BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS125C07

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009776094.1|  PREDICTED: uncharacterized protein LOC104225...    214   6e-60   Nicotiana sylvestris
ref|XP_009776095.1|  PREDICTED: uncharacterized protein LOC104225...    213   7e-60   Nicotiana sylvestris
dbj|BAO49698.1|  nuclear pore complex protein Nup214                    212   2e-59   Nicotiana benthamiana
ref|XP_009617839.1|  PREDICTED: uncharacterized protein LOC104110118    211   3e-59   Nicotiana tomentosiformis
ref|XP_010315686.1|  PREDICTED: uncharacterized protein LOC104645...    196   1e-57   
ref|XP_010315685.1|  PREDICTED: uncharacterized protein LOC104645...    196   2e-57   Solanum lycopersicum
ref|XP_010315684.1|  PREDICTED: uncharacterized protein LOC104645...    196   2e-57   
ref|XP_006363606.1|  PREDICTED: uncharacterized protein LOC102587...    201   2e-55   Solanum tuberosum [potatoes]
ref|XP_006363605.1|  PREDICTED: uncharacterized protein LOC102587...    201   2e-55   Solanum tuberosum [potatoes]
ref|XP_010315773.1|  PREDICTED: uncharacterized protein LOC101268441    200   2e-55   Solanum lycopersicum
ref|XP_011089759.1|  PREDICTED: nuclear pore complex protein NUP214     187   2e-50   Sesamum indicum [beniseed]
gb|EYU32818.1|  hypothetical protein MIMGU_mgv1a000408mg                184   5e-50   Erythranthe guttata [common monkey flower]
ref|XP_010651410.1|  PREDICTED: nuclear pore complex protein NUP214     173   9e-46   Vitis vinifera
emb|CBI16571.3|  unnamed protein product                                172   1e-45   Vitis vinifera
ref|XP_007014649.1|  Nuclear pore complex protein, putative             171   4e-45   
ref|XP_008384349.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear pore...    170   1e-44   
ref|XP_007204938.1|  hypothetical protein PRUPE_ppa000158mg             169   2e-44   
ref|XP_010093141.1|  hypothetical protein L484_005149                   169   2e-44   
ref|XP_010271928.1|  PREDICTED: uncharacterized protein LOC104607870    168   5e-44   Nelumbo nucifera [Indian lotus]
ref|XP_011461637.1|  PREDICTED: nuclear pore complex protein NUP2...    166   3e-43   Fragaria vesca subsp. vesca
ref|XP_008220268.1|  PREDICTED: uncharacterized protein LOC103320338    166   3e-43   Prunus mume [ume]
ref|XP_011461636.1|  PREDICTED: nuclear pore complex protein NUP2...    166   3e-43   Fragaria vesca subsp. vesca
gb|KDP30631.1|  hypothetical protein JCGZ_16196                         165   4e-43   Jatropha curcas
ref|XP_009339216.1|  PREDICTED: uncharacterized protein LOC103931...    165   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_009339213.1|  PREDICTED: uncharacterized protein LOC103931...    165   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_009339215.1|  PREDICTED: uncharacterized protein LOC103931...    165   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_009339212.1|  PREDICTED: uncharacterized protein LOC103931...    165   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_002303977.2|  hypothetical protein POPTR_0003s20760g             163   3e-42   
ref|XP_002523390.1|  nuclear pore complex protein nup153, putative      163   3e-42   
gb|KJB23441.1|  hypothetical protein B456_004G097900                    162   4e-42   Gossypium raimondii
gb|KDO54528.1|  hypothetical protein CISIN_1g000229mg                   162   4e-42   Citrus sinensis [apfelsine]
ref|XP_006445552.1|  hypothetical protein CICLE_v10014017mg             162   5e-42   Citrus clementina [clementine]
gb|KJB23440.1|  hypothetical protein B456_004G097900                    162   6e-42   Gossypium raimondii
gb|KJB23439.1|  hypothetical protein B456_004G097900                    162   7e-42   Gossypium raimondii
gb|KDO54530.1|  hypothetical protein CISIN_1g000229mg                   161   1e-41   Citrus sinensis [apfelsine]
gb|KDO54529.1|  hypothetical protein CISIN_1g000229mg                   161   1e-41   Citrus sinensis [apfelsine]
emb|CDP18570.1|  unnamed protein product                                159   5e-41   Coffea canephora [robusta coffee]
gb|KHG20533.1|  Nuclear pore complex                                    158   1e-40   Gossypium arboreum [tree cotton]
ref|XP_011025102.1|  PREDICTED: nuclear pore complex protein NUP2...    157   3e-40   Populus euphratica
ref|XP_011025101.1|  PREDICTED: nuclear pore complex protein NUP2...    157   3e-40   Populus euphratica
ref|XP_011025103.1|  PREDICTED: nuclear pore complex protein NUP2...    157   3e-40   Populus euphratica
ref|XP_011025104.1|  PREDICTED: nuclear pore complex protein NUP2...    157   5e-40   Populus euphratica
ref|XP_011025100.1|  PREDICTED: nuclear pore complex protein NUP2...    156   6e-40   Populus euphratica
ref|XP_011025099.1|  PREDICTED: nuclear pore complex protein NUP2...    156   6e-40   Populus euphratica
ref|XP_004172846.1|  PREDICTED: uncharacterized protein LOC101226494    155   8e-40   
ref|XP_008445928.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    154   4e-39   
ref|XP_004147125.1|  PREDICTED: uncharacterized protein LOC101219502    152   1e-38   
gb|KGN51596.1|  hypothetical protein Csa_5G583270                       150   5e-38   
ref|XP_007143523.1|  hypothetical protein PHAVU_007G078700g             148   4e-37   Phaseolus vulgaris [French bean]
ref|XP_010552295.1|  PREDICTED: uncharacterized protein LOC104822...    144   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_010552294.1|  PREDICTED: nuclear pore complex protein Nup2...    144   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_010552297.1|  PREDICTED: uncharacterized protein LOC104822...    144   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_010552296.1|  PREDICTED: uncharacterized protein LOC104822...    144   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_003526034.1|  PREDICTED: uncharacterized protein LOC100806517    142   3e-35   
ref|XP_006601898.1|  PREDICTED: uncharacterized protein LOC100794048    142   4e-35   Glycine max [soybeans]
ref|XP_002297612.2|  proline-rich family protein                        139   5e-35   
ref|XP_006392626.1|  hypothetical protein EUTSA_v10011181mg             137   2e-33   Eutrema salsugineum [saltwater cress]
gb|KCW52322.1|  hypothetical protein EUGRSUZ_J01744                     137   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010034531.1|  PREDICTED: uncharacterized protein LOC104423777    137   4e-33   
gb|KCW52323.1|  hypothetical protein EUGRSUZ_J01744                     136   5e-33   Eucalyptus grandis [rose gum]
ref|XP_002894510.1|  hypothetical protein ARALYDRAFT_337635             134   3e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_004495016.1|  PREDICTED: serine-rich adhesin for platelets...    134   4e-32   Cicer arietinum [garbanzo]
gb|KEH42389.1|  hypothetical protein MTR_1g069005                       134   4e-32   Medicago truncatula
ref|XP_010675795.1|  PREDICTED: nuclear pore complex protein NUP214     134   4e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010480089.1|  PREDICTED: uncharacterized protein LOC104758...    133   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010480090.1|  PREDICTED: uncharacterized protein LOC104758...    133   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004495017.1|  PREDICTED: serine-rich adhesin for platelets...    132   8e-32   
ref|NP_001117499.2|  nuclear pore complex protein LNO1                  132   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564694.2|  nuclear pore complex protein LNO1                     132   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAD10642.1|  Hypothetical protein                                    132   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106865.1|  PREDICTED: nuclear pore complex protein Nup2...    130   7e-31   Brassica rapa
ref|XP_009106863.1|  PREDICTED: nuclear pore complex protein Nup2...    130   7e-31   Brassica rapa
ref|XP_010501169.1|  PREDICTED: uncharacterized protein LOC104778...    129   1e-30   
emb|CDY56018.1|  BnaA08g29260D                                          129   2e-30   Brassica napus [oilseed rape]
emb|CDY10551.1|  BnaC03g70630D                                          128   4e-30   Brassica napus [oilseed rape]
ref|XP_006306239.1|  hypothetical protein CARUB_v10012062mg             123   2e-28   Capsella rubella
gb|KFK35577.1|  hypothetical protein AALP_AA4G008800                    120   3e-27   Arabis alpina [alpine rockcress]
ref|XP_008793329.1|  PREDICTED: nuclear pore complex protein Nup2...    118   7e-27   
ref|XP_008793328.1|  PREDICTED: uncharacterized protein LOC103709...    118   1e-26   
ref|XP_008793327.1|  PREDICTED: uncharacterized protein LOC103709...    118   1e-26   Phoenix dactylifera
gb|EPS63585.1|  hypothetical protein M569_11196                         109   1e-25   Genlisea aurea
ref|XP_010938158.1|  PREDICTED: nuclear pore complex protein NUP214     112   8e-25   Elaeis guineensis
ref|XP_010233776.1|  PREDICTED: nuclear pore complex protein Nup214     112   9e-25   Brachypodium distachyon [annual false brome]
ref|XP_009400147.1|  PREDICTED: uncharacterized protein LOC103984394    108   2e-23   
tpg|DAA64173.1|  TPA: hypothetical protein ZEAMMB73_624267              107   4e-23   
gb|KHN43779.1|  hypothetical protein glysoja_045839                     102   2e-21   Glycine soja [wild soybean]
gb|EMS44986.1|  hypothetical protein TRIUR3_16071                       101   5e-21   Triticum urartu
ref|XP_004958728.1|  PREDICTED: uncharacterized protein LOC101760483    101   7e-21   Setaria italica
gb|EMT14894.1|  Myb family transcription factor APL                     101   8e-21   
ref|XP_002468265.1|  hypothetical protein SORBIDRAFT_01g042703        95.5    1e-20   
gb|EEC82708.1|  hypothetical protein OsI_27378                        97.8    1e-19   Oryza sativa Indica Group [Indian rice]
gb|EEE67839.1|  hypothetical protein OsJ_25626                        97.8    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008680826.1|  PREDICTED: uncharacterized protein LOC103655932  85.1    2e-17   Zea mays [maize]
ref|XP_006829815.1|  hypothetical protein AMTR_s00119p00078800        90.5    3e-17   
gb|AFW65695.1|  hypothetical protein ZEAMMB73_930105                  85.9    4e-16   
ref|XP_006658149.1|  PREDICTED: nuclear pore complex protein Nup2...  82.4    1e-14   
tpg|DAA55075.1|  TPA: hypothetical protein ZEAMMB73_147712            73.6    4e-12   
tpg|DAA55074.1|  TPA: hypothetical protein ZEAMMB73_147712            73.2    9e-12   



>ref|XP_009776094.1| PREDICTED: uncharacterized protein LOC104225914 isoform X1 [Nicotiana 
sylvestris]
Length=1704

 Score =   214 bits (544),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            P K    R+T E IPSKQFR VEEMARKLD LLEGIEGEGGF +ASI + ++SV+ LE+G
Sbjct  669  PLKPHLTRETCEGIPSKQFRDVEEMARKLDSLLEGIEGEGGFRDASINAHRSSVLALEEG  728

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WRG+MDE+ GEIQLLLDKTV+VLA+KVYMEGI KQATD RY DLW+RQKL
Sbjct  729  IESVSEKCRIWRGVMDEQLGEIQLLLDKTVQVLARKVYMEGIFKQATDERYWDLWNRQKL  788

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            SSEL+LK++HI+++NK LT+QLIELERHFN LELN FG + G+  ++
Sbjct  789  SSELELKRQHIKEVNKSLTSQLIELERHFNTLELNKFGDTSGIKTSK  835



>ref|XP_009776095.1| PREDICTED: uncharacterized protein LOC104225914 isoform X2 [Nicotiana 
sylvestris]
Length=1677

 Score =   213 bits (543),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            P K    R+T E IPSKQFR VEEMARKLD LLEGIEGEGGF +ASI + ++SV+ LE+G
Sbjct  642  PLKPHLTRETCEGIPSKQFRDVEEMARKLDSLLEGIEGEGGFRDASINAHRSSVLALEEG  701

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WRG+MDE+ GEIQLLLDKTV+VLA+KVYMEGI KQATD RY DLW+RQKL
Sbjct  702  IESVSEKCRIWRGVMDEQLGEIQLLLDKTVQVLARKVYMEGIFKQATDERYWDLWNRQKL  761

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            SSEL+LK++HI+++NK LT+QLIELERHFN LELN FG + G+  ++
Sbjct  762  SSELELKRQHIKEVNKSLTSQLIELERHFNTLELNKFGDTSGIKTSK  808



>dbj|BAO49698.1| nuclear pore complex protein Nup214 [Nicotiana benthamiana]
Length=1744

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 143/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            P K    R+T E IPSKQFR VEEMA KLD LLEGIEGEGGF +ASI++ ++SV+ LE+G
Sbjct  689  PLKPHLTRETCEGIPSKQFRDVEEMAMKLDSLLEGIEGEGGFRDASISAHRSSVLALEEG  748

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WRG+MDE+ GEIQLLLDKTV+VLA+KVYMEGI KQATD RY DLW+RQKL
Sbjct  749  IESVSEKCRIWRGVMDEQLGEIQLLLDKTVQVLARKVYMEGIFKQATDERYWDLWNRQKL  808

