BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS125B12

Length=444
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00977.1|  unnamed protein product                                301   2e-99   Coffea canephora [robusta coffee]
gb|EMT32045.1|  Phosphoenolpyruvate carboxylase 1                       294   7e-97   
emb|CAB59571.1|  phosphoenolpyruvate carboxylase                        293   2e-96   Vanilla planifolia [cultivated vanilla]
gb|AAZ06136.1|  phosphoenolpyruvate carboxylase                         296   4e-95   Brassica napus [oilseed rape]
ref|XP_007214986.1|  hypothetical protein PRUPE_ppa002020mg             299   2e-94   
dbj|BAD27731.1|  phosphoenolpyruvate carboxylase-like                   290   8e-94   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006411525.1|  hypothetical protein EUTSA_v10016192mg             297   2e-93   
dbj|BAJ33978.1|  unnamed protein product                                297   2e-93   Eutrema halophilum
emb|CDX75798.1|  BnaC03g38810D                                          296   2e-93   
ref|XP_010924612.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       301   3e-93   
ref|XP_009603289.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    301   5e-93   Nicotiana tomentosiformis
ref|XP_009795584.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    300   5e-93   Nicotiana sylvestris
emb|CAA62469.1|  phosphoenolpyruvate carboxylase                        300   5e-93   Solanum tuberosum [potatoes]
ref|NP_001274942.1|  phosphoenolpyruvate carboxylase                    300   5e-93   Solanum tuberosum [potatoes]
ref|XP_011098224.1|  PREDICTED: phosphoenolpyruvate carboxylase         300   5e-93   Sesamum indicum [beniseed]
gb|ABR29878.1|  phosphoenolpyruvate carboxylase                         300   5e-93   Ricinus communis
ref|XP_006358941.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    300   6e-93   
ref|XP_004243288.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    300   6e-93   Solanum lycopersicum
emb|CBI20195.3|  unnamed protein product                                300   6e-93   Vitis vinifera
gb|KJB82054.1|  hypothetical protein B456_013G173500                    296   6e-93   Gossypium raimondii
ref|XP_006348868.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    300   7e-93   Solanum tuberosum [potatoes]
gb|KDP32538.1|  hypothetical protein JCGZ_14741                         300   8e-93   Jatropha curcas
ref|XP_002518037.1|  Phosphoenolpyruvate carboxylase, putative          300   8e-93   
gb|KJB27013.1|  hypothetical protein B456_004G272100                    296   9e-93   Gossypium raimondii
ref|XP_010060690.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    300   9e-93   Eucalyptus grandis [rose gum]
emb|CDP06006.1|  unnamed protein product                                300   1e-92   Coffea canephora [robusta coffee]
ref|XP_002285441.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    300   1e-92   Vitis vinifera
ref|XP_009357178.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    300   1e-92   Pyrus x bretschneideri [bai li]
gb|EPS69468.1|  hypothetical protein M569_05291                         300   1e-92   Genlisea aurea
ref|NP_001267517.1|  phosphoenolpyruvate carboxylase, housekeepin...    300   1e-92   Cucumis sativus [cucumbers]
ref|XP_009598007.1|  PREDICTED: phosphoenolpyruvate carboxylase         300   1e-92   Nicotiana tomentosiformis
ref|XP_008229092.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       299   1e-92   Prunus mume [ume]
gb|AJP17168.1|  phosphoenolpyruvate carboxylase 2                       299   1e-92   Prunus sibirica [Siberian apricot]
dbj|BAB89367.1|  phosphoenolpyruvate carboxylase                        296   2e-92   Nicotiana sylvestris
ref|XP_008342775.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    299   2e-92   
gb|ADZ05827.1|  phosphoenolpyruvate carboxylase                         297   2e-92   Citrus maxima [buntan]
ref|XP_008463734.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    299   2e-92   Cucumis melo [Oriental melon]
emb|CDX82457.1|  BnaA03g33640D                                          295   2e-92   
