  125

Query  357  PGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVK  536
            PGKY+AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+VK
Sbjct  126  PGKYNAKKICLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTVK  185

Query  537  FEEKDG  554
            FEEKDG
Sbjct  186  FEEKDG  191



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   286 bits (732),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 159/188 (85%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA   SDA
Sbjct  6    QSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   286 bits (731),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AAT MQPTKVG+  R  +S Q + KA G++P+ A++ CSL+  +K+ A    DA K+A
Sbjct  6    QAAATFMQPTKVGMATRNLKSTQCISKAFGLEPAAAKLICSLKPDLKDFAQKCVDATKIA  65

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++FAFK G
Sbjct  66   GFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAFKAG  125

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY A+K CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFE
Sbjct  126  KYKAQKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFE  185

Query  543  EKDG  554
            EKDG
Sbjct  186  EKDG  189



>gb|ABG25040.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
Length=179

 Score =   280 bits (716),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +3

Query  60   RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  239
            RS Q+V KA GV+    R+TCSLQ++IKELA   +DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGV  62

Query  240  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  419
            PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKAE
Sbjct  63   PKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAE  122

Query  420  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             VSKN+ P+FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDG
Sbjct  123  GVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDG  167



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   285 bits (730),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 158/187 (84%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A   SDAA
Sbjct  6    QAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGKCSDAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+F
Sbjct  66   KIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K GKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV SDGSV
Sbjct  126  KAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSV  185

Query  534  KFEEKDG  554
            KF+E+DG
Sbjct  186  KFKEEDG  192



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   285 bits (730),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            Q AAT MQPTK+G T  +  +S Q++ KA G++P+ A+I+CSL + +K+ A    DA K+
Sbjct  6    QAAATFMQPTKLGRTNTLQLKSPQSISKAFGLEPAGAKISCSLHADLKDFAQKCVDATKI  65

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFKP
Sbjct  66   AGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKP  125

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSDG+VKF
Sbjct  126  GKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKF  185

Query  540  EEKDG  554
            EEKDG
Sbjct  186  EEKDG  190



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   285 bits (729),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 160/188 (85%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA   SDA
Sbjct  6    QSAATFLQSAKIATAPSRGGSHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSEIFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  185

Query  531  VKFEEKDG  554
            V+F+E+DG
Sbjct  186  VQFKEEDG  193



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 163/190 (86%), Gaps = 8/190 (4%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  164
            QTAATL   TKVG+  R G      RS Q V KA GV+P+ AR+TCSLQS  K+LA    
Sbjct  6    QTAATLT--TKVGMPARGGGGSLQLRSAQAVSKAFGVEPAGARLTCSLQSDFKDLAQKCV  63

Query  165  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  344
            DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  64   DATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGVDS  123

Query  345  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  524
            FAFK GKY+ KK CLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLDEIEGPFEV++D
Sbjct  124  FAFKAGKYNVKKLCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVAND  183

Query  525  GSVKFEEKDG  554
            G+VKFEEKDG
Sbjct  184  GTVKFEEKDG  193



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 159/188 (85%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA   SDA
Sbjct  6    QSASTFLQAAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEVSSDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSSDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>gb|AAS55410.1| photosystem II protein [Brassica rapa]
Length=233

 Score =   281 bits (719),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 155/186 (83%), Gaps = 4/186 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A   SDA
Sbjct  21   QSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDIKDFAGKCSDA  80

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  81   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  140

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG 
Sbjct  141  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGK  200

Query  531  VKFEEK  548
             + +E+
Sbjct  201  RELQER  206



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   285 bits (728),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 158/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A   SDA
Sbjct  6    QSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEVSSDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSSDGS  185

Query  531  VKFEEKDG  554
            VKF+E+DG
Sbjct  186  VKFKEEDG  193



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 158/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +   K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A   SDA
Sbjct  6    QSAATFLLSAKISAAPSRGSAHLRSTQTVGKSFGLESSSARLTCSYQSDIKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160493.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +3

Query  15   TLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  188
            TLMQP+K+    T    RS Q++ KA G++ S  R+TCSL S +K+++  F+DAAK+AGF
Sbjct  11   TLMQPSKLASRTTTSHLRSSQSLSKAFGLESSGPRLTCSLHSDLKDVSRKFADAAKIAGF  70

Query  189  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  368
            ALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFK GKY
Sbjct  71   ALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKAGKY  130

Query  369  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  548
             AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV +DGS+KFEEK
Sbjct  131  QAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVGADGSIKFEEK  190

Query  549  DG  554
            DG
Sbjct  191  DG  192



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 158/187 (84%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q A T +QP K+  +P      RS QTV K+ G++ SPAR+TCSL S  K+ A   SDAA
Sbjct  6    QAATTFLQPAKIAASPSRSVHLRSNQTVAKSFGLESSPARLTCSLHSDFKDFAGKCSDAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+F
Sbjct  66   KVAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSEAFSF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV SDGSV
Sbjct  126  KPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSV  185

Query  534  KFEEKDG  554
            KF+E+DG
Sbjct  186  KFKEEDG  192



>emb|CBI19622.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 158/187 (84%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
              AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA   +DAA
Sbjct  6    HVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQKCADAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVSSD +V
Sbjct  126  KTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVSSDRTV  185

Query  534  KFEEKDG  554
            KF EKDG
Sbjct  186  KFIEKDG  192



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   283 bits (725),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 158/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +Q  K+  TP  G    RS QTVGK+ G++ S AR+TCS QS  K+ A   SDA
Sbjct  6    QSAATFLQSAKISTTPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
             KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  IKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   283 bits (725),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 164/186 (88%), Gaps = 2/186 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPAR-ITCSLQSQIKELAHNFSDAAK  176
            Q AAT MQPTK+  +  +  +S Q++ KA G++P  A+ +TCSLQ+ +K+LAH   DA K
Sbjct  6    QAAATFMQPTKLSRSNTLQQKSTQSISKAFGLEPVGAKKVTCSLQADLKDLAHKCVDATK  65

Query  177  LAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFK  356
            +AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+++FAFK
Sbjct  66   IAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLDSFAFK  125

Query  357  PGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVK  536
            PGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSDG+VK
Sbjct  126  PGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDGTVK  185

Query  537  FEEKDG  554
            FEEKDG
Sbjct  186  FEEKDG  191



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   283 bits (725),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFSD  167
            Q AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A+  +D
Sbjct  6    QAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVANKCAD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            AAKLAGFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EGGV++F
Sbjct  66   AAKLAGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEGGVDSF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP EVSSDG
Sbjct  126  AFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDG  185

Query  528  SVKFEEKDG  554
            ++KFEEKDG
Sbjct  186  TIKFEEKDG  194



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   283 bits (724),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 161/185 (87%), Gaps = 5/185 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFSDAAKL  179
            Q AAT MQPTK        +S Q + KA G++P+   ++TCSLQ+ +K+LAH   DA K+
Sbjct  6    QAAATFMQPTKFLQL----KSTQAISKAFGLEPAGVNKVTCSLQADLKDLAHKCVDATKI  61

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+E+FAFK 
Sbjct  62   AGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLESFAFKQ  121

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG+VKF
Sbjct  122  GKYNAKKFCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKF  181

Query  540  EEKDG  554
            EEKDG
Sbjct  182  EEKDG  186



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A   SDA
Sbjct  6    QSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEVSSDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSSDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = +3

Query  6    TAATLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            TAATLMQP+K+    T    RS Q++ KA G++ + AR+TCSL S +K+++  F+DAAK+
Sbjct  8    TAATLMQPSKLASRTTTSQLRSSQSLSKAFGLESAGARLTCSLHSDLKDVSRKFADAAKI  67

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++FAFK 
Sbjct  68   AGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAFKA  127

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY AKKFCLEPTSFTVKAE VSKN+PPEFQNTKLMTRLTYTLDEIEGPFEV +DGS+KF
Sbjct  128  GKYQAKKFCLEPTSFTVKAEGVSKNSPPEFQNTKLMTRLTYTLDEIEGPFEVGADGSIKF  187

Query  540  EEKDG  554
            EEKDG
Sbjct  188  EEKDG  192



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   282 bits (722),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+ AT +Q  K+   P  G    RS Q+VGK+ G+D S AR+TCS QS  K+ A   SDA
Sbjct  6    QSTATFLQSAKIATAPSRGSAHLRSTQSVGKSFGLDTSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 158/189 (84%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
              AAT +QP K+  +    R     S QTVGK+ G++ S AR+TCSLQS +K+ A   SD
Sbjct  49   HAAATFLQPAKIAASSSPSRNVYLRSNQTVGKSFGLESSSARLTCSLQSDLKDFAGKCSD  108

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            AAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F
Sbjct  109  AAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETF  168

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            +FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV SDG
Sbjct  169  SFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDG  228

Query  528  SVKFEEKDG  554
            SVKF+E+DG
Sbjct  229  SVKFKEEDG  237



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A   SDA
Sbjct  6    QSAATFIQSAKIATAPSRGGASLRSSQTVGKSFGLETSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+ SGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG E F+
Sbjct  66   VKIAGFALATSALVASGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FK GKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS+DGS
Sbjct  126  FKAGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSADGS  185

Query  531  VKFEEKDG  554
            VKF+E+DG
Sbjct  186  VKFKEEDG  193



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A   SDA
Sbjct  6    QSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
             KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  IKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   282 bits (721),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 158/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A   SDA
Sbjct  6    QSASTFLQSAKIITAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEVSSDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSSDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   281 bits (720),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 159/187 (85%), Gaps = 4/187 (2%)
 Frame = +3

Query  6    TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+     SDAA
Sbjct  8    TTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFVGKCSDAA  67

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+F
Sbjct  68   KIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSF  127

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEVSSDGSV
Sbjct  128  KPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  187

Query  534  KFEEKDG  554
            KF+E+DG
Sbjct  188  KFKEEDG  194



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   282 bits (721),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 157/188 (84%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT  Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A   SDA
Sbjct  21   QSAATFFQSAKISTAPSRGSAHLRSAQTVGKSFGLETSSARLTCSYQSDIKDFAGKCSDA  80

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  81   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  140

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLT TLDEIEGPFEVSSDGS
Sbjct  141  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTCTLDEIEGPFEVSSDGS  200

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  201  VNFKEEDG  208



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 158/189 (84%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFSD  167
            Q AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A+  +D
Sbjct  6    QAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVANKCAD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            AAKL GFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EGGV++F
Sbjct  66   AAKLTGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEGGVDSF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP EVSSDG
Sbjct  126  AFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDG  185

Query  528  SVKFEEKDG  554
            ++KFEEKDG
Sbjct  186  TIKFEEKDG  194



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 158/187 (84%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
              AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA   +DAA
Sbjct  6    HVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQKCADAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVSSD +V
Sbjct  126  KTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVSSDRTV  185

Query  534  KFEEKDG  554
            KF EKDG
Sbjct  186  KFIEKDG  192



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 158/187 (84%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
              AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA   +DAA
Sbjct  6    HVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQKCADAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLDEIEGPFEVSSD +V
Sbjct  126  KTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLDEIEGPFEVSSDRTV  185

Query  534  KFEEKDG  554
            KF EKDG
Sbjct  186  KFIEKDG  192



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 157/189 (83%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQP KV  T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA   +D
Sbjct  6    QAAATLMQPAKVAATGRNLAGQQLRTGSHLSKAFGFEPAGARLTCSLQSDLRDLAQKCAD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A KLAGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV+ F
Sbjct  66   ATKLAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDEF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFKPGKY  KK CLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLDEIEGPFEVS  G
Sbjct  126  AFKPGKYQMKKLCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLDEIEGPFEVSPSG  185

Query  528  SVKFEEKDG  554
            +V F EKDG
Sbjct  186  TVNFVEKDG  194



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   281 bits (718),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KELAH   +A+K+A
Sbjct  6    QAAATLMQPTKLRSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVEASKIA  65

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F+FKPG
Sbjct  66   GFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPG  125