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            SSEL+LK++HI+++NK LT+QLIELERHFN LELN FG + G+  ++
Sbjct  809  SSELELKRQHIKEVNKSLTSQLIELERHFNTLELNKFGDTSGIQTSK  855



>ref|XP_009617839.1| PREDICTED: uncharacterized protein LOC104110118 [Nicotiana tomentosiformis]
Length=1726

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            P K +  R+T E IPSKQFR VEEMARKLD LLEGIEGEGGF +ASI + ++SV+ LE+G
Sbjct  668  PLKPRLTRETCEGIPSKQFRDVEEMARKLDSLLEGIEGEGGFRDASIRAHRSSVLALEEG  727

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WRG+MDE+ GEIQLLLDKTV+VLA+KVYMEGI KQATD RY DLW+RQKL
Sbjct  728  IESVSEKCRIWRGVMDEQLGEIQLLLDKTVQVLARKVYMEGIFKQATDERYWDLWNRQKL  787

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            +SEL+LK++HI+++NK LT+QLIELERHFN LELN FG + G+  ++
Sbjct  788  NSELELKRQHIKEVNKSLTSQLIELERHFNTLELNKFGDTSGIQTSK  834



>ref|XP_010315686.1| PREDICTED: uncharacterized protein LOC104645555 isoform X3 [Solanum 
lycopersicum]
Length=349

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            PSKL   R+TSE  P KQF  VEEMARKLDDLLEGIEGEGGF +ASI +  +SV+ LE+G
Sbjct  28   PSKLHFTRETSEGTPLKQFHDVEEMARKLDDLLEGIEGEGGFRDASIRAHNSSVLALEEG  87

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WR +MD++ GE+QLLLDKTV+VLA+KVYME I KQATD +Y +LW+RQKL
Sbjct  88   IESVSEKCRIWRAVMDKQLGEVQLLLDKTVQVLARKVYMEEIFKQATDEQYWNLWNRQKL  147

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             SEL+LK++H+ ++NK LT+QLIELERHFN LELN FG +D +  N+
Sbjct  148  CSELELKRQHVNEVNKSLTSQLIELERHFNTLELNKFGDTDRIQTNK  194



>ref|XP_010315685.1| PREDICTED: uncharacterized protein LOC104645555 isoform X2 [Solanum 
lycopersicum]
Length=362

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            PSKL   R+TSE  P KQF  VEEMARKLDDLLEGIEGEGGF +ASI +  +SV+ LE+G
Sbjct  28   PSKLHFTRETSEGTPLKQFHDVEEMARKLDDLLEGIEGEGGFRDASIRAHNSSVLALEEG  87

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WR +MD++ GE+QLLLDKTV+VLA+KVYME I KQATD +Y +LW+RQKL
Sbjct  88   IESVSEKCRIWRAVMDKQLGEVQLLLDKTVQVLARKVYMEEIFKQATDEQYWNLWNRQKL  147

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             SEL+LK++H+ ++NK LT+QLIELERHFN LELN FG +D +  N+
Sbjct  148  CSELELKRQHVNEVNKSLTSQLIELERHFNTLELNKFGDTDRIQTNK  194



>ref|XP_010315684.1| PREDICTED: uncharacterized protein LOC104645555 isoform X1 [Solanum 
lycopersicum]
Length=367

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 139/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            PSKL   R+TSE  P KQF  VEEMARKLDDLLEGIEGEGGF +ASI +  +SV+ LE+G
Sbjct  28   PSKLHFTRETSEGTPLKQFHDVEEMARKLDDLLEGIEGEGGFRDASIRAHNSSVLALEEG  87

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WR +MD++ GE+QLLLDKTV+VLA+KVYME I KQATD +Y +LW+RQKL
Sbjct  88   IESVSEKCRIWRAVMDKQLGEVQLLLDKTVQVLARKVYMEEIFKQATDEQYWNLWNRQKL  147

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             SEL+LK++H+ ++NK LT+QLIELERHFN LELN FG +D +  N+
Sbjct  148  CSELELKRQHVNEVNKSLTSQLIELERHFNTLELNKFGDTDRIQTNK  194



>ref|XP_006363606.1| PREDICTED: uncharacterized protein LOC102587240 isoform X2 [Solanum 
tuberosum]
Length=1658

 Score =   201 bits (511),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            P KL   R+TSE  P KQF  VEEMARKLD LLEGIEGEGGF +ASI +  +SV+ LE+G
Sbjct  643  PPKLHFTRETSEGTPLKQFHDVEEMARKLDGLLEGIEGEGGFRDASIRAHSSSVLALEEG  702

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WR +MD++ GE+QLLLDKTV+VLA+KVYME I KQATD RY +LW+RQKL
Sbjct  703  IESVSEKCRIWRAVMDKQLGEVQLLLDKTVQVLARKVYMEEIFKQATDERYCNLWNRQKL  762

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             SEL+LK++H+ ++NK LT+QLIELERHFN LELN FG +DG+  ++
Sbjct  763  CSELELKRQHVNEVNKSLTSQLIELERHFNTLELNKFGDTDGIQTSK  809



>ref|XP_006363605.1| PREDICTED: uncharacterized protein LOC102587240 isoform X1 [Solanum 
tuberosum]
Length=1685

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            P KL   R+TSE  P KQF  VEEMARKLD LLEGIEGEGGF +ASI +  +SV+ LE+G
Sbjct  670  PPKLHFTRETSEGTPLKQFHDVEEMARKLDGLLEGIEGEGGFRDASIRAHSSSVLALEEG  729

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WR +MD++ GE+QLLLDKTV+VLA+KVYME I KQATD RY +LW+RQKL
Sbjct  730  IESVSEKCRIWRAVMDKQLGEVQLLLDKTVQVLARKVYMEEIFKQATDERYCNLWNRQKL  789

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             SEL+LK++H+ ++NK LT+QLIELERHFN LELN FG +DG+  ++
Sbjct  790  CSELELKRQHVNEVNKSLTSQLIELERHFNTLELNKFGDTDGIQTSK  836



>ref|XP_010315773.1| PREDICTED: uncharacterized protein LOC101268441 [Solanum lycopersicum]
Length=1610

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            PSKL   R+TSE  P KQF  VEEMARKLDDLLEGIEGEGGF +ASI +Q +SV+ LE+G
Sbjct  582  PSKLHFTRETSEGTPLKQFHDVEEMARKLDDLLEGIEGEGGFRDASIRAQSSSVLALEEG  641

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I+++S++CR+WR +MD++ GE+QLLLDKTV+VLA+KVYME I KQATD RY +LW+RQKL
Sbjct  642  IESVSEKCRIWRAVMDKQLGEVQLLLDKTVQVLARKVYMEEIFKQATDERYWNLWNRQKL  701

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             SEL+LK++H+ ++NK LT+QLIELERHFN LELN FG +D +  N+
Sbjct  702  CSELELKRQHVNEVNKSLTSQLIELERHFNTLELNKFGDTDRIQTNK  748



>ref|XP_011089759.1| PREDICTED: nuclear pore complex protein NUP214 [Sesamum indicum]
Length=1758

 Score =   187 bits (474),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF +VEEMARKLD LLEGIEG+GGF +ASI SQ +SV+ LE  I ALSDRCR WRG+M
Sbjct  727  SKQFGNVEEMARKLDKLLEGIEGKGGFRDASITSQTHSVVELEDCIWALSDRCRTWRGLM  786

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DER  E+QLLLDKT++VL +KVYMEGI KQATDSRY +LW+RQKLSSE++LK+  I ++N
Sbjct  787  DERSKEVQLLLDKTIQVLVRKVYMEGIFKQATDSRYWELWNRQKLSSEMELKRRRILELN  846

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + LT +LIELERHFN LE N FG   GM  NR
Sbjct  847  QELTTKLIELERHFNSLEFNKFGEDGGMPRNR  878



>gb|EYU32818.1| hypothetical protein MIMGU_mgv1a000408mg [Erythranthe guttata]
Length=1176

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF +VEEMA+KLD+LLEGI G+GGF  ASI SQ NSV  LE GI ALSDRCR+W+G++
Sbjct  210  SKQFGNVEEMAKKLDNLLEGIVGKGGFREASITSQANSVKELEDGIWALSDRCRVWKGLV  269

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            +E+  E+QLLLDKTV+VL +KVY+EGI KQATDSRY +LW+RQKLSSEL+LK+  I ++N
Sbjct  270  NEQSREVQLLLDKTVQVLVRKVYVEGIFKQATDSRYWELWNRQKLSSELELKRRRILELN  329

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + LTN+LIELERHFN LE N FG ++G   NR
Sbjct  330  QELTNKLIELERHFNSLEFNKFGENEGAQRNR  361



>ref|XP_010651410.1| PREDICTED: nuclear pore complex protein NUP214 [Vitis vinifera]
Length=1756

 Score =   173 bits (438),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  93   SERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRL  272
            SE   SKQF +V+EMA++LD LL+ IEG GGF +A    QK+SV+ LE+GI  LS+ CR+
Sbjct  745  SEPNLSKQFGNVKEMAKELDTLLQCIEGPGGFRDACTIFQKSSVMELEQGIGTLSENCRM  804

Query  273  WRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEH  452
            WR I+D++ GEI  LLDKTV+VLA+KVYM+GI+KQATDSRY DLWSRQKL+SEL+LK+ +
Sbjct  805  WRSIIDQQHGEIHHLLDKTVQVLARKVYMQGIVKQATDSRYWDLWSRQKLASELELKRRN  864

Query  453  IRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            I  +N+ LTNQLIELERHFN +ELN FG + G  + R
Sbjct  865  ILKINQDLTNQLIELERHFNAIELNKFGENGGNHVGR  901



>emb|CBI16571.3| unnamed protein product [Vitis vinifera]
Length=1685

 Score =   172 bits (437),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  93   SERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRL  272
            SE   SKQF +V+EMA++LD LL+ IEG GGF +A    QK+SV+ LE+GI  LS+ CR+
Sbjct  745  SEPNLSKQFGNVKEMAKELDTLLQCIEGPGGFRDACTIFQKSSVMELEQGIGTLSENCRM  804

Query  273  WRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEH  452
            WR I+D++ GEI  LLDKTV+VLA+KVYM+GI+KQATDSRY DLWSRQKL+SEL+LK+ +
Sbjct  805  WRSIIDQQHGEIHHLLDKTVQVLARKVYMQGIVKQATDSRYWDLWSRQKLASELELKRRN  864

Query  453  IRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            I  +N+ LTNQLIELERHFN +ELN FG + G  + R
Sbjct  865  ILKINQDLTNQLIELERHFNAIELNKFGENGGNHVGR  901



>ref|XP_007014649.1| Nuclear pore complex protein, putative [Theobroma cacao]
 gb|EOY32268.1| Nuclear pore complex protein, putative [Theobroma cacao]
Length=1866

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = +3

Query  66   SKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGI  245
            S  Q    TSE   SKQF ++ EMA +LD LLE IE  GGF +A    QK+SV  LE+GI
Sbjct  784  SSTQSGMRTSEPHLSKQFSNIREMAEELDTLLESIEETGGFRDACTVYQKSSVEALERGI  843

Query  246  QALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLS  425
              LSD+CR W  +MDE  G+IQ LLDKTV+VLA+K+YMEGI+KQA+DS+Y DLW+RQKLS
Sbjct  844  AFLSDKCRRWENMMDEHLGKIQHLLDKTVQVLARKIYMEGIVKQASDSQYWDLWNRQKLS  903

Query  426  SELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGM  551
            SEL+LK+ HI  +N+ LTN+LIELERHFN  EL+ FG ++G+
Sbjct  904  SELELKRRHILKLNRDLTNELIELERHFNTFELHKFGDNNGV  945



>ref|XP_008384349.1| PREDICTED: LOW QUALITY PROTEIN: nuclear pore complex protein 
Nup214 [Malus domestica]
Length=1796

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF +++EM ++LD LL+ IEG GGF +A   +QK SV  LE+GI+ LSDRCRLW+ IM
Sbjct  772  SKQFGNIKEMTKELDMLLQSIEGAGGFRDACTVNQKGSVEELERGIETLSDRCRLWKSIM  831

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DER  EIQ LLD TV+VLA+K+YMEGI+KQA+D RY D W+ QKLSSEL+LK+ HI  MN
Sbjct  832  DERLREIQHLLDTTVQVLARKIYMEGIVKQASDRRYWDFWNCQKLSSELELKRRHILKMN  891

Query  468  KVLTNQLIELERHFNILELNTFGGSDG  548
            + LT+QLI+LERHFN LELN FG + G
Sbjct  892  QDLTDQLIQLERHFNGLELNKFGENAG  918



>ref|XP_007204938.1| hypothetical protein PRUPE_ppa000158mg [Prunus persica]
 gb|EMJ06137.1| hypothetical protein PRUPE_ppa000158mg [Prunus persica]
Length=1588

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = +3

Query  66   SKLQPARD-TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            S L P+R   SE   SKQF +++EM ++LD LL+ IE  GGF +A   +QK SV  LE+G
Sbjct  717  SDLPPSRRLNSEPNSSKQFGNIKEMTKELDMLLQSIEEPGGFRDACTVNQKRSVEELERG  776

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I  LSDRCR W+ IMDER  EI+ LLD TV+VLA+K+YMEGI+KQA+DSRY D W+ QKL
Sbjct  777  IGTLSDRCRKWKSIMDERLQEIEHLLDITVQVLARKIYMEGIVKQASDSRYWDFWNCQKL  836