gb|KDO44636.1|  hypothetical protein CISIN_1g002089mg                   297   2e-92   Citrus sinensis [apfelsine]
emb|CDX97618.1|  BnaA05g24610D                                          295   2e-92   
gb|AJD81370.1|  phosphoenolpyruvate carboxylase isoform 4               297   2e-92   Egeria densa
ref|XP_004251893.1|  PREDICTED: phosphoenolpyruvate carboxylase         299   2e-92   Solanum lycopersicum
gb|AFN70424.1|  phosphoenolpyruvate carboxylase                         299   2e-92   Manihot esculenta [manioc]
ref|XP_007021730.1|  Phosphoenolpyruvate carboxylase 3 isoform 3        297   2e-92   
gb|AFN70425.1|  phosphoenolpyruvate carboxylase                         298   3e-92   Manihot esculenta subsp. flabellifolia
emb|CAB65170.1|  phosphoenolpyruvate carboxylase 1                      298   3e-92   Solanum lycopersicum var. cerasiforme [cherry tomato]
sp|P16097.1|CAPP2_MESCR  RecName: Full=Phosphoenolpyruvate carbox...    298   3e-92   Mesembryanthemum crystallinum
emb|CDY25721.1|  BnaC03g69540D                                          297   3e-92   Brassica napus [oilseed rape]
ref|NP_188112.1|  phosphoenolpyruvate carboxylase 3                     298   3e-92   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FV65.1|CAPPC_FLATR  RecName: Full=Phosphoenolpyruvate carbox...    298   3e-92   Flaveria trinervia
ref|XP_010502354.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       298   3e-92   
ref|XP_010465426.1|  PREDICTED: phosphoenolpyruvate carboxylase 3...    298   3e-92   Camelina sativa [gold-of-pleasure]
ref|XP_006370158.1|  phosphoenolpyruvate carboxylase family protein     298   3e-92   Populus trichocarpa [western balsam poplar]
gb|KFK38845.1|  phosphoenolpyruvate carboxylase                         298   3e-92   Arabis alpina [alpine rockcress]
ref|XP_009416509.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    298   3e-92   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB13196.1|  hypothetical protein B456_002G061400                    298   4e-92   Gossypium raimondii
emb|CDY45929.1|  BnaC06g09980D                                          296   4e-92   Brassica napus [oilseed rape]
gb|AAK58636.1|AF271162_1  phosphoenolpyruvate carboxylase isoform 2     298   4e-92   Hydrilla verticillata
gb|KHG02548.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    298   4e-92   Gossypium arboreum [tree cotton]
ref|XP_002882904.1|  ATPPC3                                             298   4e-92   Arabidopsis lyrata subsp. lyrata
ref|XP_010920051.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    298   5e-92   
gb|KDP36288.1|  hypothetical protein JCGZ_09795                         298   5e-92   Jatropha curcas
gb|AAK58635.2|AF271161_1  phosphoenolpyruvate carboxylase isoform 1     298   5e-92   Hydrilla verticillata
ref|XP_009766373.1|  PREDICTED: phosphoenolpyruvate carboxylase         298   5e-92   Nicotiana sylvestris
gb|ABU41519.1|  phosphoenolpyruvate carboxylase                         298   5e-92   Jatropha curcas
ref|XP_006392801.1|  hypothetical protein EUTSA_v10011967mg             297   5e-92   
ref|XP_009783765.1|  PREDICTED: phosphoenolpyruvate carboxylase         298   5e-92   Nicotiana sylvestris
ref|XP_006407030.1|  hypothetical protein EUTSA_v10019997mg             298   5e-92   Eutrema salsugineum [saltwater cress]
gb|AAM14596.1|AF494191_1  phosphoenolpyruvate carboxylase FB966         298   5e-92   Flaveria brownii
ref|XP_009762944.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    298   5e-92   Nicotiana sylvestris
ref|XP_008813763.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    296   5e-92   
ref|XP_006442514.1|  hypothetical protein CICLE_v10018719mg             298   5e-92   Citrus clementina [clementine]
ref|XP_009607156.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    298   6e-92   Nicotiana tomentosiformis
ref|XP_007021728.1|  Phosphoenolpyruvate carboxylase 3 isoform 1        298   6e-92   
dbj|BAH19953.1|  AT1G53310                                              298   6e-92   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006487452.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    298   6e-92   Citrus sinensis [apfelsine]