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+AKK CLEPTSFTVK+E V+KN P  FQNTKLMTRLTYTLDEIEGPFEVS+DGSVKFE
Sbjct  126  KYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFE  185

Query  543  EKDG  554
            EKDG
Sbjct  186  EKDG  189



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 158/189 (84%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQP+ VG T R   G+  +T   + K  G +P+ AR+TCSLQ+ +++L    +D
Sbjct  6    QAAATLMQPSTVGATRRSLAGQQLRTSSHLSKTFGFEPAGARLTCSLQTDLRDLVQKCAD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A KLAGFALATSALLV+GANAEGVP RLT+DEIQSKTYMEVKG GTANQCPTIEGGV++F
Sbjct  66   ATKLAGFALATSALLVAGANAEGVPSRLTYDEIQSKTYMEVKGIGTANQCPTIEGGVDSF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFKPGKY  KKFCLEPTSFTVKAESV+KNAPPEFQ TKLMT LTYTLDEIEGP EVS DG
Sbjct  126  AFKPGKYQMKKFCLEPTSFTVKAESVNKNAPPEFQKTKLMTCLTYTLDEIEGPLEVSPDG  185

Query  528  SVKFEEKDG  554
            +VKFEEKDG
Sbjct  186  TVKFEEKDG  194



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 159/187 (85%), Gaps = 4/187 (2%)
 Frame = +3

Query  6    TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+     SDAA
Sbjct  8    TTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFVGKCSDAA  67

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+F
Sbjct  68   KIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSF  127

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEVSSDGSV
Sbjct  128  KPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  187

Query  534  KFEEKDG  554
            KF+E+DG
Sbjct  188  KFKEEDG  194



>gb|ADB07372.1| chloroplast managanese stabilizing protein [Capsicum annuum]
Length=281

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 157/182 (86%), Gaps = 4/182 (2%)
 Frame = +3

Query  21   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  188
            MQPTK+G V+ R     RS Q+V K  GV+   AR+TCSLQ  +K+ A   +DAAK+AGF
Sbjct  1    MQPTKIGGVSARNNLQLRSSQSVNKTFGVEQGAARLTCSLQCDLKDFAQKCTDAAKIAGF  60

Query  189  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  368
            ALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPT++GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTVDGGVDSFAFKPGKY  120

Query  369  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEK  548
            +AKK CLEPTSFTVKAE V+KN+ PEFQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEK
Sbjct  121  NAKKLCLEPTSFTVKAEGVNKNSAPEFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEK  180

Query  549  DG  554
            DG
Sbjct  181  DG  182



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 159/187 (85%), Gaps = 4/187 (2%)
 Frame = +3

Query  6    TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+     SDAA
Sbjct  8    TTATFLQPAKIATSSPSRNVHLRSNQTVGKSSGLESSPARLTCSIHSDFKDFVGKCSDAA  67

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+F
Sbjct  68   KIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSF  127

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEVSSDGSV
Sbjct  128  KPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  187

Query  534  KFEEKDG  554
            KF+E+DG
Sbjct  188  KFKEEDG  194



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+     SDA
Sbjct  6    QSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKYS KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYSGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   278 bits (711),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 154/185 (83%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            Q + T +QPTKV     +  RS   V KA GV+P+  R+  SLQS +KELA+   DA KL
Sbjct  6    QASTTFLQPTKVASRNTLQLRSTPNVCKAFGVEPASGRLCLSLQSDLKELANKCVDATKL  65

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AG ALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV+ FAFK 
Sbjct  66   AGLALATSALIASGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVDTFAFKA  125

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY+AKKFCLEPT F VKAE VSKNAPP+FQNTKLMTRLTYTLDE+EGPFEVSSDG+VKF
Sbjct  126  GKYNAKKFCLEPTKFAVKAEGVSKNAPPDFQNTKLMTRLTYTLDEMEGPFEVSSDGTVKF  185

Query  540  EEKDG  554
            EEKDG
Sbjct  186  EEKDG  190



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   278 bits (711),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+     SDA
Sbjct  6    QSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   278 bits (711),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+     SDA
Sbjct  6    QSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   278 bits (710),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+     SDA
Sbjct  6    QSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 163/188 (87%), Gaps = 8/188 (4%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATLMQPTK+G+  R      +S Q++ KA G++ + A++TCSLQ    ++AH F+D+
Sbjct  6    QAAATLMQPTKIGINNRSTTLHLKSTQSISKAFGLEHNGAKLTCSLQ----DIAHRFADS  61

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTIEGG ++F+
Sbjct  62   AKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGSDSFS  121

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FK GKY+AKKFCLEPTSFTVK+E ++KN+P +FQNTKLMTRLTYTLDEIEGPFEVS DG+
Sbjct  122  FKSGKYNAKKFCLEPTSFTVKSEGITKNSPLDFQNTKLMTRLTYTLDEIEGPFEVSPDGT  181

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  182  VKFEEKDG  189



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AATLMQPTK+       +S Q++ KA G++ S +++TCSLQ+  K+LAH   +A K+A
Sbjct  6    QAAATLMQPTKLRSNSFQLKSTQSISKAFGLEHSGSKVTCSLQTDFKDLAHKCVEATKIA  65

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+++FAFK G
Sbjct  66   GFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLDSFAFKAG  125

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLDEIEGPFEVS DGSVKFE
Sbjct  126  KYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSPDGSVKFE  185

Query  543  EKDG  554
            EKDG
Sbjct  186  EKDG  189



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 154/188 (82%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K      SDA
Sbjct  6    QSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKNFTGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+     SDA
Sbjct  6    QSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALA+SAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALASSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   276 bits (706),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQP K+G         R    V +A GVD    RI+CSLQS ++E+A    DAA
Sbjct  6    QAAATLMQPAKIGGRASASLPSRQASHVARAFGVDAGAGRISCSLQSDVREVASKCIDAA  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            KLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++F F
Sbjct  66   KLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EV SDG++
Sbjct  126  KAGKYQMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVGSDGTL  185

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  186  KFEEKDG  192



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   276 bits (705),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 155/189 (82%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQP K+G      +    R    + +A GVD   ARITCSLQS ++++A    D
Sbjct  8    QAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVRDVASKCVD  67

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            AAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  68   AAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  127

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
             FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EV+SDG
Sbjct  128  PFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVASDG  187

Query  528  SVKFEEKDG  554
            ++KFEEKDG
Sbjct  188  TLKFEEKDG  196



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   275 bits (704),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 155/185 (84%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            Q  ATLMQP ++  T  +  RS    GK+LG++    R TCSL + +K+LA   +DAAK+
Sbjct  6    QAVATLMQPARLRSTASVPIRSVPAAGKSLGIESGAGRFTCSLNTDLKQLAVKLADAAKI  65

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AGFALATSAL+ SGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFK 
Sbjct  66   AGFALATSALVASGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKA  125

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY+AKK CLEPTSFTVKAE V+KNAPP+FQ TKLMTRLTYTLDEIEGPFEVSSDGSVKF
Sbjct  126  GKYNAKKLCLEPTSFTVKAEGVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGSVKF  185

Query  540  EEKDG  554
             EKDG
Sbjct  186  VEKDG  190



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   275 bits (704),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 156/192 (81%), Gaps = 8/192 (4%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG--------RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  158
            Q AAT +QP K+  +            RS QTV K+ G++ S AR TCSLQS +K+ A  
Sbjct  6    QAAATFLQPAKIAASSSSSSPSRNVHLRSNQTVAKSFGLESSSARRTCSLQSDLKDFAGK  65

Query  159  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  338
             S+AAK+AGF LATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  66   CSEAAKIAGFTLATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  125

Query  339  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  518
            E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV 
Sbjct  126  ETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVG  185

Query  519  SDGSVKFEEKDG  554
            SDGSVKF+E DG
Sbjct  186  SDGSVKFKEADG  197



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   275 bits (704),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 157/190 (83%), Gaps = 6/190 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  164
            Q AAT +QP K+  +          RS QT+GK+ G++ S AR+TCSL S +K+ A   S
Sbjct  6    QAAATFLQPAKIAASSSPPSRSVHLRSNQTIGKSFGLESSSARLTCSLHSDLKDFAGKCS  65

Query  165  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  344
            + AK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E 
Sbjct  66   EVAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSET  125

Query  345  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  524
            F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV  D
Sbjct  126  FSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGPD  185

Query  525  GSVKFEEKDG  554
            GSVKF+E+DG
Sbjct  186  GSVKFKEEDG  195



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   275 bits (704),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 156/189 (83%), Gaps = 6/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQP K+G  P        R    V +A GVD +  R++CSLQS I+E+A   +D
Sbjct  6    QAAATLMQPAKLGGRPASSAALPSRPSSHVARAFGVD-AGCRVSCSLQSDIREVASKCAD  64

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            AAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT++GGV+ F
Sbjct  65   AAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTVDGGVDTF  124

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
             FK GKY+ KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EVS+DG
Sbjct  125  PFKSGKYNVKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSADG  184

Query  528  SVKFEEKDG  554
            ++KFEEKDG
Sbjct  185  NIKFEEKDG  193



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   275 bits (704),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPR--IG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AA LMQP K+G T R   G   R++  + KA G +P+ A +TCSLQ+ +++LA   +D
Sbjct  6    QAAAMLMQPAKIGATGRSLAGQQLRTFSHLSKAFGFEPAGAGLTCSLQTDLRDLALKCAD  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A KLAGFA ATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++F
Sbjct  66   ATKLAGFAHATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            AFKPGKY  K+FCLEPTSFTVKAE ++KN+P EFQ TKLMTRLTYTLDEIEGPFEVS DG
Sbjct  126  AFKPGKYQMKRFCLEPTSFTVKAEGINKNSPAEFQKTKLMTRLTYTLDEIEGPFEVSPDG  185

Query  528  SVKFEEKDG  554
            +V+F+EKDG
Sbjct  186  AVRFQEKDG  194



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   275 bits (704),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A   SDA
Sbjct  6    QSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AE  PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAE-APKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  124

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
             KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  125  IKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  184

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  185  VNFKEEDG  192



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 155/189 (82%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q AATLMQP K+G      +    R    + +A GVD   ARITCSLQS ++++A    D
Sbjct  46   QAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVRDVASKCVD  105

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            AAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  106  AAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  165

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
             FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EV+SDG
Sbjct  166  PFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVASDG  225

Query  528  SVKFEEKDG  554
            ++KFEEKDG
Sbjct  226  TLKFEEKDG  234



>gb|AAD38521.1|AF139818_1 33 kDa oxygen evolving protein of photosystem II [Brassica napus]
Length=274

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 150/180 (83%), Gaps = 4/180 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A   SDA
Sbjct  6    QSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEVSSDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSSDGS  185



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 154/188 (82%), Gaps = 11/188 (6%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q AATL     +GV P       RS Q+V KA GV+P+  R+TCSLQ   K+LA   SDA
Sbjct  6    QAAATL-----IGVIPSRNNLQFRSSQSVSKAFGVEPATVRLTCSLQVDFKDLAQKCSDA  60

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
            AK+AGFA ATSAL+  GANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG E FA
Sbjct  61   AKVAGFAFATSALV--GANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGFETFA  118

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+AKKFCLEPTSFTVKAE V+KN+PP FQ TKLMTRLTYTLDEIEGP EVSSDG+
Sbjct  119  FKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPAFQKTKLMTRLTYTLDEIEGPLEVSSDGN  178

Query  531  VKFEEKDG  554
            VKFEEKDG
Sbjct  179  VKFEEKDG  186



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   273 bits (698),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 156/189 (83%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
              AAT +QP K+  +    R     S QTVGK+ G++ S  R+TCSL S +KE A   S+
Sbjct  6    HAAATFLQPAKIAASSSPSRNVHFRSNQTVGKSFGLESSSPRLTCSLHSDLKEFAGKCSE  65