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            SSEL+LK+ HI  MN+ LT+QLI+LERHFN LELN FG + G    R
Sbjct  837  SSELELKRRHILKMNQDLTDQLIQLERHFNALELNKFGENAGGHAGR  883



>ref|XP_010093141.1| hypothetical protein L484_005149 [Morus notabilis]
 gb|EXB53600.1| hypothetical protein L484_005149 [Morus notabilis]
Length=1634

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +3

Query  93   SERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRL  272
            SE + SKQF ++++M ++LD LL+ IE  GGF +A   SQK SV  LE+GI  LSD+ R 
Sbjct  571  SEPVLSKQFGNIKDMTKELDTLLQSIEQPGGFRDACTVSQKRSVEALEQGIGILSDKRRK  630

Query  273  WRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEH  452
            W+ IMD+R GE++ LLDKTV+VLA+K+YMEGI+KQA+D RY DLW+RQKLSS+L+LKQ H
Sbjct  631  WKSIMDDRIGEVRNLLDKTVQVLARKIYMEGIVKQASDDRYWDLWNRQKLSSKLELKQRH  690

Query  453  IRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            I  +N+ LTNQLIELERHFN +ELN FG + G    +
Sbjct  691  ILKLNEGLTNQLIELERHFNSIELNKFGENGGAHAGK  727



>ref|XP_010271928.1| PREDICTED: uncharacterized protein LOC104607870 [Nelumbo nucifera]
Length=1861

 Score =   168 bits (425),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 91/148 (61%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SK F SV+EM ++LD LL  IE +GGF +A   SQK+S+++LE+GI  LSDRCR+WR  +
Sbjct  833  SKHFGSVKEMVKELDTLLSHIEEDGGFRDACTISQKDSIMSLEEGIDNLSDRCRVWRNTL  892

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DE+  E+Q LLDKT +VL +KVY+EGI+KQA+DS+Y DLW+RQKLS ELDLK+  I ++N
Sbjct  893  DEQLNEVQQLLDKTAQVLVRKVYIEGIVKQASDSQYWDLWNRQKLSPELDLKRRQILEVN  952

Query  468  KVLTNQLIELERHFNILELNTFGGSDGM  551
            K LT+QLIELERHFN LELN FG   G+
Sbjct  953  KNLTSQLIELERHFNNLELNKFGEDGGV  980



>ref|XP_011461637.1| PREDICTED: nuclear pore complex protein NUP214 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1514

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  66   SKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGI  245
            S+L  +R  SE   SK+F +++EM ++LD  L+ I   GGF +A I +QK+SV  LE+ +
Sbjct  485  SELSQSRLNSEPSLSKKFGNMKEMTKELDMFLQSIVEPGGFRDACIVNQKSSVEELEREV  544

Query  246  QALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLS  425
              LS+RCR+W+  MDER  E++ L D TV+VLA+K+YMEGI+KQA+DSRY D WS QKLS
Sbjct  545  GILSERCRMWKSTMDERLNEVEHLFDMTVQVLARKIYMEGIVKQASDSRYWDFWSCQKLS  604

Query  426  SELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            SEL+LK+ HI  MN+ LT+QLI+LERHFN LELN FG  DG    R
Sbjct  605  SELELKRRHISKMNQDLTDQLIKLERHFNGLELNKFGEDDGARAGR  650



>ref|XP_008220268.1| PREDICTED: uncharacterized protein LOC103320338 [Prunus mume]
Length=1788

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = +3

Query  66   SKLQPARD-TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            S L P+R   SE   SKQF +++EM ++LD LL+ IE  GGF +A   +Q  SV  LE+G
Sbjct  757  SDLAPSRRLNSEPNLSKQFGNIKEMTKELDMLLQSIEEPGGFRDACTVNQIGSVEELERG  816

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            I  LSDRCR W+ IMDER  EI+ LLD TV+VLA+K+YMEGI+KQA+DSRY D W+ QKL
Sbjct  817  IGTLSDRCRKWKSIMDERLQEIEHLLDITVQVLARKIYMEGIVKQASDSRYWDFWNCQKL  876

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            SSEL+LK+ HI  MN+ LT+QLI+LERHFN LELN FG + G    R
Sbjct  877  SSELELKRRHILKMNQDLTDQLIQLERHFNGLELNKFGENAGAHAGR  923



>ref|XP_011461636.1| PREDICTED: nuclear pore complex protein NUP214 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1739

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 121/166 (73%), Gaps = 0/166 (0%)
 Frame = +3

Query  66   SKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGI  245
            S+L  +R  SE   SK+F +++EM ++LD  L+ I   GGF +A I +QK+SV  LE+ +
Sbjct  710  SELSQSRLNSEPSLSKKFGNMKEMTKELDMFLQSIVEPGGFRDACIVNQKSSVEELEREV  769

Query  246  QALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLS  425
              LS+RCR+W+  MDER  E++ L D TV+VLA+K+YMEGI+KQA+DSRY D WS QKLS
Sbjct  770  GILSERCRMWKSTMDERLNEVEHLFDMTVQVLARKIYMEGIVKQASDSRYWDFWSCQKLS  829

Query  426  SELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            SEL+LK+ HI  MN+ LT+QLI+LERHFN LELN FG  DG    R
Sbjct  830  SELELKRRHISKMNQDLTDQLIKLERHFNGLELNKFGEDDGARAGR  875



>gb|KDP30631.1| hypothetical protein JCGZ_16196 [Jatropha curcas]
Length=1353

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            S+QF +++EMA++LD LLE IEG GGF +A++ S K+SV  LE+ +Q LS +CR+W+ +M
Sbjct  270  SRQFGNIKEMAKELDILLECIEGPGGFQDATL-SHKHSVEALEERMQTLSKKCRMWKNMM  328

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            D++ GEI+ LLDKTV+VLA+K+YMEGI+KQA+DS Y +LW+RQKLSSEL+LK+ HI  +N
Sbjct  329  DDQLGEIEHLLDKTVQVLARKIYMEGIVKQASDSCYWELWNRQKLSSELELKRRHILKLN  388

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            +VLTNQLIELERHFN LEL+ FG + G+   R
Sbjct  389  QVLTNQLIELERHFNNLELHKFGENGGVLTGR  420



>ref|XP_009339216.1| PREDICTED: uncharacterized protein LOC103931454 isoform X4 [Pyrus 
x bretschneideri]
Length=1744

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF +++EM ++LD LL+ IEG GGF +A   +QK SV  LE+ I+ LSD+CRLW+ IM
Sbjct  754  SKQFGNIKEMTKELDMLLQSIEGAGGFRDACTVNQKGSVEELERDIETLSDKCRLWKSIM  813

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DER  EIQ LLD TV+VLA+K+YMEGI+KQA+D RY D W+ QKLSSEL+LK+ HI  MN
Sbjct  814  DERLREIQHLLDTTVQVLARKIYMEGIVKQASDRRYWDFWNCQKLSSELELKRRHILKMN  873

Query  468  KVLTNQLIELERHFNILELNTFG  536
            + LT+QLI+LERHFN LELN FG
Sbjct  874  QDLTDQLIQLERHFNGLELNKFG  896



>ref|XP_009339213.1| PREDICTED: uncharacterized protein LOC103931454 isoform X2 [Pyrus 
x bretschneideri]
Length=1773

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF +++EM ++LD LL+ IEG GGF +A   +QK SV  LE+ I+ LSD+CRLW+ IM
Sbjct  754  SKQFGNIKEMTKELDMLLQSIEGAGGFRDACTVNQKGSVEELERDIETLSDKCRLWKSIM  813

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DER  EIQ LLD TV+VLA+K+YMEGI+KQA+D RY D W+ QKLSSEL+LK+ HI  MN
Sbjct  814  DERLREIQHLLDTTVQVLARKIYMEGIVKQASDRRYWDFWNCQKLSSELELKRRHILKMN  873

Query  468  KVLTNQLIELERHFNILELNTFG  536
            + LT+QLI+LERHFN LELN FG
Sbjct  874  QDLTDQLIQLERHFNGLELNKFG  896



>ref|XP_009339215.1| PREDICTED: uncharacterized protein LOC103931454 isoform X3 [Pyrus 
x bretschneideri]
Length=1773

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF +++EM ++LD LL+ IEG GGF +A   +QK SV  LE+ I+ LSD+CRLW+ IM
Sbjct  754  SKQFGNIKEMTKELDMLLQSIEGAGGFRDACTVNQKGSVEELERDIETLSDKCRLWKSIM  813

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DER  EIQ LLD TV+VLA+K+YMEGI+KQA+D RY D W+ QKLSSEL+LK+ HI  MN
Sbjct  814  DERLREIQHLLDTTVQVLARKIYMEGIVKQASDRRYWDFWNCQKLSSELELKRRHILKMN  873

Query  468  KVLTNQLIELERHFNILELNTFG  536
            + LT+QLI+LERHFN LELN FG
Sbjct  874  QDLTDQLIQLERHFNGLELNKFG  896



>ref|XP_009339212.1| PREDICTED: uncharacterized protein LOC103931454 isoform X1 [Pyrus 
x bretschneideri]
Length=1774

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF +++EM ++LD LL+ IEG GGF +A   +QK SV  LE+ I+ LSD+CRLW+ IM
Sbjct  754  SKQFGNIKEMTKELDMLLQSIEGAGGFRDACTVNQKGSVEELERDIETLSDKCRLWKSIM  813

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DER  EIQ LLD TV+VLA+K+YMEGI+KQA+D RY D W+ QKLSSEL+LK+ HI  MN
Sbjct  814  DERLREIQHLLDTTVQVLARKIYMEGIVKQASDRRYWDFWNCQKLSSELELKRRHILKMN  873

Query  468  KVLTNQLIELERHFNILELNTFG  536
            + LT+QLI+LERHFN LELN FG
Sbjct  874  QDLTDQLIQLERHFNGLELNKFG  896



>ref|XP_002303977.2| hypothetical protein POPTR_0003s20760g [Populus trichocarpa]
 gb|EEE78956.2| hypothetical protein POPTR_0003s20760g [Populus trichocarpa]
Length=1785

 Score =   163 bits (413),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 90/158 (57%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  90   TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCR  269
            +SE   SKQF +++E+A++LD LLE IE +GGF +A     + SV  LE+G+  LS+ CR
Sbjct  678  SSEPNLSKQFGNIKELAKELDTLLECIEEKGGFRDACTVFLRGSVEALEEGMGTLSENCR  737

Query  270  LWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
            +W+ +MDER GEI  LLDKTV+VLA+K+Y++GI+KQA+DS+YL+LW+RQKLSSEL+LK+ 
Sbjct  738  MWKSVMDERLGEIHHLLDKTVQVLARKIYVDGIVKQASDSQYLELWNRQKLSSELELKRR  797

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             I  +N+ LTNQLI+LERHFN LEL +FGG+ G   +R
Sbjct  798  CILKLNQELTNQLIQLERHFNTLELQSFGGNAGFHTDR  835



>ref|XP_002523390.1| nuclear pore complex protein nup153, putative [Ricinus communis]
 gb|EEF38969.1| nuclear pore complex protein nup153, putative [Ricinus communis]
Length=1824

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   PARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALS  257
            P+   SE   S+QF +++EMA++LD LLE IE  GGF +A   SQ+ SV  LE+ +Q LS
Sbjct  738  PSLSKSEPYLSRQFGNIKEMAKELDSLLECIEEPGGFKDACTISQRGSVEALEERMQTLS  797

Query  258  DRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELD  437
            ++C  W+ +MDE+ GE+Q LLDKTV+VLA+K+YM+GI+KQA+DSRY +LW+RQKL SE +
Sbjct  798  EKCITWKSMMDEQLGEVQHLLDKTVQVLARKIYMDGIVKQASDSRYWELWNRQKLGSEFE  857

Query  438  LKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            LK+ HI  +N+VLTNQLI+LERHFN LEL+ F  + G+   R
Sbjct  858  LKRRHILKLNQVLTNQLIDLERHFNTLELHKFDENGGVPKGR  899



>gb|KJB23441.1| hypothetical protein B456_004G097900 [Gossypium raimondii]
Length=1634

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  111  KQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIMD  290
            KQF +++EMA++LD LLE IE  GGF +     Q++SV  LE+GI  LS +CR W+ +MD
Sbjct  589  KQFGNIKEMAKELDTLLESIEEAGGFRDVCTVFQRSSVEELEQGIAVLSKKCRSWKNVMD  648

Query  291  ERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNK  470
            E+ G+IQ  LDKTV+VLA+K+Y+EGI+KQA+DS+Y DLW+ QKLSSEL+LKQ HI  +N+
Sbjct  649  EQLGKIQQHLDKTVQVLARKIYIEGIIKQASDSQYWDLWNCQKLSSELELKQRHILKLNQ  708

Query  471  VLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             LTNQLIELERHFN  EL+ FG  DG+   R
Sbjct  709  DLTNQLIELERHFNTSELHKFGDDDGVRDGR  739



>gb|KDO54528.1| hypothetical protein CISIN_1g000229mg [Citrus sinensis]
Length=1726

 Score =   162 bits (411),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 11/172 (6%)
 Frame = +3

Query  69   KLQPARD-----------TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQK  215
            KL P++D            SE   SKQ  +++EM ++LD LL+ IE  GGF +A    Q+
Sbjct  727  KLYPSKDDYKTATLSGLPNSEPNLSKQSGNIKEMTKELDMLLQSIEETGGFRDACTVFQR  786