ref|XP_006306679.1|  hypothetical protein CARUB_v10008196mg             298   6e-92   Capsella rubella
ref|NP_175738.1|  phosphoenolpyruvate carboxylase 1                     298   6e-92   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001275821.1|  phosphoenolpyruvate carboxylase                    298   6e-92   Citrus sinensis [apfelsine]
dbj|BAJ34480.1|  unnamed protein product                                298   6e-92   Eutrema halophilum
ref|XP_002894435.1|  ATPPC1                                             298   6e-92   
emb|CAA88829.1|  phosphoenolpyruvate carboxylase                        298   6e-92   Flaveria pringlei
ref|XP_010479886.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       298   6e-92   Camelina sativa [gold-of-pleasure]
pdb|3ZGB|A  Chain A, Greater Efficiency Of Photosynthetic Carbon ...    298   6e-92   Flaveria pringlei
ref|XP_010500970.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    298   7e-92   Camelina sativa [gold-of-pleasure]
gb|AJD81371.1|  phosphoenolpyruvate carboxylase isoform 5               298   7e-92   Egeria densa
gb|EYU45020.1|  hypothetical protein MIMGU_mgv1a000847mg                297   7e-92   Erythranthe guttata [common monkey flower]
ref|XP_002530381.1|  Phosphoenolpyruvate carboxylase, putative          297   7e-92   Ricinus communis
ref|XP_009106983.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       297   7e-92   Brassica rapa
emb|CAA11415.1|  phosphoenolpyruvate carboxylase                        297   7e-92   Brassica juncea [brown mustard]
gb|AAM14597.1|AF494192_1  phosphoenolpyruvate carboxylase FPUB966       297   8e-92   Flaveria pubescens
gb|EEC83482.1|  hypothetical protein OsI_28999                          292   8e-92   Oryza sativa Indica Group [Indian rice]
emb|CAC28225.1|  phosphoenolpyruvate carboxylase                        297   8e-92   Sesbania rostrata
sp|P51062.1|CAPP_PEA  RecName: Full=Phosphoenolpyruvate carboxyla...    297   8e-92   Pisum sativum [garden pea]
ref|XP_009604678.1|  PREDICTED: phosphoenolpyruvate carboxylase         297   8e-92   Nicotiana tomentosiformis
ref|XP_010413019.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    296   8e-92   Camelina sativa [gold-of-pleasure]
gb|ABR29876.1|  phosphoenolpyruvate carboxylase                         297   8e-92   Ricinus communis
gb|AJD81368.1|  phosphoenolpyruvate carboxylase isoform 2               297   9e-92   Egeria densa
gb|KDO63366.1|  hypothetical protein CISIN_1g002112mg                   293   9e-92   Citrus sinensis [apfelsine]
ref|XP_011029569.1|  PREDICTED: phosphoenolpyruvate carboxylase         297   9e-92   Populus euphratica
ref|XP_006306678.1|  hypothetical protein CARUB_v10008196mg             298   9e-92   
ref|XP_003596385.1|  Phosphoenolpyruvate-carboxylase                    297   9e-92   Medicago truncatula
gb|KEH19560.1|  phosphoenolpyruvate carboxylase                         295   1e-91   Medicago truncatula
gb|AAD22994.1|  phosphoenolpyruvate carboxylase                         296   1e-91   Arabidopsis thaliana [mouse-ear cress]
sp|Q02735.1|CAPP_MEDSA  RecName: Full=Phosphoenolpyruvate carboxy...    297   1e-91   Medicago sativa [alfalfa]
ref|XP_004303182.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       297   1e-91   Fragaria vesca subsp. vesca
ref|XP_006360045.1|  PREDICTED: phosphoenolpyruvate carboxylase-l...    297   1e-91   Solanum tuberosum [potatoes]
ref|XP_002316861.1|  phosphoenolpyruvate carboxylase family protein     297   1e-91   
emb|CAD58726.1|  phosphoenolpyruvate carboxylase                        297   1e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010277028.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    297   1e-91   Nelumbo nucifera [Indian lotus]
ref|XP_008793018.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    297   1e-91   Phoenix dactylifera
dbj|BAA03094.1|  phosphoenolpyruvate carboxylase                        297   1e-91   Brassica napus [oilseed rape]
ref|XP_006411524.1|  hypothetical protein EUTSA_v10016192mg             296   1e-91   Eutrema salsugineum [saltwater cress]
ref|XP_009142075.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       296   1e-91   Brassica rapa