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            +AK+A FALATSAL+VSGA+AEG P+RLT+DEIQSKTYMEVKG+GTANQCPTI+GG E F
Sbjct  66   SAKIACFALATSALVVSGASAEGAPRRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETF  125

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            +FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLDEIEGPFEV SDG
Sbjct  126  SFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDG  185

Query  528  SVKFEEKDG  554
            SVKF+E+DG
Sbjct  186  SVKFKEEDG  194



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   273 bits (697),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 153/188 (81%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  170
            Q+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+     SDA
Sbjct  6    QSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDA  65

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTAN  PTI+GG E F+
Sbjct  66   VKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANHSPTIDGGSETFS  125

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV+SDGS
Sbjct  126  FKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGS  185

Query  531  VKFEEKDG  554
            V F+E+DG
Sbjct  186  VNFKEEDG  193



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 160/190 (84%), Gaps = 7/190 (4%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPR-----IGRSYQTVGKALGVDPS-PARITCSLQSQIKELAHNFS  164
            Q AAT+MQPTKVGV  R     + RS Q+V K  GV+ +  AR+TCS+ +  K+LA   +
Sbjct  6    QAAATMMQPTKVGVQGRSTNVQLLRSSQSVCKVFGVEQTGSARLTCSV-TDAKDLAQKCA  64

Query  165  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  344
             AAK+AGFALATSAL+VSGA+AEG PKRLTFDEI+SKTY+EVKG+GTANQCPTIEGGV+ 
Sbjct  65   VAAKVAGFALATSALVVSGASAEGPPKRLTFDEIRSKTYLEVKGTGTANQCPTIEGGVDK  124

Query  345  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  524
            FAFKPGKY  KKFCLEPTSFTVKA+SVSKNA PEFQ TKLMTRLTYTLDEIEGPFEVS D
Sbjct  125  FAFKPGKYQMKKFCLEPTSFTVKADSVSKNASPEFQRTKLMTRLTYTLDEIEGPFEVSPD  184

Query  525  GSVKFEEKDG  554
            GSVKFEEKDG
Sbjct  185  GSVKFEEKDG  194



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 149/185 (81%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQT-VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            Q A T +QP +V   PR     +  V K  GV+P  +R++CSL   +K L   F D  K+
Sbjct  6    QAAVTTVQPARVDPPPRAAAKLRMCVSKYFGVEPVASRVSCSLHDDLKNLTLKFVDTTKI  65

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AGF+LA SAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+E+FA KP
Sbjct  66   AGFSLAASALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKP  125

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SDG VKF
Sbjct  126  GKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASDGKVKF  185

Query  540  EEKDG  554
             EKDG
Sbjct  186  LEKDG  190



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 155/186 (83%), Gaps = 3/186 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFSDAAK  176
            Q AATL+ P KVG   R   RS   + KA G D S A R+TCS+ S ++++A   +DAAK
Sbjct  6    QAAATLI-PAKVGAPARTHLRSNSHLSKAFGFDNSTAGRLTCSINSDLRDIAQKCTDAAK  64

Query  177  LAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFK  356
            LAGFALATSAL++SGA+AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG E+F +K
Sbjct  65   LAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTESFGYK  124

Query  357  PGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVK  536
             GKY+ KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGPFEV+ DG+VK
Sbjct  125  TGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAPDGTVK  184

Query  537  FEEKDG  554
            FEEKDG
Sbjct  185  FEEKDG  190



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   268 bits (684),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +DAAK+A
Sbjct  6    QAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCADAAKMA  63

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F FK G
Sbjct  64   GFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPFKAG  123

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG++KFE
Sbjct  124  KYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADGTLKFE  183

Query  543  EKDG  554
            EKDG
Sbjct  184  EKDG  187



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +DAAK+A
Sbjct  6    QAAATLM-PAKIGGRASSVRPSSHVARAFGVDAA-ARITCSLQSDIREVASKCADAAKMA  63

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F FK G
Sbjct  64   GFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPFKAG  123

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG++KFE
Sbjct  124  KYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADGTLKFE  183

Query  543  EKDG  554
            EKDG
Sbjct  184  EKDG  187



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 153/185 (83%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            Q + T +QPTKV     +  RS   V KA GVDP+  R++ SLQS +K+LA    DA KL
Sbjct  6    QASTTFLQPTKVASRNSLQLRSSPNVCKAFGVDPTAGRVSLSLQSDLKDLASKCVDATKL  65

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AG ALATSAL+ SGA+A+G  KRLT+DEIQSKTY+EVKG+GTANQCPTIEGG+E+F FK 
Sbjct  66   AGLALATSALIASGASADGGTKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGLESFGFKA  125

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY+AKKFCLEPT FTVKAE +SKNAPP+FQ+TKLMTRLTYTLDE+EGPFEVSSDG+VKF
Sbjct  126  GKYTAKKFCLEPTKFTVKAEGISKNAPPDFQDTKLMTRLTYTLDEMEGPFEVSSDGTVKF  185

Query  540  EEKDG  554
            EEKDG
Sbjct  186  EEKDG  190



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 157/191 (82%), Gaps = 11/191 (6%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRS-------YQTVGKALGVDPSPARITCSLQSQIKELAHNF  161
            Q AATLMQPTKV        S        Q++ KA G++ + A++TC+LQ    + A+  
Sbjct  6    QAAATLMQPTKVAAITSTRSSSTLQLKPTQSISKAFGLESTGAKLTCNLQ----DFANKC  61

Query  162  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  341
            ++ AK+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV+
Sbjct  62   AETAKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVD  121

Query  342  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  521
            +FAFK GKYSAKK CLEPTSFTVKAE V+KN+P +FQNTKLMTRLTYTLDEIEGPFEVS 
Sbjct  122  SFAFKAGKYSAKKICLEPTSFTVKAEGVTKNSPLDFQNTKLMTRLTYTLDEIEGPFEVSP  181

Query  522  DGSVKFEEKDG  554
            DG+VKFEEKDG
Sbjct  182  DGTVKFEEKDG  192



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   266 bits (679),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   ++AAK+A
Sbjct  6    QAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAEAAKMA  63

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F FK G
Sbjct  64   GFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPFKAG  123

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV +DG++KFE
Sbjct  124  KYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLDEMEGPLEVGADGTLKFE  183

Query  543  EKDG  554
            EKDG
Sbjct  184  EKDG  187



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 150/193 (78%), Gaps = 14/193 (7%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRS---------YQTVGKALGVDPSPARITCSLQSQIKELAH  155
            Q AATLMQP K+G     GR+            + +A GVD   ARITCSLQS  + +A 
Sbjct  6    QAAATLMQPAKIG-----GRAPSASLPSRSSSHLARAFGVDAGAARITCSLQSDFRGVAS  60

Query  156  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  335
               DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPT +GG
Sbjct  61   KCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPTTDGG  120

Query  336  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEV  515
            VE F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EV
Sbjct  121  VEAFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEV  180

Query  516  SSDGSVKFEEKDG  554
             SDG++KFEEKDG
Sbjct  181  GSDGTLKFEEKDG  193



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 151/194 (78%), Gaps = 19/194 (10%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGR----------SYQTVGKALGVDPSPARITCSLQSQIKELA  152
            Q AATLMQP K+G     GR          S Q   +A GVD   ARITCSLQ    ++A
Sbjct  6    QAAATLMQPAKIG-----GRAPFASLPSRPSSQLACRAFGVDAGAARITCSLQ----DVA  56

Query  153  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  332
                DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  57   SRCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  116

Query  333  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFE  512
            GVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP E
Sbjct  117  GVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLE  176

Query  513  VSSDGSVKFEEKDG  554
            V SDG++KFEEKDG
Sbjct  177  VGSDGTLKFEEKDG  190



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 156/189 (83%), Gaps = 6/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+ +  D
Sbjct  6    QAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLSQSCVD  64

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEGGV++F
Sbjct  65   ATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEGGVDSF  124

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            + KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SDG
Sbjct  125  SIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASDG  184

Query  528  SVKFEEKDG  554
             VKF EKDG
Sbjct  185  KVKFIEKDG  193



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 147/184 (80%), Gaps = 11/184 (6%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AAT +  +K+   P  G   ++           +RITCS+QS +K+ A   SD AK+A
Sbjct  6    QAAATFLHQSKISAAPSRGGHLRS-----------SRITCSIQSDLKDFAGKCSDTAKIA  54

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG E F FK G
Sbjct  55   GFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGSETFEFKAG  114

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            +YS KKFC EPTSFTVKAE +SKNAPPEFQNTKLMTRLTYTLDEIEGPF+VSSDG+VKF 
Sbjct  115  QYSGKKFCFEPTSFTVKAEGISKNAPPEFQNTKLMTRLTYTLDEIEGPFDVSSDGTVKFV  174

Query  543  EKDG  554
            EKDG
Sbjct  175  EKDG  178



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 157/190 (83%), Gaps = 7/190 (4%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFS  164
            Q A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L  +  
Sbjct  6    QAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNLIQSCV  64

Query  165  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  344
            DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIEGGV++
Sbjct  65   DATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIEGGVDS  124

Query  345  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  524
            FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SD
Sbjct  125  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASD  184

Query  525  GSVKFEEKDG  554
            G VKF EKDG
Sbjct  185  GKVKFIEKDG  194



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 157/190 (83%), Gaps = 7/190 (4%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFS  164
            Q A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L  +  
Sbjct  6    QAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNLIQSCV  64

Query  165  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  344
            DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIEGGV++
Sbjct  65   DATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIEGGVDS  124

Query  345  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSD  524
            FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SD
Sbjct  125  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASD  184

Query  525  GSVKFEEKDG  554
            G VKF EKDG
Sbjct  185  GKVKFIEKDG  194



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 156/189 (83%), Gaps = 6/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  167
            Q A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+ +  D
Sbjct  6    QAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLSQSCVD  64

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEGGV++F
Sbjct  65   ATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEGGVDSF  124

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
            + KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SDG
Sbjct  125  SIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASDG  184

Query  528  SVKFEEKDG  554
             VKF EKDG
Sbjct  185  KVKFIEKDG  193



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 155/185 (84%), Gaps = 6/185 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKL  179
            Q AAT M PT      R+  +S  ++ KA G++ + ++++CSLQ+ +K+ A   +DAAK+
Sbjct  6    QAAATFMTPTS-----RVQLKSSPSICKAFGIESTGSKVSCSLQADLKDFAQKCTDAAKI  60

Query  180  AGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP  359
            AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV  FA KP
Sbjct  61   AGFALATSALVVSGASAEGSPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVNGFAVKP  120

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY+A+KFCLEPTSFTVKAE +SKN+ PEFQ TKLMTRLTYTLDEIEGP EVSSDG++KF
Sbjct  121  GKYNAQKFCLEPTSFTVKAEGISKNSAPEFQKTKLMTRLTYTLDEIEGPLEVSSDGTIKF  180

Query  540  EEKDG  554
            EEKDG
Sbjct  181  EEKDG  185



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 154/187 (82%), Gaps = 4/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHNFSDAA  173
            Q + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+   DA 
Sbjct  6    QASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV++FAF
Sbjct  66   KLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAF  124

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVSSDG+V
Sbjct  125  KPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTV  184

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  185  KFEEKDG  191



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 154/187 (82%), Gaps = 4/187 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHNFSDAA  173
            Q + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+   DA 
Sbjct  6    QASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV++FAF
Sbjct  66   KLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAF  124

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVSSDG+V
Sbjct  125  KPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTV  184

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  185  KFEEKDG  191



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   260 bits (664),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 147/184 (80%), Gaps = 2/184 (1%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLA  182
            Q AAT+M P K+G      R    V +A GVD + ARITCSLQS I+E+A   +DAAK+A
Sbjct  6    QAAATVM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCADAAKMA  63

Query  183  GFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPG  362
            GFALATSALLVSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F FK G
Sbjct  64   GFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPFKAG  123

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLDE+EGP EV    ++KFE
Sbjct  124  KYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEVRRRRTLKFE  183