Query  216  NSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRY  395
              V  LE+GI +LS++C +WR IMDER  EIQ L DKTV+VLA+K+Y EGI+KQA+DSRY
Sbjct  787  QKVEELEEGIGSLSEKCGMWRSIMDERLQEIQNLFDKTVQVLARKIYTEGIVKQASDSRY  846

Query  396  LDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGM  551
             DLW+RQKLS EL+LK+ HI  +N+ L NQLIELERHFN LELN FG +DG+
Sbjct  847  WDLWNRQKLSPELELKRGHILSINQDLINQLIELERHFNSLELNKFGENDGV  898



>ref|XP_006445552.1| hypothetical protein CICLE_v10014017mg [Citrus clementina]
 ref|XP_006488963.1| PREDICTED: uncharacterized protein LOC102629053 [Citrus sinensis]
 gb|ESR58792.1| hypothetical protein CICLE_v10014017mg [Citrus clementina]
 gb|KDO54527.1| hypothetical protein CISIN_1g000229mg [Citrus sinensis]
Length=1824

 Score =   162 bits (410),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 11/172 (6%)
 Frame = +3

Query  69   KLQPARD-----------TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQK  215
            KL P++D            SE   SKQ  +++EM ++LD LL+ IE  GGF +A    Q+
Sbjct  727  KLYPSKDDYKTATLSGLPNSEPNLSKQSGNIKEMTKELDMLLQSIEETGGFRDACTVFQR  786

Query  216  NSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRY  395
              V  LE+GI +LS++C +WR IMDER  EIQ L DKTV+VLA+K+Y EGI+KQA+DSRY
Sbjct  787  QKVEELEEGIGSLSEKCGMWRSIMDERLQEIQNLFDKTVQVLARKIYTEGIVKQASDSRY  846

Query  396  LDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGM  551
             DLW+RQKLS EL+LK+ HI  +N+ L NQLIELERHFN LELN FG +DG+
Sbjct  847  WDLWNRQKLSPELELKRGHILSINQDLINQLIELERHFNSLELNKFGENDGV  898



>gb|KJB23440.1| hypothetical protein B456_004G097900 [Gossypium raimondii]
Length=1821

 Score =   162 bits (410),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  111  KQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIMD  290
            KQF +++EMA++LD LLE IE  GGF +     Q++SV  LE+GI  LS +CR W+ +MD
Sbjct  776  KQFGNIKEMAKELDTLLESIEEAGGFRDVCTVFQRSSVEELEQGIAVLSKKCRSWKNVMD  835

Query  291  ERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNK  470
            E+ G+IQ  LDKTV+VLA+K+Y+EGI+KQA+DS+Y DLW+ QKLSSEL+LKQ HI  +N+
Sbjct  836  EQLGKIQQHLDKTVQVLARKIYIEGIIKQASDSQYWDLWNCQKLSSELELKQRHILKLNQ  895

Query  471  VLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             LTNQLIELERHFN  EL+ FG  DG+   R
Sbjct  896  DLTNQLIELERHFNTSELHKFGDDDGVRDGR  926



>gb|KJB23439.1| hypothetical protein B456_004G097900 [Gossypium raimondii]
Length=1710

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  111  KQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIMD  290
            KQF +++EMA++LD LLE IE  GGF +     Q++SV  LE+GI  LS +CR W+ +MD
Sbjct  776  KQFGNIKEMAKELDTLLESIEEAGGFRDVCTVFQRSSVEELEQGIAVLSKKCRSWKNVMD  835

Query  291  ERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNK  470
            E+ G+IQ  LDKTV+VLA+K+Y+EGI+KQA+DS+Y DLW+ QKLSSEL+LKQ HI  +N+
Sbjct  836  EQLGKIQQHLDKTVQVLARKIYIEGIIKQASDSQYWDLWNCQKLSSELELKQRHILKLNQ  895

Query  471  VLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             LTNQLIELERHFN  EL+ FG  DG+   R
Sbjct  896  DLTNQLIELERHFNTSELHKFGDDDGVRDGR  926



>gb|KDO54530.1| hypothetical protein CISIN_1g000229mg [Citrus sinensis]
Length=1334

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 11/172 (6%)
 Frame = +3

Query  69   KLQPARD-----------TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQK  215
            KL P++D            SE   SKQ  +++EM ++LD LL+ IE  GGF +A    Q+
Sbjct  727  KLYPSKDDYKTATLSGLPNSEPNLSKQSGNIKEMTKELDMLLQSIEETGGFRDACTVFQR  786

Query  216  NSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRY  395
              V  LE+GI +LS++C +WR IMDER  EIQ L DKTV+VLA+K+Y EGI+KQA+DSRY
Sbjct  787  QKVEELEEGIGSLSEKCGMWRSIMDERLQEIQNLFDKTVQVLARKIYTEGIVKQASDSRY  846

Query  396  LDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGM  551
             DLW+RQKLS EL+LK+ HI  +N+ L NQLIELERHFN LELN FG +DG+
Sbjct  847  WDLWNRQKLSPELELKRGHILSINQDLINQLIELERHFNSLELNKFGENDGV  898



>gb|KDO54529.1| hypothetical protein CISIN_1g000229mg [Citrus sinensis]
Length=1324

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 11/172 (6%)
 Frame = +3

Query  69   KLQPARD-----------TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQK  215
            KL P++D            SE   SKQ  +++EM ++LD LL+ IE  GGF +A    Q+
Sbjct  727  KLYPSKDDYKTATLSGLPNSEPNLSKQSGNIKEMTKELDMLLQSIEETGGFRDACTVFQR  786

Query  216  NSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRY  395
              V  LE+GI +LS++C +WR IMDER  EIQ L DKTV+VLA+K+Y EGI+KQA+DSRY
Sbjct  787  QKVEELEEGIGSLSEKCGMWRSIMDERLQEIQNLFDKTVQVLARKIYTEGIVKQASDSRY  846

Query  396  LDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGM  551
             DLW+RQKLS EL+LK+ HI  +N+ L NQLIELERHFN LELN FG +DG+
Sbjct  847  WDLWNRQKLSPELELKRGHILSINQDLINQLIELERHFNSLELNKFGENDGV  898



>emb|CDP18570.1| unnamed protein product [Coffea canephora]
Length=1754

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQ  +VE MARK+D LLE I G GGF +AS  SQ++SV+ LE+G+  +S+RCR+WRG++
Sbjct  761  SKQICNVEVMARKMDSLLEAIGGAGGFRDASTTSQEDSVVALEEGLWTISERCRMWRGVL  820

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            +ER  EIQLLLDKTV+V AK++ ++GI +QATD  Y DLW+ QKLSSEL+LK++HI +++
Sbjct  821  EERLREIQLLLDKTVQVSAKRICLQGIFQQATDKWYWDLWNCQKLSSELELKRKHIIEVD  880

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMN  560
            + LT+QL+ELERHFN +E N FG S+    N
Sbjct  881  QDLTSQLVELERHFNTIEFNRFGKSEVAQTN  911



>gb|KHG20533.1| Nuclear pore complex [Gossypium arboreum]
Length=1833

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = +3

Query  111  KQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIMD  290
            KQF +++EMA++LD LLE IE  GGF +     Q++SV  LE GI  LS +CR W+ +MD
Sbjct  776  KQFGNIKEMAKELDTLLESIEEAGGFRDVCTVFQRSSVEELEHGIAVLSKKCRSWKNVMD  835

Query  291  ERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNK  470
            E+ G+IQ  LDKT++VLA+K+Y+EGI+KQA+D +Y DLW+ QKLSSEL+LKQ HI  +N+
Sbjct  836  EQLGKIQQHLDKTIQVLARKIYIEGIIKQASDRQYWDLWNCQKLSSELELKQRHILKLNQ  895

Query  471  VLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             LTNQLIELERHFN  EL+ FG  DG+   R
Sbjct  896  DLTNQLIELERHFNTRELHKFGDDDGVRDGR  926



>ref|XP_011025102.1| PREDICTED: nuclear pore complex protein NUP214 isoform X4 [Populus 
euphratica]
Length=1804

 Score =   157 bits (397),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 88/158 (56%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  90   TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCR  269
            +SE   SKQF +++E+A++LD LLE IE +GGF +A     ++SV  LE+G+  LS+ CR
Sbjct  730  SSEPNLSKQFGNIKELAKELDTLLECIEEKGGFRDACTVFLRDSVEALEEGMGTLSENCR  789

Query  270  LWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
            + + +MDER GEI  LLDKTV+VLA+K+Y++GI+KQA+DS+YL+LW+ QKLSSEL+LK+ 
Sbjct  790  MLKSVMDERLGEIHHLLDKTVQVLARKIYVDGIVKQASDSQYLELWNHQKLSSELELKRR  849

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             I  +N+ LTNQLI+LERHFN LEL +FGG+ G   +R
Sbjct  850  CILKLNQELTNQLIQLERHFNALELQSFGGNAGFHTDR  887



>ref|XP_011025101.1| PREDICTED: nuclear pore complex protein NUP214 isoform X3 [Populus 
euphratica]
Length=1805

 Score =   157 bits (397),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 88/158 (56%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  90   TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCR  269
            +SE   SKQF +++E+A++LD LLE IE +GGF +A     ++SV  LE+G+  LS+ CR
Sbjct  730  SSEPNLSKQFGNIKELAKELDTLLECIEEKGGFRDACTVFLRDSVEALEEGMGTLSENCR  789

Query  270  LWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
            + + +MDER GEI  LLDKTV+VLA+K+Y++GI+KQA+DS+YL+LW+ QKLSSEL+LK+ 
Sbjct  790  MLKSVMDERLGEIHHLLDKTVQVLARKIYVDGIVKQASDSQYLELWNHQKLSSELELKRR  849

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             I  +N+ LTNQLI+LERHFN LEL +FGG+ G   +R
Sbjct  850  CILKLNQELTNQLIQLERHFNALELQSFGGNAGFHTDR  887



>ref|XP_011025103.1| PREDICTED: nuclear pore complex protein NUP214 isoform X5 [Populus 
euphratica]
Length=1803

 Score =   157 bits (397),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 88/158 (56%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  90   TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCR  269
            +SE   SKQF +++E+A++LD LLE IE +GGF +A     ++SV  LE+G+  LS+ CR
Sbjct  730  SSEPNLSKQFGNIKELAKELDTLLECIEEKGGFRDACTVFLRDSVEALEEGMGTLSENCR  789

Query  270  LWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
            + + +MDER GEI  LLDKTV+VLA+K+Y++GI+KQA+DS+YL+LW+ QKLSSEL+LK+ 
Sbjct  790  MLKSVMDERLGEIHHLLDKTVQVLARKIYVDGIVKQASDSQYLELWNHQKLSSELELKRR  849

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             I  +N+ LTNQLI+LERHFN LEL +FGG+ G   +R
Sbjct  850  CILKLNQELTNQLIQLERHFNALELQSFGGNAGFHTDR  887



>ref|XP_011025104.1| PREDICTED: nuclear pore complex protein NUP214 isoform X6 [Populus 
euphratica]
 ref|XP_011025105.1| PREDICTED: nuclear pore complex protein NUP214 isoform X7 [Populus 
euphratica]
Length=1784

 Score =   157 bits (396),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 88/158 (56%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  90   TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCR  269
            +SE   SKQF +++E+A++LD LLE IE +GGF +A     ++SV  LE+G+  LS+ CR
Sbjct  678  SSEPNLSKQFGNIKELAKELDTLLECIEEKGGFRDACTVFLRDSVEALEEGMGTLSENCR  737

Query  270  LWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
            + + +MDER GEI  LLDKTV+VLA+K+Y++GI+KQA+DS+YL+LW+ QKLSSEL+LK+ 
Sbjct  738  MLKSVMDERLGEIHHLLDKTVQVLARKIYVDGIVKQASDSQYLELWNHQKLSSELELKRR  797

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             I  +N+ LTNQLI+LERHFN LEL +FGG+ G   +R
Sbjct  798  CILKLNQELTNQLIQLERHFNALELQSFGGNAGFHTDR  835



>ref|XP_011025100.1| PREDICTED: nuclear pore complex protein NUP214 isoform X2 [Populus 
euphratica]
Length=1835

 Score =   156 bits (395),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 88/158 (56%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  90   TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCR  269
            +SE   SKQF +++E+A++LD LLE IE +GGF +A     ++SV  LE+G+  LS+ CR
Sbjct  730  SSEPNLSKQFGNIKELAKELDTLLECIEEKGGFRDACTVFLRDSVEALEEGMGTLSENCR  789

Query  270  LWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
            + + +MDER GEI  LLDKTV+VLA+K+Y++GI+KQA+DS+YL+LW+ QKLSSEL+LK+ 
Sbjct  790  MLKSVMDERLGEIHHLLDKTVQVLARKIYVDGIVKQASDSQYLELWNHQKLSSELELKRR  849

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             I  +N+ LTNQLI+LERHFN LEL +FGG+ G   +R
Sbjct  850  CILKLNQELTNQLIQLERHFNALELQSFGGNAGFHTDR  887



>ref|XP_011025099.1| PREDICTED: nuclear pore complex protein NUP214 isoform X1 [Populus 
euphratica]
Length=1836

 Score =   156 bits (395),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 88/158 (56%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +3

Query  90   TSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCR  269
            +SE   SKQF +++E+A++LD LLE IE +GGF +A     ++SV  LE+G+  LS+ CR
Sbjct  730  SSEPNLSKQFGNIKELAKELDTLLECIEEKGGFRDACTVFLRDSVEALEEGMGTLSENCR  789