emb|CDX98516.1|  BnaC05g38590D                                          296   1e-91   
emb|CDY51508.1|  BnaC04g02430D                                          296   1e-91   Brassica napus [oilseed rape]
gb|EMS60171.1|  Phosphoenolpyruvate carboxylase 2                       296   1e-91   Triticum urartu
ref|NP_850373.4|  phosphoenolpyruvate carboxylase 2                     296   1e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142853.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       296   1e-91   Brassica rapa
gb|KFK37112.1|  hypothetical protein AALP_AA4G214300                    296   1e-91   Arabis alpina [alpine rockcress]
ref|XP_008813762.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    296   1e-91   Phoenix dactylifera
ref|XP_010552117.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       296   1e-91   Tarenaya hassleriana [spider flower]
emb|CDY47982.1|  BnaA04g24600D                                          296   1e-91   Brassica napus [oilseed rape]
gb|AAP43628.1|  phosphoenolpyruvate carboxylase                         296   1e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881863.1|  phosphoenolpyruvate carboxylase                    296   2e-91   Arabidopsis lyrata subsp. lyrata
ref|XP_010508551.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       296   2e-91   Camelina sativa [gold-of-pleasure]
ref|XP_006293629.1|  hypothetical protein CARUB_v10022582mg             296   2e-91   Capsella rubella
ref|XP_007149740.1|  hypothetical protein PHAVU_005G095300g             296   2e-91   Phaseolus vulgaris [French bean]
emb|CDY55389.1|  BnaA05g34260D                                          296   2e-91   Brassica napus [oilseed rape]
ref|XP_006852422.1|  hypothetical protein AMTR_s00021p00059810          296   2e-91   Amborella trichopoda
ref|XP_009146304.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       296   2e-91   Brassica rapa
emb|CBI21984.3|  unnamed protein product                                296   2e-91   Vitis vinifera
dbj|BAJ97144.1|  predicted protein                                      296   2e-91   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABV80356.1|  phosphoenolpyruvate carboxylase                         296   2e-91   Gossypium hirsutum [American cotton]
ref|XP_003577980.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       296   2e-91   Brachypodium distachyon [annual false brome]
gb|EMT08272.1|  Phosphoenolpyruvate carboxylase 2                       296   2e-91   
ref|XP_006296907.1|  hypothetical protein CARUB_v10012899mg             296   2e-91   Capsella rubella
dbj|BAJ85327.1|  predicted protein                                      296   2e-91   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002280569.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    296   2e-91   Vitis vinifera
gb|KJB33217.1|  hypothetical protein B456_006G001300                    296   3e-91   Gossypium raimondii
ref|XP_004970018.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    296   3e-91   Setaria italica
ref|XP_004248242.1|  PREDICTED: phosphoenolpyruvate carboxylase         296   3e-91   Solanum lycopersicum
gb|KHG25331.1|  Phosphoenolpyruvate carboxylase 2                       296   4e-91   Gossypium arboreum [tree cotton]
gb|KEH19559.1|  phosphoenolpyruvate carboxylase                         295   4e-91   Medicago truncatula
emb|CDY14847.1|  BnaC04g48440D                                          295   4e-91   Brassica napus [oilseed rape]
ref|NP_001267665.1|  phosphoenolpyruvate carboxylase 2-like             295   4e-91   Cucumis sativus [cucumbers]
ref|XP_008455304.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       295   4e-91   
gb|ABY87944.1|  phosphoenolpyruvate carboxylase                         295   4e-91   Arachis hypogaea [goober]
ref|NP_001237394.1|  phosphoenolpyruvate carboxylase                    295   4e-91   Glycine max [soybeans]
gb|KHG25857.1|  Phosphoenolpyruvate carboxylase 2                       295   4e-91   Gossypium arboreum [tree cotton]
ref|XP_011100202.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    295   4e-91   Sesamum indicum [beniseed]
ref|XP_010915515.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    295   4e-91   Elaeis guineensis