Query  543  EKDG  554
            EKDG
Sbjct  184  EKDG  187



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +3

Query  108  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  287
            AR+TCSLQS  K+LA    DA K+AG ALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+E
Sbjct  8    ARLTCSLQSDFKDLAQKCVDATKIAGIALATSALVVSGASAEGVPKRLTYDEIQSKTYLE  67

Query  288  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  467
            VKG+GTANQCPTIEGGV++FAFK GKY+ KK CLEPTSFTVKAESV+KN+PPEFQNTKLM
Sbjct  68   VKGTGTANQCPTIEGGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNSPPEFQNTKLM  127

Query  468  TRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TRLTYTLDEIEGPFEV++DG+VKFEEKDG
Sbjct  128  TRLTYTLDEIEGPFEVANDGTVKFEEKDG  156



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 152/192 (79%), Gaps = 16/192 (8%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPAR--------ITCSLQSQIKELAHN  158
            Q AATLMQP K+G   R   S   V     + PS AR        I+CSL S ++E+A  
Sbjct  6    QAAATLMQPAKMG---RSASSSSAV-----LLPSSARPSSHAARTISCSLTSDLREVATK  57

Query  159  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  338
             +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  58   CADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGV  117

Query  339  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS  518
            + F FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLDEIEGP EV+
Sbjct  118  DAFPFKAGKYEMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVA  177

Query  519  SDGSVKFEEKDG  554
            +DG++KFEEKDG
Sbjct  178  ADGTLKFEEKDG  189



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 149/187 (80%), Gaps = 19/187 (10%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPR---IGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQP KV    R   + RS Q+V KA G++P  AR+TCSLQ+ +K+LA    DA 
Sbjct  6    QAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            KPGKY AKKFCLEPTSFTV                KLMTRLTYTLDEIEGPFEVS+DG+V
Sbjct  126  KPGKYYAKKFCLEPTSFTV----------------KLMTRLTYTLDEIEGPFEVSTDGTV  169

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  170  KFEEKDG  176



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   255 bits (651),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  66   YQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPK  245
            +Q V K+ GV+   +R+ CSL   +K LA    +  K+AG ALATSAL+VSGANAEGVPK
Sbjct  26   FQCVSKSFGVEQVTSRVYCSLHDDLKSLALKCVETTKIAGLALATSALVVSGANAEGVPK  85

Query  246  RLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            RLTFDEIQSKTYMEVKG+GTANQCPTIEGG+++FA KPGKY AKKFCLEPTSFTVKAE V
Sbjct  86   RLTFDEIQSKTYMEVKGTGTANQCPTIEGGLDSFAIKPGKYYAKKFCLEPTSFTVKAEGV  145

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            SKN+ P+FQNTKLMTRLTYTLDEIEGPFEV+SDG VKF EKDG
Sbjct  146  SKNSTPDFQNTKLMTRLTYTLDEIEGPFEVASDGKVKFIEKDG  188



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 144/187 (77%), Gaps = 23/187 (12%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K L        
Sbjct  6    QAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKGLGSQ-----  60

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
                           GA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  61   ---------------GASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  105

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSV  533
            K GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG+V
Sbjct  106  KSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGTV  165

Query  534  KFEEKDG  554
            KFEEKDG
Sbjct  166  KFEEKDG  172



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   247 bits (630),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = +3

Query  60   RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  239
            RS Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGV
Sbjct  14   RSSQSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGV  71

Query  240  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  419
            PKRLT+ EIQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE
Sbjct  72   PKRLTYKEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAE  131

Query  420  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             VS+NA P FQNTKLMTRLTYTLDEIEGPFEV+SDG+V+F EKDG
Sbjct  132  DVSRNATPVFQNTKLMTRLTYTLDEIEGPFEVASDGTVRFLEKDG  176



>ref|XP_009387680.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like, 
partial [Musa acuminata subsp. malaccensis]
Length=170

 Score =   241 bits (616),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 137/165 (83%), Gaps = 6/165 (4%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSP-ARITCSLQSQIKELAHNFS  164
            Q AATLMQP KVG T R       RS   + KA G++P+  AR+TCSLQS ++E+A   +
Sbjct  6    QAAATLMQPAKVGATSRTAAGVQLRSSSHLTKAFGLEPAASARLTCSLQSDVREMAQKCA  65

Query  165  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  344
            D  KLAGFALA SAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGVE+
Sbjct  66   DGVKLAGFALAASALVVTGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVES  125

Query  345  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  479
            FAFKPGKY+ KK CLEPTSFTVKAE+VSKNAPPEFQ TKLMTRLT
Sbjct  126  FAFKPGKYNTKKLCLEPTSFTVKAEAVSKNAPPEFQKTKLMTRLT  170



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +3

Query  69   QTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKR  248
            Q+V K+    P   R++CSL   +K L+ N  +A K+AGFALATSAL+VSGA+AEGVPKR
Sbjct  22   QSVSKSF--KPVTRRVSCSLHDDLKNLSLNCVEATKIAGFALATSALVVSGASAEGVPKR  79

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  428
            LT++EIQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE VS
Sbjct  80   LTYEEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAEGVS  139

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            KNA P FQNTKLMTRLTYTLDEIEGPF+V+SDG+V+F EKDG
Sbjct  140  KNAKPVFQNTKLMTRLTYTLDEIEGPFDVASDGTVRFLEKDG  181



>gb|AEH95324.1| 33 kDa manganese stabilizing chloroplast protein [Allium cepa]
Length=238

 Score =   239 bits (610),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  162  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  341
            +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV+
Sbjct  2    TDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVD  61

Query  342  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSS  521
            +FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYT+DEIEGPFEVS 
Sbjct  62   SFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTMDEIEGPFEVSP  121

Query  522  DGSVKFEEKDG  554
            D +VKFEEKDG
Sbjct  122  DSTVKFEEKDG  132



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = +3

Query  69   QTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKR  248
            Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGVPKR
Sbjct  22   QSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGVPKR  79

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  428
            LT+ +IQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE VS
Sbjct  80   LTYKDIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAEGVS  139

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            +NA P F NTKLMTRLTYTLDEIEGPFEV+SDG+V+F EKDG
Sbjct  140  RNATPFFLNTKLMTRLTYTLDEIEGPFEVASDGTVRFLEKDG  181



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   237 bits (605),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 143/188 (76%), Gaps = 4/188 (2%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIGRSYQTVGK---ALGVDP-SPARITCSLQSQIKELAHNFSDA  170
            Q AATL+QPTK+ VT    R   +      A G +P + AR++CSLQ  +KE A   + A
Sbjct  12   QAAATLLQPTKLSVTRSSSRLSSSSSHVSRAFGFEPATSARVSCSLQDDVKEFAEKCAGA  71

Query  171  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  350
             K+A   LA SAL+ SGA AEG PKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGVE F 
Sbjct  72   TKIAAVTLAASALVASGAGAEGPPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGVEGFP  131

Query  351  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGS  530
            FK GKY  KK C+EPTSFTVKAES +KN PP+FQ T+LMTRLTYTLDEIEGP EVSSDG 
Sbjct  132  FKAGKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTRLMTRLTYTLDEIEGPLEVSSDGK  191

Query  531  VKFEEKDG  554
            +KFEEKDG
Sbjct  192  LKFEEKDG  199



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHNFSD  167
            Q AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A   + 
Sbjct  12   QAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAEKCAG  71

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGVE F
Sbjct  72   ATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGVEAF  131

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
             FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVS DG
Sbjct  132  PFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEVSHDG  191

Query  528  SVKFEEKDG  554
             +KFEEKDG
Sbjct  192  KLKFEEKDG  200



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHNFSD  167
            Q AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A   + 
Sbjct  12   QAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAEKCAG  71

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGVE F
Sbjct  72   ATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGVEAF  131

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
             FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVS DG
Sbjct  132  PFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEVSQDG  191

Query  528  SVKFEEKDG  554
             +KFEEKDG
Sbjct  192  KLKFEEKDG  200



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHNFSD  167
            Q AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A   + 
Sbjct  12   QAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAEKCAG  71

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGVE F
Sbjct  72   ATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGVEAF  131

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
             FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVS DG
Sbjct  132  PFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEVSQDG  191

Query  528  SVKFEEKDG  554
             +KFEEKDG
Sbjct  192  KLKFEEKDG  200



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 5/189 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAHNFSD  167
            Q AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A   + 
Sbjct  12   QAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAEKCAG  71

Query  168  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  347
            A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGVE F
Sbjct  72   ATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGVEAF  131

Query  348  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDG  527
             FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVS DG
Sbjct  132  PFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLDEIEGPLEVSHDG  191

Query  528  SVKFEEKDG  554
             +KFEEKDG
Sbjct  192  KLKFEEKDG  200



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +3

Query  210  LVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCL  389
            L  GA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG+++FAFKPGKY+AKK CL
Sbjct  9    LSQGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLDSFAFKPGKYNAKKICL  68

Query  390  EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDG
Sbjct  69   EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDG  123



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +3

Query  216  SGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEP  395
            SGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY AKKFCLEP
Sbjct  19   SGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEP  78

Query  396  TSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TSFTVKAESV+KNAPP+FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDG
Sbjct  79   TSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDG  131



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 2/123 (2%)
 Frame = +3

Query  192  LATSALLVS--GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  365
            + T +L+V   GA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFKPGK
Sbjct  2    VVTYSLIVKFKGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKPGK  61

Query  366  YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEE  545
            Y+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEE
Sbjct  62   YNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEE  121

Query  546  KDG  554
            KDG
Sbjct  122  KDG  124



>gb|ACE98011.1| putative protein, partial [Populus tremula]
 gb|ACE98012.1| putative protein, partial [Populus tremula]
 gb|ACE98013.1| putative protein, partial [Populus tremula]
 gb|ACE98014.1| putative protein, partial [Populus tremula]
 gb|ACE98015.1| putative protein, partial [Populus tremula]
 gb|ACE98016.1| putative protein, partial [Populus tremula]
 gb|ACE98017.1| putative protein, partial [Populus tremula]
 gb|ACE98018.1| putative protein, partial [Populus tremula]
 gb|ACE98019.1| putative protein, partial [Populus tremula]
 gb|ACE98020.1| putative protein, partial [Populus tremula]
 gb|ACE98021.1| putative protein, partial [Populus tremula]
 gb|ACE98022.1| putative protein, partial [Populus tremula]
 gb|ACE98023.1| putative protein, partial [Populus tremula]
 gb|ACE98024.1| putative protein, partial [Populus tremula]
 gb|ACE98025.1| putative protein, partial [Populus tremula]
 gb|ACE98026.1| putative protein, partial [Populus tremula]
 gb|ACE98027.1| putative protein, partial [Populus tremula]
 gb|ACE98028.1| putative protein, partial [Populus tremula]
 gb|ACE98029.1| putative protein, partial [Populus tremula]
 gb|ACE98030.1| putative protein, partial [Populus tremula]
 gb|ACE98031.1| putative protein, partial [Populus tremula]
 gb|ACE98032.1| putative protein, partial [Populus tremula]
 gb|ACE98033.1| putative protein, partial [Populus tremula]
 gb|ACE98034.1| putative protein, partial [Populus tremula]
 gb|ACE98035.1| putative protein, partial [Populus tremula]
 gb|ACE98036.1| putative protein, partial [Populus tremula]
 gb|ACE98037.1| putative protein, partial [Populus tremula]
 gb|ACE98038.1| putative protein, partial [Populus tremula]
 gb|ACE98039.1| putative protein, partial [Populus tremula]
 gb|ACE98040.1| putative protein, partial [Populus tremula]
 gb|ACE98041.1| putative protein, partial [Populus tremula]
 gb|ACE98042.1| putative protein, partial [Populus tremula]
 gb|ACE98043.1| putative protein, partial [Populus tremula]
 gb|ACE98044.1| putative protein, partial [Populus tremula]
 gb|ACE98045.1| putative protein, partial [Populus tremula]
 gb|ACE98046.1| putative protein, partial [Populus tremula]
Length=170