Query  270  LWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
            + + +MDER GEI  LLDKTV+VLA+K+Y++GI+KQA+DS+YL+LW+ QKLSSEL+LK+ 
Sbjct  790  MLKSVMDERLGEIHHLLDKTVQVLARKIYVDGIVKQASDSQYLELWNHQKLSSELELKRR  849

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             I  +N+ LTNQLI+LERHFN LEL +FGG+ G   +R
Sbjct  850  CILKLNQELTNQLIQLERHFNALELQSFGGNAGFHTDR  887



>ref|XP_004172846.1| PREDICTED: uncharacterized protein LOC101226494, partial [Cucumis 
sativus]
Length=874

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  186  FMNASIASQKNSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEG  365
            FM+A  A QK+SV  LE G+ +LSD C++WR  M+ER  E+Q L DK V+VL+KK Y+EG
Sbjct  21   FMDACTAFQKSSVEALELGLASLSDGCQIWRSTMNERSQEVQNLFDKMVQVLSKKTYIEG  80

Query  366  ILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSD  545
            I+ Q++DS+Y + W RQKLSSEL+LK++HI  MN+ +TNQLIELERHFN LELN FGG++
Sbjct  81   IVMQSSDSKYWEQWDRQKLSSELELKRQHILKMNQNITNQLIELERHFNGLELNKFGGNE  140



>ref|XP_008445928.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103488807 
[Cucumis melo]
Length=1660

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  186  FMNASIASQKNSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEG  365
            FM+A  A QK+SV  LE G+ +LSD C++WR  M+ER  E+Q L DK V+VL+KK Y+EG
Sbjct  731  FMDACTAFQKSSVEALELGLASLSDECQIWRSTMNERVQEVQNLFDKMVQVLSKKTYIEG  790

Query  366  ILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSD  545
            I+ QA+DS+Y + W RQKLSSEL+LK++HI  MN+ +TNQLIELERHFN LELN FGG++
Sbjct  791  IVMQASDSKYWEQWDRQKLSSELELKRQHILKMNQNITNQLIELERHFNGLELNKFGGNE  850



>ref|XP_004147125.1| PREDICTED: uncharacterized protein LOC101219502 [Cucumis sativus]
Length=2161

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  186   FMNASIASQKNSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEG  365
             FM+A  A QK+SV  LE G+ +LSD C++WR  M+ER  E+Q L DK V+VL+KK Y+EG
Sbjct  1231  FMDACTAFQKSSVEALELGLASLSDGCQIWRSTMNERSQEVQNLFDKMVQVLSKKTYIEG  1290

Query  366   ILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSD  545
             I+ Q++DS+Y + W RQKLSSEL+LK++HI  MN+ +TNQLIELERHFN LELN FGG++
Sbjct  1291  IVMQSSDSKYWEQWDRQKLSSELELKRQHILKMNQNITNQLIELERHFNGLELNKFGGNE  1350



>gb|KGN51596.1| hypothetical protein Csa_5G583270 [Cucumis sativus]
Length=1704

 Score =   150 bits (380),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 88/155 (57%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = +3

Query  87   DTSERIPSKQ--FRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSD  260
            D SER  S     + ++EM   LD LLE IE  GGFM+A  A QK+SV  LE G+ +LSD
Sbjct  696  DGSERYYSNSPLAKPMKEMCEGLDTLLESIEESGGFMDACTAFQKSSVEALELGLASLSD  755

Query  261  RCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDL  440
             C++WR  M+ER  E+Q L DK V+VL+KK Y+EGI+ Q++DS+Y + W RQKLSSEL+L
Sbjct  756  GCQIWRSTMNERSQEVQNLFDKMVQVLSKKTYIEGIVMQSSDSKYWEQWDRQKLSSELEL  815

Query  441  KQEHIRDMNKVLTNQLIELERHFNILELNTFGGSD  545
            K++HI  MN+ +TNQLIELERHFN LELN FGG++
Sbjct  816  KRQHILKMNQNITNQLIELERHFNGLELNKFGGNE  850



>ref|XP_007143523.1| hypothetical protein PHAVU_007G078700g [Phaseolus vulgaris]
 gb|ESW15517.1| hypothetical protein PHAVU_007G078700g [Phaseolus vulgaris]
Length=1754

 Score =   148 bits (373),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 83/147 (56%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF ++ EM ++LD LL  IEG GGF +A   S ++S+  LE+GI ALS +C+     +
Sbjct  714  SKQFGNINEMTKELDLLLRSIEGAGGFKDACTRSLQSSIEELEQGIDALSRKCKSLTCQV  773

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DE   E+  LL+KT++V+A+K+YMEGI KQA+DSRY DLW+RQKL+SEL+LK++HI  +N
Sbjct  774  DEHHEEVHYLLNKTIRVMARKIYMEGIYKQASDSRYWDLWNRQKLNSELELKRQHILSLN  833

Query  468  KVLTNQLIELERHFNILELNTFGGSDG  548
            + LTNQLIELERHFN LELN F  + G
Sbjct  834  QDLTNQLIELERHFNALELNKFSQNGG  860



>ref|XP_010552295.1| PREDICTED: uncharacterized protein LOC104822690 isoform X2 [Tarenaya 
hassleriana]
Length=1829

 Score =   144 bits (363),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 81/163 (50%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   QPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQAL  254
            Q     SE   SKQF ++ EMAR+LD LL+ IEG GGF ++     K+SV  LE+G++ L
Sbjct  726  QAGASKSEPNLSKQFSNINEMARELDMLLQCIEGPGGFKDSCTILPKDSVEKLEQGLENL  785

Query  255  SDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSEL  434
            ++ C+ W+ + D++  EIQ LLD+TV+VLA+K YMEGI+KQ +D +Y +LW+RQKL+ EL
Sbjct  786  AEECQTWKNVTDKQLAEIQHLLDRTVQVLARKTYMEGIVKQTSDKQYWELWNRQKLNPEL  845

Query  435  DLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + K+++I  +NK LT+QLIELERHFN LEL+++    G+ M +
Sbjct  846  EAKRQYIMTLNKDLTHQLIELERHFNRLELDSYHEDSGLHMAK  888



>ref|XP_010552294.1| PREDICTED: nuclear pore complex protein Nup214 isoform X1 [Tarenaya 
hassleriana]
Length=1872

 Score =   144 bits (363),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 81/163 (50%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   QPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQAL  254
            Q     SE   SKQF ++ EMAR+LD LL+ IEG GGF ++     K+SV  LE+G++ L
Sbjct  726  QAGASKSEPNLSKQFSNINEMARELDMLLQCIEGPGGFKDSCTILPKDSVEKLEQGLENL  785

Query  255  SDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSEL  434
            ++ C+ W+ + D++  EIQ LLD+TV+VLA+K YMEGI+KQ +D +Y +LW+RQKL+ EL
Sbjct  786  AEECQTWKNVTDKQLAEIQHLLDRTVQVLARKTYMEGIVKQTSDKQYWELWNRQKLNPEL  845

Query  435  DLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + K+++I  +NK LT+QLIELERHFN LEL+++    G+ M +
Sbjct  846  EAKRQYIMTLNKDLTHQLIELERHFNRLELDSYHEDSGLHMAK  888



>ref|XP_010552297.1| PREDICTED: uncharacterized protein LOC104822690 isoform X4 [Tarenaya 
hassleriana]
Length=1785

 Score =   144 bits (362),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 81/163 (50%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   QPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQAL  254
            Q     SE   SKQF ++ EMAR+LD LL+ IEG GGF ++     K+SV  LE+G++ L
Sbjct  726  QAGASKSEPNLSKQFSNINEMARELDMLLQCIEGPGGFKDSCTILPKDSVEKLEQGLENL  785

Query  255  SDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSEL  434
            ++ C+ W+ + D++  EIQ LLD+TV+VLA+K YMEGI+KQ +D +Y +LW+RQKL+ EL
Sbjct  786  AEECQTWKNVTDKQLAEIQHLLDRTVQVLARKTYMEGIVKQTSDKQYWELWNRQKLNPEL  845

Query  435  DLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + K+++I  +NK LT+QLIELERHFN LEL+++    G+ M +
Sbjct  846  EAKRQYIMTLNKDLTHQLIELERHFNRLELDSYHEDSGLHMAK  888



>ref|XP_010552296.1| PREDICTED: uncharacterized protein LOC104822690 isoform X3 [Tarenaya 
hassleriana]
Length=1828

 Score =   144 bits (362),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 81/163 (50%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   QPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQAL  254
            Q     SE   SKQF ++ EMAR+LD LL+ IEG GGF ++     K+SV  LE+G++ L
Sbjct  726  QAGASKSEPNLSKQFSNINEMARELDMLLQCIEGPGGFKDSCTILPKDSVEKLEQGLENL  785

Query  255  SDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSEL  434
            ++ C+ W+ + D++  EIQ LLD+TV+VLA+K YMEGI+KQ +D +Y +LW+RQKL+ EL
Sbjct  786  AEECQTWKNVTDKQLAEIQHLLDRTVQVLARKTYMEGIVKQTSDKQYWELWNRQKLNPEL  845

Query  435  DLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + K+++I  +NK LT+QLIELERHFN LEL+++    G+ M +
Sbjct  846  EAKRQYIMTLNKDLTHQLIELERHFNRLELDSYHEDSGLHMAK  888



>ref|XP_003526034.1| PREDICTED: uncharacterized protein LOC100806517 [Glycine max]
Length=1744

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF ++ EM ++LD LL+ +E  GGF +A   S ++S+  +E+G+ ALS +C++    +
Sbjct  718  SKQFGNINEMTKELDLLLKSVEETGGFRDACTRSLRSSIEAVEQGMDALSKKCKILTCQV  777

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DE   E+  LL+KT++ +A+K+YMEGI KQA+DSRY DLW+RQKL+SEL+LK++HI  +N
Sbjct  778  DEHHEEVHYLLNKTIRAMARKIYMEGIYKQASDSRYWDLWNRQKLNSELELKRQHILSLN  837

Query  468  KVLTNQLIELERHFNILELNTF  533
            + LT QLIELERHFN LELN F
Sbjct  838  QDLTYQLIELERHFNALELNKF  859



>ref|XP_006601898.1| PREDICTED: uncharacterized protein LOC100794048 [Glycine max]
Length=1732

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF ++ EM ++LD LL+ IE  GGF +A   S ++S+  +E+G+ ALS +C++    +
Sbjct  717  SKQFGNINEMTKELDLLLKSIEEAGGFRDACTRSLRSSIEAVEQGMDALSKKCKILTCQV  776

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            DE   E+  LL+KT++ +A+K+YMEGI KQA+DSRY DLW+RQKL+SEL+LK++HI  +N
Sbjct  777  DEHHEEVHYLLNKTIRAMARKIYMEGIYKQASDSRYWDLWNRQKLNSELELKRQHILSLN  836

Query  468  KVLTNQLIELERHFNILELNTF  533
            + LT QLIELERHFN LELN F
Sbjct  837  QDLTYQLIELERHFNALELNKF  858



>ref|XP_002297612.2| proline-rich family protein [Populus trichocarpa]
 gb|EEE82417.2| proline-rich family protein [Populus trichocarpa]
Length=635

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 119/169 (70%), Gaps = 3/169 (2%)
 Frame = +3

Query  66   SKLQPARDTSER---IPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLE  236
            S   P  D  +R   +P      +++MA +LD LLE I+  GGF +A     ++SV  LE
Sbjct  43   STCSPPLDAEQRGLIVPENLLLQIKDMAEELDMLLECIDEPGGFRDACTVFLRSSVEALE  102

Query  237  KGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQ  416
            +G+  LS+ CR+ + +MDER GEIQ +L KTV+VLA++++++GI+KQA+D +  +LW+RQ
Sbjct  103  EGMGTLSENCRMLKNMMDERLGEIQHVLYKTVQVLARRIHLDGIVKQASDRQSWELWNRQ  162

Query  417  KLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            KLSSEL+LK+  I  +N+ LTNQLI++ERHFN LEL +FGG+DG   +R
Sbjct  163  KLSSELELKRRCILKLNQELTNQLIQVERHFNTLELRSFGGNDGSHSDR  211



>ref|XP_006392626.1| hypothetical protein EUTSA_v10011181mg [Eutrema salsugineum]
 gb|ESQ29912.1| hypothetical protein EUTSA_v10011181mg [Eutrema salsugineum]
Length=1826

 Score =   137 bits (346),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 117/167 (70%), Gaps = 2/167 (1%)
 Frame = +3

Query  63   PSKLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKG  242
            PS   P R   E   SKQ  ++ EMAR++D LL+ IEG GGF +   +  K+ +  LE+G
Sbjct  722  PSSPGPLR--LENTMSKQPSNINEMAREMDALLQSIEGPGGFKDCCTSLLKSHIEELEQG  779

Query  243  IQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKL  422
            +Q+L+ +C+ W+ I  E+Q EIQ LLDKT++VLAKK YMEG+ KQ +D++Y  LW+R++L
Sbjct  780  LQSLAGKCQTWKSITHEQQAEIQHLLDKTIQVLAKKTYMEGLYKQTSDNQYWQLWNRRRL  839

Query  423  SSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + EL+ K++HI  +NK LT+QLIELER+FN LEL+ +    G+ + R
Sbjct  840  NPELEAKRQHIVKLNKDLTHQLIELERYFNRLELDRYQEDGGLSVAR  886



>gb|KCW52322.1| hypothetical protein EUGRSUZ_J01744 [Eucalyptus grandis]
Length=1664