gb|AAB80714.1|  phosphoenolpyruvate carboxylase 1                       295   4e-91   Gossypium hirsutum [American cotton]
ref|XP_004516076.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    295   5e-91   Cicer arietinum [garbanzo]
gb|KJB27012.1|  hypothetical protein B456_004G272100                    295   5e-91   Gossypium raimondii
ref|XP_010108239.1|  Phosphoenolpyruvate carboxylase, housekeepin...    298   5e-91   
ref|XP_009406237.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    295   5e-91   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB82053.1|  hypothetical protein B456_013G173500                    295   5e-91   Gossypium raimondii
gb|KHN36697.1|  Phosphoenolpyruvate carboxylase 2                       295   5e-91   Glycine soja [wild soybean]
emb|CAA09588.1|  phosphoenolpyruvate-carboxylase                        295   5e-91   Vicia faba [broad bean]
gb|AAO42888.1|  At3g14940                                               295   6e-91   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FV66.1|CAPPB_FLATR  RecName: Full=Phosphoenolpyruvate carbox...    295   7e-91   Flaveria trinervia
tpg|DAA61011.1|  TPA: phosphoenolpyruvate carboxylase4                  295   7e-91   
emb|CAA11414.1|  phosphoenolpyrovate carboxylase                        295   7e-91   Brassica juncea [brown mustard]
dbj|BAC20364.1|  phosphoenolpyruvate carboxylase                        295   7e-91   Lotus japonicus
ref|XP_007133202.1|  hypothetical protein PHAVU_011G160200g             295   7e-91   Phaseolus vulgaris [French bean]
gb|ACO48251.1|  phosphoenolpyruvate carboxylase                         295   8e-91   Arachis hypogaea [goober]
ref|XP_009135413.1|  PREDICTED: phosphoenolpyruvate carboxylase 3       295   8e-91   Brassica rapa
ref|NP_001105438.1|  phosphoenolpyruvate carboxylase 2                  295   9e-91   Zea mays [maize]
ref|XP_006582125.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    291   1e-90   Glycine max [soybeans]
emb|CAA81072.1|  phosphoenolpyruvate carboxylase                        294   1e-90   Flaveria trinervia
sp|P30694.2|CAPPA_FLATR  RecName: Full=C4 phosphoenolpyruvate car...    294   1e-90   Flaveria trinervia
gb|AAY28730.1|  phosphoenolpyruvate carboxylase                         294   1e-90   Alternanthera ficoidea [sanguinarea]
gb|ACC66283.1|  phosphoenolpyruvate carboxylase                         294   1e-90   Suaeda glauca
gb|AJD81367.1|  phosphoenolpyruvate carboxylase isoform 1               294   1e-90   Egeria densa
gb|EYU41129.1|  hypothetical protein MIMGU_mgv1a000842mg                294   1e-90   Erythranthe guttata [common monkey flower]
pdb|3ZGE|A  Chain A, Greater Efficiency Of Photosynthetic Carbon ...    295   1e-90   Flaveria trinervia
emb|CAM83969.2|  phosphoenolpyruvate carboxylase                        290   1e-90   Cyrtococcum patens
gb|KDO63365.1|  hypothetical protein CISIN_1g002112mg                   293   1e-90   Citrus sinensis [apfelsine]
pdb|4BXH|B  Chain B, Resolving The Activation Site Of Positive Re...    295   1e-90   Flaveria trinervia
ref|XP_002462179.1|  hypothetical protein SORBIDRAFT_02g021090          294   1e-90   Sorghum bicolor [broomcorn]
ref|XP_010104390.1|  Phosphoenolpyruvate carboxylase 2                  294   1e-90   Morus notabilis
sp|P29194.1|CAPP2_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    294   1e-90   Sorghum bicolor [broomcorn]
sp|P27154.1|CAPP_TOBAC  RecName: Full=Phosphoenolpyruvate carboxy...    294   1e-90   Nicotiana tabacum [American tobacco]
emb|CDM84220.1|  unnamed protein product                                292   2e-90   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007149391.1|  hypothetical protein PHAVU_005G066400g             294   2e-90   Phaseolus vulgaris [French bean]
gb|AAD45696.1|AF159051_1  phosphoenolpyruvate carboxylase               293   2e-90   Picea abies
dbj|BAC20365.1|  phosphoenolpyruvate carboxylase                        294   2e-90   Lotus japonicus
gb|AAK58637.1|AF271163_1  phosphoenolpyruvate carboxylase isoform 3     294   2e-90   Hydrilla verticillata
ref|XP_011005507.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    294   2e-90   Populus euphratica