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/108 (91%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  410
            EGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAFK GKY+AKKFCLEPTSFTV
Sbjct  1    EGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAFKAGKYNAKKFCLEPTSFTV  60

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDG
Sbjct  61   KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFEEKDG  108



>gb|AIS72812.1| oxygen evolving activity, partial [Rhizophora apiculata]
Length=147

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +3

Query  222  ANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTS  401
            A AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FAFKPGKY+ KK CLEPTS
Sbjct  1    AGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFAFKPGKYNVKKLCLEPTS  60

Query  402  FTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            FTVKAE V+KNAPPEFQNTKLMTRLTYTLDEIEGPFEVS DG+VKF EKDG
Sbjct  61   FTVKAEGVNKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFVEKDG  111



>gb|KJB43587.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=262

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = +3

Query  3    QTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  173
            Q AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA    DA 
Sbjct  6    QAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQKCVDAT  65

Query  174  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  353
            KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAF
Sbjct  66   KLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAF  125

Query  354  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  449
            KPGKY AKKFCLEPTSFTVK + V+   P  F
Sbjct  126  KPGKYYAKKFCLEPTSFTVK-QLVASGKPDSF  156



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +3

Query  231  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  410
            EGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EGGV++FAFKPGKY+ KKFCLEPTSFTV
Sbjct  1    EGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEGGVDSFAFKPGKYNMKKFCLEPTSFTV  60

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            KAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP EVSSDG+VKFEEKDG
Sbjct  61   KAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDGTVKFEEKDG  108



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +3

Query  243  KRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAES  422
            KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV++FAFKPGKY+AKKFCLEPT F VKAE 
Sbjct  4    KRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEG  63

Query  423  VSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            +SKN+ P+FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDG
Sbjct  64   ISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDG  107



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 117/161 (73%), Gaps = 5/161 (3%)
 Frame = +3

Query  72   TVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRL  251
            ++  A G+ P+ AR++C+L+  +K +  N    AK A   LA+SAL+   A AEGVP+RL
Sbjct  32   SMSNAFGLKPAVARVSCNLEENVKSIVDN----AKAAAIVLASSALVAGAAFAEGVPQRL  87

Query  252  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  431
            TFDE+ ++TYM+VKGSGTANQCP +  G + FAFK G Y+ +KFCLEPTSFTVKAES  K
Sbjct  88   TFDEVNAQTYMDVKGSGTANQCPIVAEGSDKFAFKDGNYTMRKFCLEPTSFTVKAESQFK  147

Query  432  NAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
                 FQ TKLMTRLTYTLDEIEGP  V  +G+++FEE DG
Sbjct  148  GGNEGFQPTKLMTRLTYTLDEIEGPLTV-QNGNLRFEEVDG  187



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  276  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  455
            TY+EVKG+GTANQCPTIEGGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNAPPEFQ 
Sbjct  1    TYLEVKGTGTANQCPTIEGGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNAPPEFQR  60

Query  456  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDG
Sbjct  61   TKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDG  93



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +3

Query  282  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  461
            MEVKG+GTANQCPTI+GG + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTK
Sbjct  1    MEVKGTGTANQCPTIDGGSDEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTK  60

Query  462  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            LMTRLTYTLDEIEGPFEVSSDG+VKFEEKDG
Sbjct  61   LMTRLTYTLDEIEGPFEVSSDGTVKFEEKDG  91



>gb|ABV57472.1| chloroplast PsbO [Phyllostachys edulis]
Length=160

 Score =   170 bits (431),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +3

Query  270  SKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  449
            SKTYMEVKG+GTANQCPTI+GGV++F FKPGKY  KKFCLEPTSFTVKAE V+KNAPPEF
Sbjct  1    SKTYMEVKGTGTANQCPTIDGGVDSFPFKPGKYYMKKFCLEPTSFTVKAEGVAKNAPPEF  60

Query  450  QNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            Q TKLMTRLTYTLDEIEGP EV +DG++KF EKDG
Sbjct  61   QKTKLMTRLTYTLDEIEGPLEVGADGTIKFVEKDG  95



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 119/163 (73%), Gaps = 5/163 (3%)
 Frame = +3

Query  66   YQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPK  245
            +  V  A G+ P+ +R++CS++  ++ +     D AK A   LA+SAL+   A AEG P+
Sbjct  30   HAPVNSAFGLKPAASRVSCSVEETVRRVV----DGAKAAALVLASSALVAGAALAEGTPQ  85

Query  246  RLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            RLTFDEI ++TYM+VKGSGTANQCP +  G + F+FK GKY+ KK C+EPTSFTVKAES 
Sbjct  86   RLTFDEINAQTYMDVKGSGTANQCPIVPEGSDKFSFKDGKYTMKKLCMEPTSFTVKAESP  145

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             K     FQNTKLMTRLTYTLDEIEGP  V S+G+++FEEKDG
Sbjct  146  FKGGSEGFQNTKLMTRLTYTLDEIEGPLTV-SNGNLRFEEKDG  187



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 113/156 (72%), Gaps = 2/156 (1%)
 Frame = +3

Query  87   LGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEI  266
             G+    +R++CSL  +        +DAAK A  ALATSALL   A A   P RLTFDEI
Sbjct  45   FGLSKCNSRLSCSLDEEASSFVSKVADAAKGAAVALATSALLAQAAVA--APPRLTFDEI  102

Query  267  QSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  446
             SKTY+EVKG+GTANQCP I GG++ F+FKPGKY  +K CLEPT F VKAES  K    E
Sbjct  103  NSKTYLEVKGTGTANQCPAIGGGLDGFSFKPGKYQMQKLCLEPTEFRVKAESQFKGGDTE  162

Query  447  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            F  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG
Sbjct  163  FTKTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  198



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   169 bits (429),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 5/161 (3%)
 Frame = +3

Query  72   TVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRL  251
            ++  A G+ P+ AR++C+L+  ++ +     D AK A   LA+SAL+   A AEGVP+RL
Sbjct  32   SLSSAFGLTPAAARVSCNLEENVRSVV----DGAKAAALVLASSALMAGAALAEGVPQRL  87

Query  252  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  431
            TFDEI ++TYM+VKGSGTANQCP +  G   F+FK G+Y+ +K CLEPTSFTVKAES  K
Sbjct  88   TFDEINAQTYMDVKGSGTANQCPIVAEGSGQFSFKDGEYTMRKLCLEPTSFTVKAESPFK  147

Query  432  NAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
                 +Q TKLMTRLTYTLDEIEGP  V   G+++FEEKDG
Sbjct  148  GGSEGYQQTKLMTRLTYTLDEIEGPLTVKG-GNLRFEEKDG  187



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   162 bits (410),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +3

Query  282  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  461
            MEVKG+GTANQCPTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TK
Sbjct  1    MEVKGTGTANQCPTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTK  60

Query  462  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            LMTRLTYTLDEIEGP EV SDG++KFEEKDG
Sbjct  61   LMTRLTYTLDEIEGPLEVGSDGTLKFEEKDG  91



>gb|ACT83791.1| putative photosystem II oxygen evolving system 33 kDa subunit 
[Lemna minor]
Length=151

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +3

Query  288  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  467
            VKG+GTANQCPTI+GGV+ F FK GKY+ KKFCLEPTSFTVKAE VSKN+ PEFQ TKLM
Sbjct  1    VKGTGTANQCPTIDGGVDGFPFKAGKYNLKKFCLEPTSFTVKAEGVSKNSAPEFQKTKLM  60

Query  468  TRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TRLTYTLDEIEGP EVSSDG++KFEEKDG
Sbjct  61   TRLTYTLDEIEGPLEVSSDGTIKFEEKDG  89



>ref|XP_004243178.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Solanum lycopersicum]
Length=177

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  108  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  287
            +R++ SL++ +K+ +H   D + +AGF+LATS+L+VSGANAE VPKRLT DEIQ+KTYME
Sbjct  64   SRLSFSLEADLKDFSHKCIDTSMIAGFSLATSSLVVSGANAERVPKRLTLDEIQTKTYME  123

Query  288  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  449
            VKG+ TANQCPTI+GGV NFAFK GKY+AKKF LE T F VK E VSKN+  EF
Sbjct  124  VKGTVTANQCPTIDGGVNNFAFKLGKYNAKKFYLETTPFIVKEEGVSKNSALEF  177



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 109/163 (67%), Gaps = 8/163 (5%)
 Frame = +3

Query  72   TVGKALGV--DPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPK  245
            +V KA G+  +   AR+TCS++  +K      +D  K+A    A + L+   A A   PK
Sbjct  33   SVSKAFGLRSNGGGARLTCSMEDIVKRA----TDVGKVAVATAAATLLVAGTAAAN--PK  86

Query  246  RLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            RLT+DE+Q++TY+EVKGSGTANQCP + GG E F FKPG YS KKFCLEPTSFTVK ES 
Sbjct  87   RLTYDEVQAQTYLEVKGSGTANQCPILSGGDEGFKFKPGSYSVKKFCLEPTSFTVKKESP  146

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             K    ++ +TKLMTRLTYTLDEIE    V   G++K  EKDG
Sbjct  147  FKGGGDQYVDTKLMTRLTYTLDEIEADLSVDEKGNLKLVEKDG  189



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = +3

Query  75   VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLT  254
            V +A G+  + A+++CS +  ++      +DA K A  ALA++AL+ S A A  VP RL 
Sbjct  30   VSQAFGLKTASAKVSCSAEENVRGFVQKCADAGKAAALALASTALVASSAQA-AVP-RLN  87

Query  255  FDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKN  434
            FDE+QS TY EVKGSG ANQCP I GGV+ FAFK GKY   K CLEPT+FTVKAES  K 
Sbjct  88   FDELQSLTYSEVKGSGIANQCPIIAGGVDGFAFKSGKYQVSKMCLEPTAFTVKAESQFKG  147

Query  435  APPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
               EFQ TKLMTRLTYTLDEIEGP EV+ + ++KF E DG
Sbjct  148  QGEEFQKTKLMTRLTYTLDEIEGPLEVNGN-NLKFTEVDG  186



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 108/163 (66%), Gaps = 8/163 (5%)
 Frame = +3

Query  72   TVGKALGV--DPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPK  245
            +V KA G+  +   AR+TCS++  +K      +D  K+A    A + L+   A A   PK
Sbjct  33   SVSKAFGLRSNGGGARLTCSMEDIVKRA----TDVGKVAVATAAATLLVAGTAAAN--PK  86

Query  246  RLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            RLT+DE+Q++TY+EVKGSGTANQCP + GG   F FKPG YS KKFCLEPTSFTVK ES 
Sbjct  87   RLTYDEVQAQTYLEVKGSGTANQCPILSGGDGGFKFKPGSYSVKKFCLEPTSFTVKKESP  146

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             K    ++ +TKLMTRLTYTLDEIE    V   G++K  EKDG
Sbjct  147  FKGGGDQYVDTKLMTRLTYTLDEIEADLSVDEKGNLKLVEKDG  189



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  228  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  407
            AEGVP+RLTFDEI ++TY++VKGSGTANQCP +  G + F  K G Y  KK CLEPTSFT
Sbjct  28   AEGVPQRLTFDEINAQTYLDVKGSGTANQCPIVAEGSDKFNLKDGNYQMKKLCLEPTSFT  87

Query  408  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            VKAES  K    ++Q TKLMTRLTYTLDEIEGP  + S+G++KFEEKDG
Sbjct  88   VKAESQFKQGGEDYQPTKLMTRLTYTLDEIEGPLTI-SNGNLKFEEKDG  135



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +3

Query  240  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  419
            PKRLT+DE+Q++TY+EVKGSGTANQCP + GG E F FKPG YS KKFCLEPTSFTVK E
Sbjct  1    PKRLTYDEVQAQTYLEVKGSGTANQCPILSGGDEGFKFKPGSYSVKKFCLEPTSFTVKKE  60