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   ERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLW  275
            + I SKQ  +++EM  +LD LL+ I  +GGF +A   S K  V  +E+ I  LS +C +W
Sbjct  573  DPITSKQSGNIKEMVNELDTLLDSIVRKGGFKDACTISLKGPVEEIEERIGNLSSQCMMW  632

Query  276  RGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHI  455
            + I++E+  E+Q LLD TV+VLA+K+Y+EGI+KQA D +Y DLW+RQKL +EL++K++HI
Sbjct  633  KSIVEEQLEEVQSLLDNTVQVLARKMYVEGIVKQAKDDQYWDLWNRQKLGTELEMKRQHI  692

Query  456  RDMNKVLTNQLIELERHFNILELNTFG  536
              +N+ LTN+LI+LERHFN LELN FG
Sbjct  693  LKLNQDLTNELIKLERHFNTLELNKFG  719



>ref|XP_010034531.1| PREDICTED: uncharacterized protein LOC104423777 [Eucalyptus grandis]
Length=1926

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   ERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLW  275
            + I SKQ  +++EM  +LD LL+ I  +GGF +A   S K  V  +E+ I  LS +C +W
Sbjct  835  DPITSKQSGNIKEMVNELDTLLDSIVRKGGFKDACTISLKGPVEEIEERIGNLSSQCMMW  894

Query  276  RGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHI  455
            + I++E+  E+Q LLD TV+VLA+K+Y+EGI+KQA D +Y DLW+RQKL +EL++K++HI
Sbjct  895  KSIVEEQLEEVQSLLDNTVQVLARKMYVEGIVKQAKDDQYWDLWNRQKLGTELEMKRQHI  954

Query  456  RDMNKVLTNQLIELERHFNILELNTFG  536
              +N+ LTN+LI+LERHFN LELN FG
Sbjct  955  LKLNQDLTNELIKLERHFNTLELNKFG  981



>gb|KCW52323.1| hypothetical protein EUGRSUZ_J01744 [Eucalyptus grandis]
Length=1071

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +3

Query  102  IPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRG  281
            I SKQ  +++EM  +LD LL+ I  +GGF +A   S K  V  +E+ I  LS +C +W+ 
Sbjct  575  ITSKQSGNIKEMVNELDTLLDSIVRKGGFKDACTISLKGPVEEIEERIGNLSSQCMMWKS  634

Query  282  IMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRD  461
            I++E+  E+Q LLD TV+VLA+K+Y+EGI+KQA D +Y DLW+RQKL +EL++K++HI  
Sbjct  635  IVEEQLEEVQSLLDNTVQVLARKMYVEGIVKQAKDDQYWDLWNRQKLGTELEMKRQHILK  694

Query  462  MNKVLTNQLIELERHFNILELNTFG  536
            +N+ LTN+LI+LERHFN LELN FG
Sbjct  695  LNQDLTNELIKLERHFNTLELNKFG  719



>ref|XP_002894510.1| hypothetical protein ARALYDRAFT_337635 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70769.1| hypothetical protein ARALYDRAFT_337635 [Arabidopsis lyrata subsp. 
lyrata]
Length=1825

 Score =   134 bits (337),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 77/152 (51%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQ  ++ EMAR++D LL+ IEG GGF ++     K+ V  LE+G+++L+ RC+ W+  +
Sbjct  731  SKQPSNINEMAREMDTLLQSIEGPGGFKDSCEVLLKSHVEELEQGLESLAGRCQTWKSTI  790

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
             E+Q EIQ LLDKT++VLAKK YMEG+ KQ  D++Y  LW+RQKL+ EL+ K++HI  +N
Sbjct  791  HEQQAEIQHLLDKTIQVLAKKTYMEGMYKQTADNQYWQLWNRQKLNPELEAKRQHIMKLN  850

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            K LT+QLIELER+FN LEL+ +    G  + R
Sbjct  851  KDLTHQLIELERYFNRLELDRYHEDGGHPVAR  882



>ref|XP_004495016.1| PREDICTED: serine-rich adhesin for platelets-like isoform X1 
[Cicer arietinum]
Length=1764

 Score =   134 bits (336),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 75/152 (49%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            +KQF ++ EM ++LD LL+ IE  GGF +A   S ++S+  +E+ +  LS +C++    +
Sbjct  753  TKQFGNINEMTKELDLLLKSIEEAGGFRDACTRSLQSSIEEVEQSMNILSTQCKIRTCQV  812

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            D+   E+  LL+KT++V+A+KVYME I KQA DSRY DLW+RQKL+SEL+LK++HI  +N
Sbjct  813  DQHVEEVHFLLNKTIQVVARKVYMEDIYKQACDSRYWDLWNRQKLNSELELKRQHILSLN  872

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + LT QL+ELERHFN LELN F  + G  + R
Sbjct  873  QDLTYQLVELERHFNALELNKFSQNGGHLIGR  904



>gb|KEH42389.1| hypothetical protein MTR_1g069005 [Medicago truncatula]
Length=1831

 Score =   134 bits (336),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 76/152 (50%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF ++ EM ++LD LL+ IE  GGF +A   S ++S+  +E+ +  LS +C++    +
Sbjct  805  SKQFGNINEMTKELDLLLKSIEEPGGFRDACTRSLQSSIEEVEQSMDTLSKQCKIRMCQV  864

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            D+   E+  LL+KTV+V+A+KVY+E I KQA DSRY DLW+RQKL+SEL+LK++HI  +N
Sbjct  865  DQHLEEVHYLLNKTVQVVARKVYLEDIYKQACDSRYWDLWNRQKLNSELELKRQHILSLN  924

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + LT+QL+ELERHFN LELN F    G  + R
Sbjct  925  QDLTHQLVELERHFNALELNKFSQYGGHHIGR  956



>ref|XP_010675795.1| PREDICTED: nuclear pore complex protein NUP214 [Beta vulgaris 
subsp. vulgaris]
Length=1700

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +3

Query  111  KQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIMD  290
            KQF +V+ MA +LD LLE IE  GGF +A   + ++S+  LE+G+ +LS+R R W+   +
Sbjct  738  KQFSNVQNMANELDKLLESIEKAGGFRDACTTAHRSSLEALEEGMDSLSERNREWQSSTE  797

Query  291  ERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNK  470
             R  E+QLLLDKTV+VLA+K +MEGI++Q TD +Y DLW+RQKL+SELD K++ + + ++
Sbjct  798  GRLREVQLLLDKTVQVLARKTHMEGIVRQTTDGQYWDLWNRQKLNSELDQKRDSVLNRSQ  857

Query  471  VLTNQLIELERHFNILELNTFGGSDGM  551
             L N++IELE+HFN LELN +G S G+
Sbjct  858  DLINRMIELEKHFNTLELNLYGESSGV  884



>ref|XP_010480089.1| PREDICTED: uncharacterized protein LOC104758833 isoform X1 [Camelina 
sativa]
Length=1829

 Score =   133 bits (335),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 76/152 (50%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQ  ++ EMAR++D LL+ IEG GGF ++     K+ V  LE+G++ L+ +C+ W+  +
Sbjct  733  SKQPSNINEMAREMDTLLQSIEGPGGFKDSCAFLLKSHVEELEQGLENLAGKCQTWKSTI  792

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
             E+Q EIQ LLDKT++VLAKK YMEG+ KQ  D++Y  LW+RQKL+ EL+ K++HI  +N
Sbjct  793  HEQQAEIQHLLDKTIQVLAKKTYMEGMYKQTADNQYWQLWNRQKLNPELEAKRQHIMKLN  852

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            K LT+QLIELER+FN LEL+ +    G+ + R
Sbjct  853  KDLTHQLIELERYFNRLELDRYHEDGGLPVAR  884



>ref|XP_010480090.1| PREDICTED: uncharacterized protein LOC104758833 isoform X2 [Camelina 
sativa]
Length=1826

 Score =   133 bits (334),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 76/152 (50%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQ  ++ EMAR++D LL+ IEG GGF ++     K+ V  LE+G++ L+ +C+ W+  +
Sbjct  733  SKQPSNINEMAREMDTLLQSIEGPGGFKDSCAFLLKSHVEELEQGLENLAGKCQTWKSTI  792

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
             E+Q EIQ LLDKT++VLAKK YMEG+ KQ  D++Y  LW+RQKL+ EL+ K++HI  +N
Sbjct  793  HEQQAEIQHLLDKTIQVLAKKTYMEGMYKQTADNQYWQLWNRQKLNPELEAKRQHIMKLN  852

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            K LT+QLIELER+FN LEL+ +    G+ + R
Sbjct  853  KDLTHQLIELERYFNRLELDRYHEDGGLPVAR  884



>ref|XP_004495017.1| PREDICTED: serine-rich adhesin for platelets-like isoform X2 
[Cicer arietinum]
Length=1444

 Score =   132 bits (333),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 75/152 (49%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            +KQF ++ EM ++LD LL+ IE  GGF +A   S ++S+  +E+ +  LS +C++    +
Sbjct  433  TKQFGNINEMTKELDLLLKSIEEAGGFRDACTRSLQSSIEEVEQSMNILSTQCKIRTCQV  492

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            D+   E+  LL+KT++V+A+KVYME I KQA DSRY DLW+RQKL+SEL+LK++HI  +N
Sbjct  493  DQHVEEVHFLLNKTIQVVARKVYMEDIYKQACDSRYWDLWNRQKLNSELELKRQHILSLN  552

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            + LT QL+ELERHFN LELN F  + G  + R
Sbjct  553  QDLTYQLVELERHFNALELNKFSQNGGHLIGR  584



>ref|NP_001117499.2| nuclear pore complex protein LNO1 [Arabidopsis thaliana]
 sp|F4I1T7.1|NP214_ARATH RecName: Full=Nuclear pore complex protein NUP214; AltName: Full=Nucleoporin 
214; AltName: Full=Protein EMBRYO DEFECTIVE 
1011; AltName: Full=Protein LNO1; AltName: Full=Protein LONO1 
[Arabidopsis thaliana]
 gb|AEE33263.1| Nuclear pore complex protein [Arabidopsis thaliana]
Length=1819

 Score =   132 bits (332),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 75/152 (49%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            S Q  ++ EMAR++D LL+ IEG GGF ++     K++V  LE+G+++L+ +C+ W+  +
Sbjct  728  SNQPSNINEMAREMDTLLQSIEGPGGFKDSCAFILKSNVEELEQGLESLAGKCQTWKSTI  787

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
             E+Q EIQ LLDKT++VLAKK YMEG+ KQ  D++Y  LW+RQKL+ EL+ K++HI  +N
Sbjct  788  HEQQAEIQHLLDKTIQVLAKKTYMEGMYKQTADNQYWQLWNRQKLNPELEAKRQHIMKLN  847

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            K LT+QLIELER+FN LEL+ +    G  + R
Sbjct  848  KDLTHQLIELERYFNRLELDRYNEDGGHPVAR  879



>ref|NP_564694.2| nuclear pore complex protein LNO1 [Arabidopsis thaliana]
 gb|AEE33262.1| Nuclear pore complex protein [Arabidopsis thaliana]
Length=1816

 Score =   132 bits (332),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 75/152 (49%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            S Q  ++ EMAR++D LL+ IEG GGF ++     K++V  LE+G+++L+ +C+ W+  +
Sbjct  728  SNQPSNINEMAREMDTLLQSIEGPGGFKDSCAFILKSNVEELEQGLESLAGKCQTWKSTI  787

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
             E+Q EIQ LLDKT++VLAKK YMEG+ KQ  D++Y  LW+RQKL+ EL+ K++HI  +N
Sbjct  788  HEQQAEIQHLLDKTIQVLAKKTYMEGMYKQTADNQYWQLWNRQKLNPELEAKRQHIMKLN  847

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            K LT+QLIELER+FN LEL+ +    G  + R
Sbjct  848  KDLTHQLIELERYFNRLELDRYNEDGGHPVAR  879



>gb|AAD10642.1| Hypothetical protein [Arabidopsis thaliana]
Length=1804

 Score =   132 bits (331),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 75/152 (49%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            S Q  ++ EMAR++D LL+ IEG GGF ++     K++V  LE+G+++L+ +C+ W+  +
Sbjct  733  SNQPSNINEMAREMDTLLQSIEGPGGFKDSCAFILKSNVEELEQGLESLAGKCQTWKSTI  792

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
             E+Q EIQ LLDKT++VLAKK YMEG+ KQ  D++Y  LW+RQKL+ EL+ K++HI  +N
Sbjct  793  HEQQAEIQHLLDKTIQVLAKKTYMEGMYKQTADNQYWQLWNRQKLNPELEAKRQHIMKLN  852

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            K LT+QLIELER+FN LEL+ +    G  + R
Sbjct  853  KDLTHQLIELERYFNRLELDRYNEDGGHPVAR  884



>ref|XP_009106865.1| PREDICTED: nuclear pore complex protein Nup214 isoform X2 [Brassica 
rapa]
Length=1786

 Score =   130 bits (327),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 74/156 (47%), Positives = 112/156 (72%), Gaps = 0/156 (0%)
 Frame = +3

Query  96   ERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLW  275
            E   SKQ  ++ EMAR++D LL+ IEG GGF ++  +     +  LE+G++ L+ +C+  
Sbjct  731  EHAMSKQPSNINEMAREMDALLQSIEGPGGFKDSCTSLLTGHIEELEQGLEILAGKCQTC  790