Query  420  SVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            S  K    ++ +TKLMTRLTYTLDEIE    V   G++K  EKDG
Sbjct  61   SPFKGGGDQYVDTKLMTRLTYTLDEIEADLSVDEKGNLKLVEKDG  105



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +3

Query  195  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  374
            AT +L V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  
Sbjct  45   ATVSLGVAGAVLAQSASAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKL  104

Query  375  KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            ++FC+EPTSFTVK ES  K    EFQ T+LMTRLTYTLD + G F+V SDGSV+ +E DG
Sbjct  105  ERFCMEPTSFTVKEESQFKAGESEFQKTRLMTRLTYTLDGMTGDFKVGSDGSVQIKENDG  164



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 93/149 (62%), Gaps = 9/149 (6%)
 Frame = +3

Query  114  ITCSLQSQIKELAHNFS-DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEV  290
            + C L   ++      + +  K+A   +  S+L+++GA+     + LT+DE+Q  TY++V
Sbjct  37   VVCGLSENVQSAVAAAAANVGKMA--VVVGSSLMLAGAS-----QALTYDELQGLTYLQV  89

Query  291  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  467
            KGSG AN CP +EGG  N    K G Y+  KFCLEPTSFTVK ES  K    +F  TKLM
Sbjct  90   KGSGIANTCPVLEGGSSNLKDLKAGDYNISKFCLEPTSFTVKEESQFKGGDTDFVKTKLM  149

Query  468  TRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TRLTYTLDEI G F V   G+V F+E+DG
Sbjct  150  TRLTYTLDEISGKFSVDGSGNVNFKEEDG  178



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +3

Query  195  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  374
            A+ AL V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y+ 
Sbjct  44   ASVALGVAGAVLAQSAGAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKEIKAGDYAL  103

Query  375  KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            ++FC+EPTSFTVK ES  K    EF  T+LMTRLTYTLD + G F+V SDGSV  +E DG
Sbjct  104  ERFCMEPTSFTVKEESQFKQGESEFSKTRLMTRLTYTLDGMTGSFKVGSDGSVNVQENDG  163



>gb|ADC54897.1| oxygen-evolving enhancer protein, partial [Cladophora coelothrix]
Length=235

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LT+D+ QS TYM++KG+G AN CP I+GG +N    KPG YS  KFC+EPTSF V+ ES+
Sbjct  1    LTYDQFQSLTYMQIKGTGLANTCPIIDGGSDNPKDIKPGTYSMYKFCMEPTSFKVQEESM  60

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             + AP  F +TKL+TRLTYTLDE+EG F V SDGS++  E++G
Sbjct  61   QRGAPSFFSDTKLLTRLTYTLDEMEGKFVVGSDGSLRVTEEEG  103



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  410
            G    L+FDE+Q  TY++VKGSG AN CPT++GG  N    KPG YS  KFC+EPTSFTV
Sbjct  53   GSANALSFDELQGLTYLQVKGSGIANTCPTLDGGSANIKDLKPGSYSLGKFCMEPTSFTV  112

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K ES  K    +F +TKLMTRLTYTLDE+ G F+V   G+V+ +E+DG
Sbjct  113  KEESQFKGGDSDFVSTKLMTRLTYTLDEMSGSFKVDGSGNVELKEEDG  160



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  428
            +T+DE+Q  TY++VKG+G AN CP ++GG  + + K G Y+ +KFC+EPTSFTVK +S  
Sbjct  65   VTYDELQGLTYLQVKGTGLANTCPVVDGGESSKSIKAGDYALEKFCMEPTSFTVKEDSAF  124

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K    EF  TKLMTRLTYTLD + G F+V SDGSV  +E+DG
Sbjct  125  KAGESEFTKTKLMTRLTYTLDGMTGSFKVGSDGSVAIQERDG  166



>gb|ADC54902.1| oxygen-evolving enhancer protein, partial [Klebsormidium flaccidum]
Length=142

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  300  GTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  479
            G AN C  I GG + F  K GKY+ KK CLEPTSFTVKAES  K+   +FQ TKLMTRLT
Sbjct  1    GVANTCAIIAGGEDGFKVKAGKYTLKKLCLEPTSFTVKAESQFKDKKEDFQKTKLMTRLT  60

Query  480  YTLDEIEGPFEVSSDGSVKFEEKDG  554
            YTLDEIEGP EV +DGS+KFEEKDG
Sbjct  61   YTLDEIEGPLEVGNDGSLKFEEKDG  85



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  410
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DG
Sbjct  107  KEESQFKGGDSEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDG  154



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  410
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DG
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDG  154



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  410
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K ES  K    EF  TKLMTRLTYTLD + G F+V SDGS + +E DG
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDG  154



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  425
            LTFDE+Q  TY++VKG+G AN CP I+GG  N    KPG YS +K CLEPTSFTVK E+ 
Sbjct  54   LTFDELQGLTYLQVKGTGIANTCPVIDGGSTNLKDLKPGTYSFEKLCLEPTSFTVKEENA  113

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
               +  EF +TKLMTRLTYTLDEI G   V S+GSV+ +E+DG
Sbjct  114  KGES--EFVSTKLMTRLTYTLDEISGKLTVGSNGSVELKEEDG  154



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  363  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE  542
            KY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLDEIEGP EVSSDG++KFE
Sbjct  1    KYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFE  60

Query  543  EKDG  554
            EKDG
Sbjct  61   EKDG  64



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +3

Query  378  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            KFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDG
Sbjct  1    KFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDG  59



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  381  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDG
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDG  58



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  381  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDG
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDG  58



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  381  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDG
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDG  58



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +3

Query  381  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDG
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDG  58



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTV  410
            G    LT+DE+Q  TY++VKGSG AN CP +E G  N    K G Y  +K C+EPTSFTV
Sbjct  45   GSANALTYDELQGLTYLQVKGSGIANTCPVVEAGTTNLNELKAGNYKFQKMCMEPTSFTV  104

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K ES  +    EF  TKLMTRLTYTLDE+ G F+V   G V+ +E+DG
Sbjct  105  KEESQFRGGDSEFVKTKLMTRLTYTLDEMSGTFKVDGSGKVELQEEDG  152



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +3

Query  219  GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPT  398
            GANA      LT++E+Q+ TYM+VKG+G AN CP +EG   N     G Y  +K CLEPT
Sbjct  61   GANA------LTYNELQNLTYMQVKGTGIANTCPIVEGAAGNIKLGSGTYKIEKMCLEPT  114

Query  399  SFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            SFTVK ES  K    E+  TKLMTRLTYTLDEI G   V + G V F E+DG
Sbjct  115  SFTVKEESQFKGGADEYVQTKLMTRLTYTLDEISGALTVGAAGDVTFVEEDG  166



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  428
            L++D++ + TY++VKG+G AN CP IE  V N   K G YS ++ C+EPTSFTVK ES  
Sbjct  23   LSYDDLNALTYLQVKGTGIANTCPVIEKNV-NDKIKAGDYSIEQLCMEPTSFTVKEESQF  81

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K    EF  TKL+TRLTYTLD+I G F+V +DGSV F E+DG
Sbjct  82   KAGEAEFVKTKLLTRLTYTLDDISGKFKVGADGSVTFTEEDG  123



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = +3

Query  252  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVS  428
            TFDE+Q  TY++VKGSG AN CPT+ GG  N    K G YS  K CLEPTSF VK E+  
Sbjct  65   TFDELQGLTYLQVKGSGIANTCPTLSGGSSNIKDLKSGTYSVNKMCLEPTSFKVKEEAQF  124

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            KN   +F  TKL+TRLTYTLDEI G  ++   G V+F+E+DG
Sbjct  125  KNGEADFVPTKLVTRLTYTLDEISGQMKIDGSGGVEFKEEDG  166



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = +3

Query  228  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  407
            A G  + +T+DE+Q  TY++VKG+G AN CP +E G    + K G Y+ +KFC+EPTSFT
Sbjct  57   AAGSAQAVTYDELQGLTYLQVKGTGLANTCPVVETGGSGSSIKGGDYALEKFCMEPTSFT  116

Query  408  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            VK ES  K    EF  TKLMTRLTYTLD + G F+V SDGSV  +E+DG
Sbjct  117  VKEESAFKAGESEFVKTKLMTRLTYTLDGMTGSFKVGSDGSVAVQERDG  165



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  410
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  52   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  111

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K ESV K    EF  TKLMTRLTYTLD + G  +V SDGS + +E+DG
Sbjct  112  KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDG  159



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  410
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  48   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  107

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            K ESV K    EF  TKLMTRLTYTLD + G  +V SDGS + +E+DG
Sbjct  108  KEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDG  155



>gb|AEW08532.1| hypothetical protein CL304Contig1_01, partial [Pinus radiata]
 gb|AFG43487.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43488.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43489.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
Length=87

 Score =   112 bits (279),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLDEIEGP EVSSDG +KF
Sbjct  1    GKYEMKKLCMEPTSFTVKAEGTNKNLPPDFQKTRLMTRLTYTLDEIEGPLEVSSDGKLKF  60

Query  540  EEKDG  554
            EEKDG
Sbjct  61   EEKDG  65



>gb|ADC54900.1| oxygen-evolving enhancer protein, partial [Entransia fimbriata]
Length=151

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +3

Query  276  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  455
            TY +VKG+G ANQCP +         KPGKY+ +K CLEPTSFTVKA    K++P  FQ 
Sbjct  1    TYXQVKGTGIANQCPKLGSAEPGLKVKPGKYAVEKLCLEPTSFTVKAPGPLKDSPVAFQK  60

Query  456  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEE  545
            TKLMTRLTYTLDE EG  +V SDGS+KFE+
Sbjct  61   TKLMTRLTYTLDENEGTLDVGSDGSLKFEK  90



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 69/102 (68%), Gaps = 2/102 (2%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  428
            +T+DE+Q  TY++VKG+G AN CP +E G    A K G Y   KFC+EPTSFTVK E   
Sbjct  95   VTYDELQGLTYLQVKGTGLANTCPVVESGSGPKALKAGDYKFDKFCVEPTSFTVKEEKA-  153

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             +   EF  TKLMTRLTYTLD + G F+V SDGSV   EKDG
Sbjct  154  -DGSTEFAKTKLMTRLTYTLDAMSGDFKVGSDGSVNVVEKDG  194



>gb|AFB34200.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
 gb|AFB34201.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
Length=87

 Score =   111 bits (277),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  360  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF  539
            GKY  KK C+EPTSFTVKAES +KN PP+FQ TKLMTRLTYTLDEIEGP +VS DG +KF
Sbjct  1    GKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTKLMTRLTYTLDEIEGPLDVSPDGKLKF  60

Query  540  EEKDG  554
            EEKDG
Sbjct  61   EEKDG  65



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  425
            L +D++Q  TY++VKGSG AN CP +  G  N    P G Y+  K CLEPTSF VK ES 
Sbjct  115  LDYDQLQGLTYLQVKGSGLANTCPDLNSGTTNLKELPAGDYAVSKLCLEPTSFKVKEESQ  174

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             K    +F +TKLMTRLTYTLD+I G  ++ SDG V FEE+DG
Sbjct  175  FKGGAADFVDTKLMTRLTYTLDDISGKLKLGSDGKVTFEEEDG  217



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = +3

Query  201  SALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAK  377
            +++L   ANA      LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  +
Sbjct  40   TSMLAGAANA------LTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLE  93

Query  378  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            +FC+EPT+F+VK ES  K     F  TKLMTRLTYTLD + G F+V   G+V+ +E DG
Sbjct  94   RFCMEPTAFSVKEESQFKGGETNFVATKLMTRLTYTLDGMTGTFKVDGSGNVELKEDDG  152



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  425
            LT+D++Q  TY++VKG+G AN CP I GG  N    P G Y   +FCLEPTSFTVK +S 
Sbjct  67   LTYDQLQGLTYLQVKGTGVANTCPVISGGSTNPKDIPAGNYKFSEFCLEPTSFTVKEDSQ  126

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             K    E   TKLMTRLTYTLD++ G   + SDG V F+E+DG
Sbjct  127  FKAGESELVKTKLMTRLTYTLDDMSGKMTIGSDGKVTFKEEDG  169



>gb|AFK26084.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena stellata]
Length=248

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  29   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  88

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
                 PEF+ TKLMTRLTYTLD I    +V  DGS   +EKDG
Sbjct  89   DSKPKPEFEKTKLMTRLTYTLDGIRADLQVGGDGSWTLKEKDG  131



>gb|AFK26083.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena pseudostellata]
Length=249

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 63/103 (61%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  30   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  89

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
                 PEF+ TKLMTRLTYTLD I    +V  DGS   +EKDG
Sbjct  90   DSKPKPEFEKTKLMTRLTYTLDGIRADLQVGGDGSWTLKEKDG  132



>ref|XP_003082811.1| photosystem II oxygen-evolving complex protein 1 precursor-Chlamydomonas 
reinhardtii (ISS) [Ostreococcus tauri]
Length=180

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  428
            +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK ES  
Sbjct  9    VTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQF  68

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFE  512
            K    EFQ T+LMTRLTYTLD + G F+
Sbjct  69   KAGESEFQKTRLMTRLTYTLDGMTGDFK  96



>gb|ADC54905.1| oxygen-evolving enhancer protein, partial [Ostreococcus tauri]
Length=148

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +3

Query  276  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  455
            T  + KG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK ES  K    EFQ 
Sbjct  2    TXXQXKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQFKAGESEFQK  61

Query  456  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            T+LMTRLTYTLD + G F+V SDGSV+ +E DG
Sbjct  62   TRLMTRLTYTLDGMTGDFKVGSDGSVQIKENDG  94



>gb|ADC54906.1| oxygen-evolving enhancer protein, partial [Phyllodictyon orientale]
Length=148

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = +3

Query  291  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  467
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ES+ + A PE+  TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGNYSMYKFCMEPTSFKVKEESIIRGAAPEYSKTKLL  61

Query  468  TRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TRLTY+LDE+EG F V SDGSV+ +E++G
Sbjct  62   TRLTYSLDEMEGKFIVGSDGSVRVQEEEG  90



>gb|AFK26085.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Monomorphina pyrum]
Length=237

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  20   LTFDEIQSLSYLEVKGSGLANTCPXIADGTGAKLSLKSGNYKINNMCLEPSSFQVKTPS-  78

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            +   P EF+ TKLMTRLTYTLD I    +V  DGS K +E DG
Sbjct  79   TDGKPSEFEKTKLMTRLTYTLDGIRADLQVGGDGSWKIKEIDG  121



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 4/109 (4%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFT  407
            G  K LT+DE Q  +Y++VKGSG AN CP +  G  +   A KPG Y   KFC+EPT F 
Sbjct  81   GASKALTYDEFQGLSYLDVKGSGMANTCPVLSSGTTDVKTALKPGNYKFDKFCIEPTKFQ  140

Query  408  VKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            VK E V K    EF +TKLMTRLTYTLD + G  +V S G+++F E+DG
Sbjct  141  VK-EDVGKG-KKEFIDTKLMTRLTYTLDAMSGSMKVGSGGAIEFAEEDG  187



>gb|ADC54893.1| oxygen-evolving enhancer protein, partial [Boodlea composita]
Length=148

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = +3

Query  276  TYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQ  452
            T  + KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ES+ +   PE+ 
Sbjct  2    TXXQXKGTGLANTCPIIDGGSDNPKDLKAGTYSMYKFCMEPTSFQVKEESIIRGGAPEYS  61

Query  453  NTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             TKL+TRLTY+LDE+EG F V SDGSV+  E++G
Sbjct  62   KTKLLTRLTYSLDEMEGKFVVGSDGSVRIVEEEG  95



>gb|AFK26079.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Cryptoglena skujae]
Length=236

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  19   LTFDEIQSLSYLEVKGSGLANTCPIIADGTGAKLSLKSGNYKINNMCLEPSSFQVKVPS-  77

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            +   P EF+ TKLMTRLTYTLD I    +V  DGS   +E DG
Sbjct  78   TDGKPTEFEKTKLMTRLTYTLDGIRADLQVGGDGSWSIKEIDG  120



>gb|AFK37254.1| unknown [Medicago truncatula]
Length=66

 Score =   103 bits (257),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  466  MSLVFWNSGGAFLLTLSAFTVNDVGSKQNFLALYFPGLNAKFSTPPSMVGHWLAVPLPFT  287
            MSLVFWN+ G FL+T SA TVN+VGS+QNFLALYFPGL    STPPSMVGHW AVP+P T
Sbjct  1    MSLVFWNASGVFLVTPSALTVNEVGSRQNFLALYFPGLKENESTPPSMVGHWFAVPVPLT  60

Query  286  SIYVLL  269
            S YVLL
Sbjct  61   SKYVLL  66



>ref|XP_010550781.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=195

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 71/103 (69%), Gaps = 13/103 (13%)
 Frame = +3

Query  60   RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  239
            RS  +V KA G+  S AR+TCSL S + + A   SDAAK+AGFALATSAL+VSGANAEGV
Sbjct  23   RSSPSVAKAFGLGSSSARLTCSLHSDLSDFARKCSDAAKIAGFALATSALVVSGANAEGV  82

Query  240  PKRLTFDEIQSKTYMEVKG---SGTANQCPTIEGGVENFAFKP  359
            PKRLTFDE    T MEVKG   +GTAN      G  E F F+P
Sbjct  83   PKRLTFDE----TCMEVKGITTTGTAN------GHSEKFGFEP  115



>gb|ADC54913.1| oxygen-evolving enhancer protein, partial [Valonia utricularis]
Length=147

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 1/89 (1%)
 Frame = +3

Query  291  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  467
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ESV++   P + +TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGSYSMYKFCMEPTSFKVKEESVARGGAPSYSSTKLL  61

Query  468  TRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TRLTY+LDE+EG F V SDGSV+  E++G
Sbjct  62   TRLTYSLDEMEGKFIVGSDGSVRMTEEEG  90



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 4/103 (4%)
 Frame = +3

Query  252  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESV  425
            TFDE Q  +Y++VKGSG AN CP +  G  +   + KPG Y  +KFC+EP+SF VK E V
Sbjct  91   TFDEFQGLSYLDVKGSGMANTCPVLSSGTSDVKGSLKPGTYKFEKFCIEPSSFQVK-EDV  149

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             K    EF NTKLMTRLTYTLD + G  +V S G+++F+E+DG
Sbjct  150  GK-GKKEFINTKLMTRLTYTLDAMSGTMKVGSGGAIEFKEEDG  191



>emb|CCI69514.1| oxygen-evolving enhancer protein, partial [Scotinosphaera sp. 
CAUP H5307]
Length=173

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = +3

Query  291  KGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  464
            + SG AN C  IEGG  N   A KPG Y  ++FCLEPTSFTVK ES  K   PEF  TKL
Sbjct  11   RDSGVANTCAVIEGGSSNVRSALKPGSYKLERFCLEPTSFTVKEESSFKGGEPEFVKTKL  70

Query  465  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            MTRLTYTLD I G  +V+SDG+V  +E+DG
Sbjct  71   MTRLTYTLDSISGSLKVNSDGTVALKEEDG  100



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  142  LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  201

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             K    EF+ TKLMTRLTYTLD I     V  DGS   +EKDG
Sbjct  202  EKQQVTEFERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDG  244



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 65/101 (64%), Gaps = 0/101 (0%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  428
            +TFDE+Q  TY++VKG+G AN CPT+  G +    K G Y     C+EPT+F VK ES  
Sbjct  63   VTFDELQGLTYLQVKGTGVANTCPTLSTGGDGSTLKAGSYQISGMCIEPTAFKVKEESQF  122

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKD  551
            K    EF  TKLMTRLTYTLD + G   V SDGSV F++ +
Sbjct  123  KEGTSEFVKTKLMTRLTYTLDGLSGKMTVGSDGSVDFKKDN  163



>gb|ACU65446.1| putative oxygen-evolving enhancer [Tragopogon dubius]
Length=77

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +3

Query  18   LMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFAL  194
             MQPTKVGV+ R+  +S Q++ KA GVDP+ AR++CSLQS +K+ AH  +DAAK+AGFAL
Sbjct  1    FMQPTKVGVSGRLQLKSSQSICKAFGVDPATARVSCSLQSDLKDFAHKCTDAAKIAGFAL  60

Query  195  ATSALLVSGANAEGVPK  245
            ATSAL+VSGA+AEG PK
Sbjct  61   ATSALVVSGASAEGSPK  77



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 64/103 (62%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  96   LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  155

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
             K    EF+ TKLMTRLTYTLD I     V  DGS   +EKDG
Sbjct  156  EKQQVTEFERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDG  198



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 85/156 (54%), Gaps = 17/156 (11%)
 Frame = +3

Query  93   VDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQS  272
            V P   R+  S  + +K +A         AG A A     VS     G    LTFDE Q 
Sbjct  47   VAPRQTRVFASKPNAMKNIA---------AGLAAAG----VSSIGFLGASNALTFDEFQG  93

Query  273  KTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  446
             +Y +VKGSG AN CP +  G  +   + K G Y   KFC+EPTSF VK E V K    E
Sbjct  94   LSYTDVKGSGMANTCPILNSGTTDVKGSLKAGTYKFDKFCIEPTSFQVK-EDVGKG-KKE  151

Query  447  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            F + KLMTRLTYTLD + G  +V S G+++F+E+DG
Sbjct  152  FIDVKLMTRLTYTLDAMSGSMKVGSGGAIEFKEEDG  187



>gb|ADC54908.1| oxygen-evolving enhancer protein, partial [Siphonocladus tropicus]
Length=145

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = +3

Query  285  EVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  461
            + KG+G AN CP I+GG +N    KPG Y+  KFC+EPTSFTVK +++ +   P +  TK
Sbjct  1    QXKGTGLANTCPIIDGGSDNPKDIKPGSYAMYKFCMEPTSFTVKEQALIRGGEPFYSKTK  60

Query  462  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            L+TRLTY+LDE+EG F V SDGS++  E++G
Sbjct  61   LLTRLTYSLDEMEGKFIVGSDGSIRITEEEG  91



>gb|ACU65447.1| putative oxygen-evolving enhancer [Tragopogon pratensis]
Length=77

 Score =   100 bits (250),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +3

Query  18   LMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFAL  194
             MQPTKVGV+ R+  +S Q++ KA GV+P+ AR++CSLQS +K+ AH  +DAAK+AGFAL
Sbjct  1    FMQPTKVGVSGRLQLKSSQSICKAFGVEPATARVSCSLQSDLKDFAHKCTDAAKIAGFAL  60

Query  195  ATSALLVSGANAEGVPK  245
            ATSAL+VSGA+AEG PK
Sbjct  61   ATSALVVSGASAEGSPK  77



>gb|AGI15762.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=158

 Score =   102 bits (255),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +3

Query  399  SFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            SFTVKAESVSKNAPPEFQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDG
Sbjct  1    SFTVKAESVSKNAPPEFQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDG  52



>emb|CAH04962.1| oxygen-evolving enhancer protein 1 [Cyanophora paradoxa]
Length=347

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 74/116 (64%), Gaps = 6/116 (5%)
 Frame = +3

Query  213  VSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE-NFAFKPGK-YSAKKFC  386
            VS ANAEG    LTFD++ S  Y+++KG+G +N CPT+      N + + GK Y     C
Sbjct  86   VSQANAEG----LTFDQLNSANYLKLKGTGISNTCPTLGASARGNISLEKGKEYYLTDLC  141

Query  387  LEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            ++PT   VKAES+ K    EFQ T+L+TR TYT+D++EGP  V SD  V F EKDG
Sbjct  142  IQPTEILVKAESLQKGKGEEFQPTRLVTRATYTIDKVEGPIFVDSDNQVTFVEKDG  197