Query  276  RGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHI  455
            + I  E+QGEIQ LLDKT++VLAKK+YMEG+ KQ +D +Y  LW+R++L+ EL+ K++HI
Sbjct  791  KSITHEQQGEIQHLLDKTIQVLAKKLYMEGMYKQTSDDQYWQLWNRRRLNPELEAKRQHI  850

Query  456  RDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
              +NK LT+QLIELER+FN LEL+ +    G+ ++R
Sbjct  851  VKLNKDLTHQLIELERYFNRLELDRYQDDGGLPLSR  886



>ref|XP_009106863.1| PREDICTED: nuclear pore complex protein Nup214 isoform X1 [Brassica 
rapa]
Length=1788

 Score =   130 bits (327),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 74/156 (47%), Positives = 112/156 (72%), Gaps = 0/156 (0%)
 Frame = +3

Query  96   ERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLW  275
            E   SKQ  ++ EMAR++D LL+ IEG GGF ++  +     +  LE+G++ L+ +C+  
Sbjct  731  EHAMSKQPSNINEMAREMDALLQSIEGPGGFKDSCTSLLTGHIEELEQGLEILAGKCQTC  790

Query  276  RGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHI  455
            + I  E+QGEIQ LLDKT++VLAKK+YMEG+ KQ +D +Y  LW+R++L+ EL+ K++HI
Sbjct  791  KSITHEQQGEIQHLLDKTIQVLAKKLYMEGMYKQTSDDQYWQLWNRRRLNPELEAKRQHI  850

Query  456  RDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
              +NK LT+QLIELER+FN LEL+ +    G+ ++R
Sbjct  851  VKLNKDLTHQLIELERYFNRLELDRYQDDGGLPLSR  886



>ref|XP_010501169.1| PREDICTED: uncharacterized protein LOC104778424 isoform X1 [Camelina 
sativa]
 ref|XP_010501170.1| PREDICTED: uncharacterized protein LOC104778424 isoform X2 [Camelina 
sativa]
Length=1827

 Score =   129 bits (325),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 75/152 (49%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQ  ++ EMAR++D LL+ IEG GGF ++     K+ V  LE+G++ L+ + + W+  +
Sbjct  731  SKQPSNINEMAREMDTLLQSIEGPGGFKDSCAFLLKSHVEELEQGLENLAGKSQTWKSTI  790

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
             E+Q EIQ LLDKT++VLAKK YMEG+ KQ  D++Y  LW+RQKL+ EL+ K++HI  +N
Sbjct  791  HEQQAEIQHLLDKTIQVLAKKTYMEGMYKQTADNQYWQLWNRQKLNPELEAKRQHIMKLN  850

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            K LT+QLIELER+FN LEL+ +    G+ + R
Sbjct  851  KDLTHQLIELERYFNRLELDRYHEDGGLPVAR  882



>emb|CDY56018.1| BnaA08g29260D [Brassica napus]
Length=1753

 Score =   129 bits (324),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 74/156 (47%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = +3

Query  96   ERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLW  275
            E   SKQ  ++ EMAR++D LL+ IEG GGF ++  +     +  LE+G++ L+ +C+  
Sbjct  727  EHAMSKQTSNINEMAREMDALLQSIEGPGGFKDSCTSLLTGYIEELEQGLEILAGKCQTC  786

Query  276  RGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHI  455
            + I  E+QGEIQ LLDKT++VLAKK YMEG+ KQ +D +Y  LW+R++L+ EL+ K++HI
Sbjct  787  KIITHEQQGEIQHLLDKTIQVLAKKTYMEGMYKQTSDDQYWQLWNRRRLNPELEAKRQHI  846

Query  456  RDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
              +NK LT+QLIELER+FN LEL+ +    G+ ++R
Sbjct  847  VKLNKDLTHQLIELERYFNRLELDRYQDDGGLPLSR  882



>emb|CDY10551.1| BnaC03g70630D [Brassica napus]
Length=1497

 Score =   128 bits (321),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 73/154 (47%), Positives = 109/154 (71%), Gaps = 0/154 (0%)
 Frame = +3

Query  96   ERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLW  275
            E   SKQ  ++ EMAR++D LL+ IEG GGF ++  +     +  LE+G++ L+ +C+  
Sbjct  488  EHAMSKQPSNINEMAREMDALLQSIEGPGGFKDSCTSLLTGHIEELEQGLEILAGKCQTC  547

Query  276  RGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHI  455
            + I  E+QGEIQ LLDKT++VLAKK YMEG+ KQ +D +Y  LW+R++L+ EL+ K++HI
Sbjct  548  KSITHEQQGEIQHLLDKTIQVLAKKTYMEGMYKQTSDDQYWQLWNRRRLNPELEAKRQHI  607

Query  456  RDMNKVLTNQLIELERHFNILELNTFGGSDGMXM  557
              +NK LT+QLIELER+FN LEL+ +    G+ +
Sbjct  608  VKLNKDLTHQLIELERYFNRLELDRYQDDGGLPL  641



>ref|XP_006306239.1| hypothetical protein CARUB_v10012062mg [Capsella rubella]
 gb|EOA39137.1| hypothetical protein CARUB_v10012062mg [Capsella rubella]
Length=1821

 Score =   123 bits (309),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 73/152 (48%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQ  ++ EMAR +D LL+ IEG GGF ++     ++ V  LE+G++ L+ +C+ W+  +
Sbjct  732  SKQPSNINEMARDMDTLLQSIEGPGGFKDSCAFLLESEVEELEQGLENLAGKCQTWKSTI  791

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
             E+Q EIQ LLDKT++VLAK  YMEG+ +Q  D++Y  LW+RQKL+ EL+ K++HI  +N
Sbjct  792  HEQQAEIQHLLDKTIQVLAKTTYMEGMYEQTADNQYWQLWNRQKLNPELEAKRQHIMKLN  851

Query  468  KVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            K LT+QLIELER+FN LEL+ +    G+ + R
Sbjct  852  KDLTHQLIELERYFNRLELDRYHEDGGLTVAR  883



>gb|KFK35577.1| hypothetical protein AALP_AA4G008800 [Arabis alpina]
Length=1732

 Score =   120 bits (300),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 76/162 (47%), Positives = 113/162 (70%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   PARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALS  257
            P    S+   SKQ  ++ EMAR +D LL+ IEG GGF ++     K+ +  LE+G+++L+
Sbjct  710  PLNAGSQHNMSKQPSNINEMARDMDALLQSIEGPGGFKDSCTFLLKSHIEELEEGLESLA  769

Query  258  DRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELD  437
             +C+ W+ I  E+Q EIQ LLDKT++VLAKK YMEG+ KQ +D++Y  LW+ ++L+ EL+
Sbjct  770  GKCQTWKSITHEQQAEIQHLLDKTIQVLAKKTYMEGMYKQTSDNQYWQLWNLRRLNPELE  829

Query  438  LKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
             KQ+HI  +NK LT+QLIELER+FN LEL+ +    G+ + R
Sbjct  830  AKQQHIMKLNKDLTHQLIELERYFNRLELDRYQEDGGLPVAR  871



>ref|XP_008793329.1| PREDICTED: nuclear pore complex protein Nup214 isoform X3 [Phoenix 
dactylifera]
Length=1372

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SK+F +V++M ++LD LL  IE E GF +A    Q++S++ LE+G+Q LS    + R  +
Sbjct  337  SKEFYNVKDMTKELDTLLSFIEREDGFRDACTVFQQSSLLALEEGLQNLSALSGICRSKV  396

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            +++  EIQ L +K ++V A+++YMEGI++QA++ +Y D+W++QKLS E +LK++ I + N
Sbjct  397  EQQLMEIQELQNKMLQVSARQLYMEGIVRQASNGKYWDIWNQQKLSPEFELKRQQILNAN  456

Query  468  KVLTNQLIELERHFNILELNTFG  536
            + LTNQLIELERHFN LE+N FG
Sbjct  457  QKLTNQLIELERHFNSLEINRFG  479



>ref|XP_008793328.1| PREDICTED: uncharacterized protein LOC103709652 isoform X2 [Phoenix 
dactylifera]
Length=1662

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SK+F +V++M ++LD LL  IE E GF +A    Q++S++ LE+G+Q LS    + R  +
Sbjct  761  SKEFYNVKDMTKELDTLLSFIEREDGFRDACTVFQQSSLLALEEGLQNLSALSGICRSKV  820

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            +++  EIQ L +K ++V A+++YMEGI++QA++ +Y D+W++QKLS E +LK++ I + N
Sbjct  821  EQQLMEIQELQNKMLQVSARQLYMEGIVRQASNGKYWDIWNQQKLSPEFELKRQQILNAN  880

Query  468  KVLTNQLIELERHFNILELNTFGGS  542
            + LTNQLIELERHFN LE+N FG S
Sbjct  881  QKLTNQLIELERHFNSLEINRFGES  905



>ref|XP_008793327.1| PREDICTED: uncharacterized protein LOC103709652 isoform X1 [Phoenix 
dactylifera]
Length=1796

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 107/145 (74%), Gaps = 0/145 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SK+F +V++M ++LD LL  IE E GF +A    Q++S++ LE+G+Q LS    + R  +
Sbjct  761  SKEFYNVKDMTKELDTLLSFIEREDGFRDACTVFQQSSLLALEEGLQNLSALSGICRSKV  820

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            +++  EIQ L +K ++V A+++YMEGI++QA++ +Y D+W++QKLS E +LK++ I + N
Sbjct  821  EQQLMEIQELQNKMLQVSARQLYMEGIVRQASNGKYWDIWNQQKLSPEFELKRQQILNAN  880

Query  468  KVLTNQLIELERHFNILELNTFGGS  542
            + LTNQLIELERHFN LE+N FG S
Sbjct  881  QKLTNQLIELERHFNSLEINRFGES  905



>gb|EPS63585.1| hypothetical protein M569_11196, partial [Genlisea aurea]
Length=243

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  279  GIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIR  458
            G+MDE+  +++ LLDKTV+V+ +K  +EG+LKQ+TD RY DLW RQKLS +++LK++ I 
Sbjct  1    GVMDEKLKDVKHLLDKTVQVMTRKANIEGMLKQSTDGRYWDLWDRQKLSYQMELKRKSIS  60

Query  459  DMNKVLTNQLIELERHFNILELNTFG  536
            +  ++LTN+L+ELERHFN LELN FG
Sbjct  61   EYEQLLTNKLVELERHFNTLELNKFG  86



>ref|XP_010938158.1| PREDICTED: nuclear pore complex protein NUP214 [Elaeis guineensis]
Length=1808

 Score =   112 bits (281),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 106/145 (73%), Gaps = 0/145 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SK+F +V++M ++LD LL  IE EGGF +A    Q++S++ LE+G+Q LS    + R  +
Sbjct  762  SKEFYNVKDMTKELDTLLSFIEREGGFRDACTVFQQSSLLALEEGLQNLSALSCICRNKV  821

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            +++  EIQ L +K ++V A+++YMEGI++QA++ +Y  +W+RQKLS E +LK++ I + N
Sbjct  822  EQQLMEIQELRNKMLQVSARQLYMEGIVRQASNGQYWGIWNRQKLSPEFELKRQQILNAN  881

Query  468  KVLTNQLIELERHFNILELNTFGGS  542
            + LT QLIELERHFN +E+N FG S
Sbjct  882  QNLTKQLIELERHFNSVEINRFGES  906



>ref|XP_010233776.1| PREDICTED: nuclear pore complex protein Nup214 [Brachypodium 
distachyon]
Length=1776

 Score =   112 bits (280),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 64/157 (41%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = +3

Query  93   SERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRL  272
            +E+  SK+F S+ +M  +LD LL  IE +GGF++A I SQ++ +  LE  +Q   +  ++
Sbjct  734  TEQDLSKKFYSINDMTEELDTLLAYIEKDGGFIDACITSQQHPLSVLEGDLQNFMELLQV  793

Query  273  WRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEH  452
            ++  ++E+  + + L +K  +V A++ YM+GIL Q++D++Y D+W+RQKLS E ++K+++
Sbjct  794  FKNKVEEKYSKTEDLRNKMFQVSARQAYMKGILSQSSDTQYWDIWNRQKLSPEFEVKRQN  853

Query  453  IRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            I   N+ LTNQL+ELERHFN LE+N FG +  +  +R
Sbjct  854  ILKANQNLTNQLVELERHFNNLEMNKFGDTGRVASSR  890



>ref|XP_009400147.1| PREDICTED: uncharacterized protein LOC103984394 [Musa acuminata 
subsp. malaccensis]
Length=2557

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 101/146 (69%), Gaps = 0/146 (0%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SKQF +V++M ++LD LL  IE EGGF +A     +NS++ LE G++ LS   R+ R  +
Sbjct  740  SKQFYNVKDMTKELDTLLSLIEQEGGFKDACTVLHQNSILTLEDGLKNLSQTFRMCRRKV  799

Query  288  DERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMN  467
            +E   EIQ L  K  +V A++VYM  I+KQA+   Y D+W+RQKL+ E++ K+++I  + 
Sbjct  800  EEELTEIQELQRKMSQVSARQVYMADIVKQASTEHYWDIWNRQKLNPEIEQKRQNIWKVY  859

Query  468  KVLTNQLIELERHFNILELNTFGGSD  545
            + LTNQLIELER+FN LE++ FG SD
Sbjct  860  QDLTNQLIELERYFNTLEISKFGESD  885



>tpg|DAA64173.1| TPA: hypothetical protein ZEAMMB73_624267 [Zea mays]
Length=1735

 Score =   107 bits (268),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 64/157 (41%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = +3