>gb|ADC54904.1| oxygen-evolving enhancer protein, partial [Nephroselmis olivacea]
Length=142

 Score =   102 bits (253),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +3

Query  285  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  464
            + KG+G AN CP IE  V +   K G Y+ ++ CLEPTSFTVK ES  K+   EF  TKL
Sbjct  1    QXKGTGIANTCPVIEKDVSD-KIKGGDYAMEQLCLEPTSFTVKEESQFKDGKSEFVKTKL  59

Query  465  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            MTRLTYTLD+I G F+V +DGSV F E+DG
Sbjct  60   MTRLTYTLDDITGKFKVGADGSVTFTEEDG  89



>emb|CCI69513.1| oxygen-evolving enhancer protein, partial [Chlorochytrium lemnae]
Length=143

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  291  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  467
            KGSG AN CP IEGG  N    KPG Y+  K C+EPTSFTVK +S  K    EF  TKLM
Sbjct  1    KGSGIANTCPVIEGGSTNLKDLKPGXYTFDKLCMEPTSFTVKEDSQFKGGETEFVKTKLM  60

Query  468  TRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TRLTYTLD + G  +V   G+V+F+E+DG
Sbjct  61   TRLTYTLDAMSGTMKVDGSGNVEFKEEDG  89



>gb|AFK26080.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Discoplastis spathirhyncha]
Length=239

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 60/101 (59%), Gaps = 1/101 (1%)
 Frame = +3

Query  255  FDEIQSKTYMEVKGSGTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  431
            +DEIQS +Y+EVKGSG AN CP I EG     A K G Y     CLEP+SF VK  S   
Sbjct  21   YDEIQSLSYLEVKGSGLANTCPIIAEGSGNKLALKAGNYKINNMCLEPSSFQVKVPSPDG  80

Query  432  NAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
                +F+ TKLMTRLTYTLD I     V  DGS   +E DG
Sbjct  81   KTVTDFEKTKLMTRLTYTLDGIRADLTVGGDGSWTIKEIDG  121



>gb|AFK26081.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena archaeoplastidiata]
Length=237

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 65/103 (63%), Gaps = 2/103 (2%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LT+DE+QS +Y+E+KGSG +N CP I  G  N  + K G Y     CLEP SF V++ S 
Sbjct  20   LTYDEMQSLSYLEMKGSGLSNTCPIIADGTGNKLSLKAGDYKILNMCLEPASFQVRSPS-  78

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            +   P EF+ TKLMTRLTYTLD I    +V  DGS   +E DG
Sbjct  79   ADGKPSEFEKTKLMTRLTYTLDGIRANLKVGGDGSWSVKEIDG  121



>gb|ADC54894.1| oxygen-evolving enhancer protein, partial [Bornetella sphaerica]
Length=142

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
 Frame = +3

Query  291  KGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  467
            KG+G AN CPTIE G  +  A   G Y   KFC+EPTSFTVK ES  K    EF NTKLM
Sbjct  1    KGTGIANTCPTIETGTTDLSALXAGDYKFSKFCMEPTSFTVKEESQFKGGETEFVNTKLM  60

Query  468  TRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TRLTYTLD++ G F+V SD  V F E++G
Sbjct  61   TRLTYTLDDMSGTFKVGSDRKVSFVEEEG  89



>gb|AFK26082.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena granulata]
Length=239

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  425
            LT++E+QS +Y+E+KG+G +N CP I  G       K GKY     CLEP++F VK    
Sbjct  20   LTYNEMQSLSYLEMKGTGLSNTCPIITDGTGTKLNLKAGKYEINNMCLEPSAFQVKVPPT  79

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
                 PEF+ TKLMTRLTYTLD I     V  DGS    EKDG
Sbjct  80   DVRPNPEFERTKLMTRLTYTLDGIRADLTVGGDGSWSIXEKDG  122



>gb|KIY92168.1| Oxygen-evolving enhancer protein 1,chloroplastic [Monoraphidium 
neglectum]
Length=153

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +3

Query  234  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  410
            G    LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  ++FC+EPT+F+V
Sbjct  44   GAANALTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLERFCMEPTAFSV  103

Query  411  KAESVSKNAPPEFQNTKLMTRLTYTLDEIE  500
            K ES  K     F  TKLMTRLTYTLD + 
Sbjct  104  KEESQFKGGETNFVATKLMTRLTYTLDGVR  133



>gb|ADC54903.1| oxygen-evolving enhancer protein, partial [Mesostigma viride]
Length=151

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = +3

Query  276  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  455
            T  + KG+G AN C  I+          GKY   K CLEPTS  VK ES+ K   P+F  
Sbjct  2    TXXQXKGTGLANTCAVIDNASTELKVAGGKYKVAKMCLEPTSVKVKEESILKGGAPQFVE  61

Query  456  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TKL+TR+TYTLDEI G   V +DGSV+F+E+DG
Sbjct  62   TKLLTRMTYTLDEISGSMTVGNDGSVQFKEEDG  94



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 61/102 (60%), Gaps = 1/102 (1%)
 Frame = +3

Query  252  TFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVS  428
            T+DEIQS +YME+KG+G +N CP I    E+    + G Y     CLEP+SF VK  S  
Sbjct  106  TYDEIQSLSYMEMKGTGLSNTCPIIADSSESKLNLRAGNYKINNMCLEPSSFQVKVPSPD  165

Query  429  KNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
                 +F+ TKLMTRLTYTLD I     V  DGS K +E DG
Sbjct  166  GKTVTDFEKTKLMTRLTYTLDGIRADLAVGGDGSWKIKEIDG  207



>gb|ADC54890.1| oxygen-evolving enhancer protein, partial [Acetabularia acetabulum]
Length=143

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +3

Query  300  GTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  476
            G AN C  IE G  + +  KPG Y   KFC+EP+SFTVK ES  K    EF NTKLMTRL
Sbjct  1    GVANTCAVIESGSTDLSVLKPGNYKFTKFCMEPSSFTVKEESQFKGGETEFVNTKLMTRL  60

Query  477  TYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TYTLD++ G F V+S+G V F E++G
Sbjct  61   TYTLDDMNGQFAVASNGQVDFIEEEG  86



>ref|XP_005652213.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27669.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
Length=270

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 65/102 (64%), Gaps = 1/102 (1%)
 Frame = +3

Query  249  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  425
            +T+D++Q+ +Y EV+G+G A  CP IE G  N A  KPG Y  K  CLEPT   V+ E +
Sbjct  10   ITYDQLQNMSYNEVRGTGLAAVCPLIEEGSTNLADLKPGTYKLKNLCLEPTKIQVQEEGL  69

Query  426  SKNAPPEFQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKD  551
            +K + P++ NTKL+TR T  L +IE   +V  +G+V  +E D
Sbjct  70   TKGSGPQWSNTKLLTRQTTNLSDIEADLKVGPNGAVVLKESD  111



>gb|ADC54912.1| oxygen-evolving enhancer protein, partial [Ulva intestinalis]
Length=151

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 62/96 (65%), Gaps = 5/96 (5%)
 Frame = +3

Query  276  TYMEVKGSGTANQCPTIE---GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  446
            TY ++KG+G AN CPT+E   G V +   KPG Y   +FC+EP+  TVK ES  K    E
Sbjct  1    TYXQIKGTGRANACPTLEETNGSVSDL--KPGNYKLDRFCMEPSKITVKEESQFKGGVTE  58

Query  447  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            F NTKL+TRLTYTLD++ G   +   GS+  +E+DG
Sbjct  59   FVNTKLVTRLTYTLDQMSGTVTIGPGGSISLKEEDG  94



>gb|ADC54901.1| oxygen-evolving enhancer protein, partial [Ignatius tetrasporus]
Length=145

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +3

Query  285  EVKGSGTANQCPTIEGGVEN--FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNT  458
            ++KGSG AN CP IEGG  N     K G Y    FC+EPTSF VK ES  K    EF NT
Sbjct  1    QIKGSGIANTCPVIEGGSSNPKSDLKSGTYKFDNFCMEPTSFQVKEESQFKGGNEEFVNT  60

Query  459  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            KLMTRLTYTLD + G   ++  G+V+F E+DG
Sbjct  61   KLMTRLTYTLDAMSGEIRING-GNVQFIEEDG  91



>gb|ADC54891.1| oxygen-evolving enhancer protein, partial [Ulvella repens]
Length=140

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  300  GTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  476
            G AN C T+ EG  E  A K G Y+  +FC+EPT FTVK ES  K    EF NTKLMTRL
Sbjct  1    GVANTCATLDEGSAEGSALKQGTYALSQFCMEPTKFTVKEESQFKGGVTEFVNTKLMTRL  60

Query  477  TYTLDEIEGPFEVSSDGSVKFEEKDG  554
            TYTLD++ G   V + GS+  +E+DG
Sbjct  61   TYTLDQMSGTMTVGAGGSISLKEEDG  86



>gb|ADC54898.1| oxygen-evolving enhancer protein, partial [Codium sp. HEC 15711]
Length=151

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = +3

Query  276  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  455
            TY ++KG+G AN CPT+  G +  A KPG Y+    C+EPTS  VK ES  K+   +F  
Sbjct  1    TYXQIKGTGLANTCPTLSTGDDAKALKPGSYAVSSMCIEPTSIQVKDESQFKDGVADFVK  60

Query  456  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKD  551
            TKLMTRLTYTLD + G   V   G + FE+ +
Sbjct  61   TKLMTRLTYTLDGLGGKMTVGGSGDISFEKDN  92



>gb|ADC54899.1| oxygen-evolving enhancer protein, partial [Derbesia sp. 2773-1]
Length=142

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = +3

Query  291  KGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMT  470
            KG+G AN CPT+E G +  + K G Y+    C+EPT+F VK ES  ++ P  F +TKLMT
Sbjct  1    KGTGIANTCPTLETGEDGKSLKAGTYTVSGMCIEPTAFQVKEESEFRDQPAAFVDTKLMT  60

Query  471  RLTYTLDEIEGPFEVSSDGSVKF-EEKDG  554
            RLTYTLD + G   V  DGSV F ++ DG
Sbjct  61   RLTYTLDGLGGKMTVGGDGSVDFKKDNDG  89



>gb|ADC54895.1| oxygen-evolving enhancer protein, partial [Bryopsis sp. EE4]
Length=144

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = +3

Query  285  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  464
            + KG+G AN CPT+  G +  + K G Y     C+EPTS TVK ES  K+   EF  TKL
Sbjct  1    QXKGTGVANTCPTLATGGDGSSLKAGSYQVTGMCIEPTSITVKEESQFKDGVSEFVKTKL  60

Query  465  MTRLTYTLDEIEGPFEVSSDGSVKFEEKD  551
            MTRLTYTLD + G   V  DGSV F++ +
Sbjct  61   MTRLTYTLDGLSGKMTVGGDGSVDFKKDN  89



>ref|XP_002894679.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70938.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=91

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 53/91 (58%), Gaps = 32/91 (35%)
 Frame = +3

Query  282  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  461
            MEVKG+GTAN CP                                +SVSKNA PEFQNTK
Sbjct  1    MEVKGTGTANTCP--------------------------------DSVSKNATPEFQNTK  28

Query  462  LMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG  554
            LMTRLTYTL EIEGPFEV  DGSV F+E+DG
Sbjct  29   LMTRLTYTLVEIEGPFEVDLDGSVNFKEEDG  59



>gb|ADE06500.1| oxygen-evolving enhancer [Tragopogon porrifolius]
Length=61

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  63   SYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVP  242
            S Q++ KA GV+P+ AR++CSLQS +K+ AH  +DAAK+AGFALATSAL+VSGA+AEG P
Sbjct  1    SSQSICKAFGVEPATARVSCSLQSDLKDFAHKCTDAAKIAGFALATSALVVSGASAEGSP  60

Query  243  K  245
            K
Sbjct  61   K  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800