Query  93   SERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRL  272
            SE+  SK+F S+ EM ++LD LL  IE +GGF +A I  Q+  +   E G+Q      ++
Sbjct  732  SEQDLSKKFYSINEMTKELDALLAYIEKDGGFRDACITIQQRPLSMFEDGLQNFLQLLQV  791

Query  273  WRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEH  452
            ++G ++E+  +I+ L +   +V A++ YM+GI+ Q++D++Y D+W+RQKLS E ++K+++
Sbjct  792  FKGKVEEQCSKIEDLRNNMFQVSARQTYMKGIVSQSSDNQYWDIWNRQKLSPEFEVKRQN  851

Query  453  IRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            I   N+ LTNQL+ELERHFN LE+N    +  +  NR
Sbjct  852  ILRANQDLTNQLVELERHFNNLEMNRSSETGRVASNR  888



>gb|KHN43779.1| hypothetical protein glysoja_045839 [Glycine soja]
Length=930

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  339  LAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNIL  518
            +A+K+YMEGI KQA+DSRY DLW+RQKL+SEL+LK++HI  +N+ LT QLIELERHFN L
Sbjct  1    MARKIYMEGIYKQASDSRYWDLWNRQKLNSELELKRQHILSLNQDLTYQLIELERHFNAL  60

Query  519  ELNTF  533
            ELN F
Sbjct  61   ELNKF  65



>gb|EMS44986.1| hypothetical protein TRIUR3_16071 [Triticum urartu]
Length=1732

 Score =   101 bits (252),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 64/165 (39%), Positives = 107/165 (65%), Gaps = 1/165 (1%)
 Frame = +3

Query  69   KLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQ  248
            KL    DT + + SK+  S+ +M  +LD LL  IE +GGF +A +  Q+  +  LE  +Q
Sbjct  715  KLGTMFDTQQDL-SKKIYSINDMTEELDTLLSYIEKDGGFRDACMTLQQRPLSVLEGDLQ  773

Query  249  ALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSS  428
             L +  ++++  ++E+  + + L +K  +V A++ YM+GIL Q++D++Y D+W+RQ LS 
Sbjct  774  NLLELLQVFKNKVEEQCSKAEDLRNKMFQVSARQAYMKGILTQSSDTQYWDIWNRQNLSP  833

Query  429  ELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            E + K+++I   N+ LTNQL+ELERHFN LE+N FG +  +  +R
Sbjct  834  EFEAKRQNILKANQNLTNQLVELERHFNNLEMNKFGETGRVASSR  878



>ref|XP_004958728.1| PREDICTED: uncharacterized protein LOC101760483 [Setaria italica]
Length=1766

 Score =   101 bits (251),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 60/147 (41%), Positives = 101/147 (69%), Gaps = 1/147 (1%)
 Frame = +3

Query  87   DTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRC  266
            D+ E + SK+  S+ EM ++LD LL  IE +GGF +A I  Q+  +   E G+Q   +  
Sbjct  734  DSQEDL-SKKLYSINEMTKELDALLAYIEKDGGFRDACITFQQRPLSVFEDGLQNFMELL  792

Query  267  RLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQ  446
            ++++  ++ +  +I+ L +K  +V A++ YM+GI+ Q++D++Y D+W+RQKLS E ++K+
Sbjct  793  QVFKNKVEGQCSKIEDLRNKMFQVSARQAYMKGIVSQSSDTQYWDIWNRQKLSPEFEVKR  852

Query  447  EHIRDMNKVLTNQLIELERHFNILELN  527
            ++I   N+ LTNQL+ELERHFN LE+N
Sbjct  853  QNILKANQNLTNQLVELERHFNNLEMN  879



>gb|EMT14894.1| Myb family transcription factor APL [Aegilops tauschii]
Length=2213

 Score =   101 bits (251),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 64/165 (39%), Positives = 107/165 (65%), Gaps = 1/165 (1%)
 Frame = +3

Query  69   KLQPARDTSERIPSKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQ  248
            KL    DT + + SK+  S+ +M  +LD LL  IE +GGF +A +  Q+  +  LE  +Q
Sbjct  793  KLGTMFDTQQDL-SKKIYSINDMTEELDTLLSYIEKDGGFRDACMTLQQRPLSVLEGDLQ  851

Query  249  ALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSS  428
             L +  ++++  ++E+  + + L +K  +V A++ YM+GIL Q++D++Y D+W+RQ LS 
Sbjct  852  NLLELLQVFKNKVEEQCSKAEDLRNKMFQVSARQAYMKGILTQSSDTQYWDIWNRQNLSP  911

Query  429  ELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            E + K+++I   N+ LTNQL+ELERHFN LE+N FG +  +  +R
Sbjct  912  EFEAKRQNILKANQNLTNQLVELERHFNNLEMNKFGETGRVASSR  956



>ref|XP_002468265.1| hypothetical protein SORBIDRAFT_01g042703 [Sorghum bicolor]
 gb|EER95263.1| hypothetical protein SORBIDRAFT_01g042703 [Sorghum bicolor]
Length=193

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 84/126 (67%), Gaps = 0/126 (0%)
 Frame = +3

Query  186  FMNASIASQKNSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEG  365
            F +A I  Q+  +   E G+Q L +  ++++G ++E+  +I+ L +K  +V A++ YM+G
Sbjct  4    FRDACITFQQRPLSMFEDGLQNLLELLQVFKGKVEEQCSKIEDLRNKVFQVSARQTYMKG  63

Query  366  ILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSD  545
            I+ Q++D++Y D+W+ QKLS E ++K++ I   N+ LTNQL+ELERHFN LE+N    + 
Sbjct  64   IVSQSSDNQYWDIWNCQKLSPEFEVKRQIILKANQNLTNQLVELERHFNNLEMNRSSETG  123

Query  546  GMXMNR  563
             +  NR
Sbjct  124  RVASNR  129



>gb|EEC82708.1| hypothetical protein OsI_27378 [Oryza sativa Indica Group]
Length=1755

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 98/149 (66%), Gaps = 6/149 (4%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SK+F S+ +M ++LD LL  IE +GGF +A I  Q+  +   E  +Q   +  ++++  +
Sbjct  719  SKKFYSINDMTKELDTLLSYIEKDGGFRDACITFQERPLSMFEGDLQNFLELLQIFKNKI  778

Query  288  DERQGEIQLLLDK------TVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
             E+   ++ L +K      T +V A++ YM+GI+ Q++D++Y D+W+RQKLS E + K++
Sbjct  779  AEQCSRVEDLRNKMFQGTSTTRVSARQAYMKGIVDQSSDTQYWDIWNRQKLSPEFEAKRQ  838

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFG  536
            +I   N+ LTNQL+ELERHFN LE+N FG
Sbjct  839  NILKANQNLTNQLVELERHFNNLEMNKFG  867



>gb|EEE67839.1| hypothetical protein OsJ_25626 [Oryza sativa Japonica Group]
Length=1755

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 98/149 (66%), Gaps = 6/149 (4%)
 Frame = +3

Query  108  SKQFRSVEEMARKlddllegiegeggFMNASIASQKNSVINLEKGIQALSDRCRLWRGIM  287
            SK+F S+ +M ++LD LL  IE +GGF +A I  Q+  +   E  +Q   +  ++++  +
Sbjct  719  SKKFYSINDMTKELDTLLSYIEKDGGFRDACITFQERPLSMFEGDLQNFLELLQIFKNKI  778

Query  288  DERQGEIQLLLDK------TVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQE  449
             E+   ++ L +K      T +V A++ YM+GI+ Q++D++Y D+W+RQKLS E + K++
Sbjct  779  AEQCSRVEDLRNKMFQGTSTTRVSARQAYMKGIVDQSSDTQYWDIWNRQKLSPEFEAKRQ  838

Query  450  HIRDMNKVLTNQLIELERHFNILELNTFG  536
            +I   N+ LTNQL+ELERHFN LE+N FG
Sbjct  839  NILKANQNLTNQLVELERHFNNLEMNKFG  867



>ref|XP_008680826.1| PREDICTED: uncharacterized protein LOC103655932 [Zea mays]
Length=129

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = +3

Query  285  MDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDM  464
            ++E+  +I+ L +   +V A++ YM+GI+ Q++D++Y D+W+RQKLS E ++K+++I   
Sbjct  14   VEEQCSKIEDLRNNMFQVSARQTYMKGIVSQSSDNQYWDIWNRQKLSPEFEVKRQNILRA  73

Query  465  NKVLTNQLIELERHFNILELNTFGGSDGMXMN  560
            N+ LTNQL+ELERHFN LE+N  G +  +  N
Sbjct  74   NQDLTNQLVELERHFNNLEMNRSGETGRVASN  105



>ref|XP_006829815.1| hypothetical protein AMTR_s00119p00078800 [Amborella trichopoda]
 gb|ERM97231.1| hypothetical protein AMTR_s00119p00078800 [Amborella trichopoda]
Length=1802

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  210  QKNSVINLEKGIQALSDRCRLWRGIMDERQGEIQLLLDKTVKVLAKKVYMEGILKQATDS  389
            +K+S+  LE+  Q L   CR+ +  +++R  E+Q L DKT++V+A +++ E I+KQA D 
Sbjct  782  RKSSIKALEEKSQNLLRSCRVCKSTIEKRHEEMQSLWDKTLQVVAWRLHTESIVKQAADD  841

Query  390  RYLDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFGGSDGMXMNR  563
            +Y   W+ Q LS E +LK++ I   ++ L  Q IELE+HFN LEL+ FG + G    R
Sbjct  842  QYWKSWNCQNLSPEFELKRQKIMKASQNLRCQFIELEKHFNALELDKFGENGGALKGR  899



>gb|AFW65695.1| hypothetical protein ZEAMMB73_930105 [Zea mays]
Length=549

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 82/135 (61%), Gaps = 12/135 (9%)
 Frame = +3

Query  192  NASIASQKNSVINLEKGIQALSDRCRLWRGIMDER------------QGEIQLLLDKTVK  335
            +A I  Q+ S+   E G+Q      ++++  ++E+            QGEI +     + 
Sbjct  149  DACITIQQRSLSMFEDGLQNFLQLLQVFKRKVEEQCSKIEDLRNNMFQGEIFVCSFDYLF  208

Query  336  VLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNI  515
            + A++ YM+GI+ Q++D++Y D+W+RQKLS E ++K+++I   N+ LTNQL+ELERHFN 
Sbjct  209  ISARQTYMKGIVSQSSDNQYWDIWNRQKLSPEFEVKRQNILRANQDLTNQLVELERHFNN  268

Query  516  LELNTFGGSDGMXMN  560
            LE+N  G +  +  N
Sbjct  269  LEMNRSGETGRVASN  283



>ref|XP_006658149.1| PREDICTED: nuclear pore complex protein Nup214-like isoform X1 
[Oryza brachyantha]
Length=953

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  357  MEGILKQATDSRYLDLWSRQKLSSELDLKQEHIRDMNKVLTNQLIELERHFNILELNTFG  536
            M+GI+ Q++D++Y D+W+RQKLS E ++K+++I   N+ LTNQL+ELERHFN LE+N FG
Sbjct  1    MKGIVDQSSDTQYWDIWNRQKLSPEFEVKRQNILKANQNLTNQLVELERHFNNLEMNKFG  60



>tpg|DAA55075.1| TPA: hypothetical protein ZEAMMB73_147712, partial [Zea mays]
Length=399

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 79/137 (58%), Gaps = 22/137 (16%)
 Frame = +3

Query  192  NASIASQKNSVINLEKGIQALSDRCRLWRGIMDERQGEIQLL---------LDKT----V  332
            +A I  Q+ S+   E G+Q      ++++  ++E+  +I+ L          DK     +
Sbjct  140  DACITIQQRSLSMFEDGLQNFLQLLQVFKSKVEEQCSKIEYLRNNMFQGEIFDKYFMSFL  199

Query  333  KVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLK-QEHIR-----DMNKV---LTNQ  485
             +   + YM+GI+ Q++D++Y D+W+RQKLS E ++K Q  +R     +M+ V   LTNQ
Sbjct  200  PLFVMQTYMKGIVSQSSDNQYWDIWNRQKLSPEFEVKRQNSLRANQENNMSFVIQDLTNQ  259

Query  486  LIELERHFNILELNTFG  536
            L+ELERHFN LE+N  G
Sbjct  260  LVELERHFNNLEMNRSG  276



>tpg|DAA55074.1| TPA: hypothetical protein ZEAMMB73_147712 [Zea mays]
Length=561

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 79/137 (58%), Gaps = 22/137 (16%)
 Frame = +3

Query  192  NASIASQKNSVINLEKGIQALSDRCRLWRGIMDERQGEIQLL---------LDKT----V  332
            +A I  Q+ S+   E G+Q      ++++  ++E+  +I+ L          DK     +
Sbjct  140  DACITIQQRSLSMFEDGLQNFLQLLQVFKSKVEEQCSKIEYLRNNMFQGEIFDKYFMSFL  199

Query  333  KVLAKKVYMEGILKQATDSRYLDLWSRQKLSSELDLK-QEHIR-----DMNKV---LTNQ  485
             +   + YM+GI+ Q++D++Y D+W+RQKLS E ++K Q  +R     +M+ V   LTNQ
Sbjct  200  PLFVMQTYMKGIVSQSSDNQYWDIWNRQKLSPEFEVKRQNSLRANQENNMSFVIQDLTNQ  259

Query  486  LIELERHFNILELNTFG  536
            L+ELERHFN LE+N  G
Sbjct  260  LVELERHFNNLEMNRSG  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880