ref|XP_003527347.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    293   2e-90   Glycine max [soybeans]
gb|KHN36882.1|  Phosphoenolpyruvate carboxylase                         293   2e-90   Glycine soja [wild soybean]
ref|XP_009354255.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       293   2e-90   Pyrus x bretschneideri [bai li]
ref|XP_006593478.1|  PREDICTED: phosphoenolpyruvate carboxylase i...    293   2e-90   
gb|ACO48250.1|  phosphoenolpyruvate carboxylase                         293   2e-90   Arachis hypogaea [goober]
ref|NP_001236741.1|  phosphoenolpyruvate carboxylase                    293   2e-90   
ref|XP_010553399.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    293   2e-90   Tarenaya hassleriana [spider flower]
ref|XP_011082759.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    293   2e-90   Sesamum indicum [beniseed]
gb|ABR17346.1|  unknown                                                 293   2e-90   Picea sitchensis
ref|XP_007213682.1|  hypothetical protein PRUPE_ppa000910mg             293   2e-90   Prunus persica
ref|XP_010675388.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       293   2e-90   Beta vulgaris subsp. vulgaris [field beet]
sp|P51063.1|CAPP_PICAB  RecName: Full=Phosphoenolpyruvate carboxy...    293   3e-90   Picea abies
ref|NP_001241357.1|  phosphoenolpyruvate carboxylase                    293   3e-90   Glycine max [soybeans]
ref|XP_008226531.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    293   3e-90   Prunus mume [ume]
ref|XP_009395707.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       293   3e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010524060.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       293   3e-90   Tarenaya hassleriana [spider flower]
dbj|BAC41248.1|  phosphoenolpyruvate carboxylase                        293   3e-90   Glycine max [soybeans]
emb|CDP15935.1|  unnamed protein product                                293   3e-90   Coffea canephora [robusta coffee]
ref|XP_006469015.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    293   3e-90   
ref|XP_008368627.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    291   3e-90   
gb|KDO63363.1|  hypothetical protein CISIN_1g002112mg                   293   4e-90   Citrus sinensis [apfelsine]
ref|XP_006446789.1|  hypothetical protein CICLE_v10014164mg             293   4e-90   Citrus clementina [clementine]
gb|EMS57465.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    294   4e-90   Triticum urartu
gb|AAU07998.1|  phosphoenolpyruvate carboxylase 3                       293   4e-90   Lupinus albus
gb|ACN32213.1|  phosphoenolpyruvate carboxylase                         293   4e-90   Arachis hypogaea [goober]
ref|XP_008655339.1|  PREDICTED: uncharacterized protein LOC100384...    293   4e-90   
ref|XP_006660531.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    293   5e-90   
emb|CAJ84247.1|  phosphoenolpyruvate carboxylase                        292   5e-90   Lupinus luteus
sp|P29193.1|CAPP1_SACHY  RecName: Full=Phosphoenolpyruvate carbox...    292   5e-90   Saccharum sp.
dbj|BAD36412.1|  putative phosphoenolpyruvate carboxylase               292   6e-90   Oryza sativa Japonica Group [Japonica rice]
emb|CBM56258.1|  C3 phosphoenolpyruvate carboxylase                     292   6e-90   Panicum bisulcatum [Japanese panicgrass]
ref|XP_003607582.1|  Phosphoenolpyruvate carboxylase                    292   6e-90   Medicago truncatula
ref|XP_008362419.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       292   6e-90   
ref|XP_009342319.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    291   6e-90   Pyrus x bretschneideri [bai li]
ref|XP_010542308.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    292   7e-90   Tarenaya hassleriana [spider flower]
ref|XP_004956559.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    292   7e-90   Setaria italica
ref|XP_010527380.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    292   7e-90   Tarenaya hassleriana [spider flower]
gb|EAZ08566.1|  hypothetical protein OsI_30839                          292   7e-90   Oryza sativa Indica Group [Indian rice]
gb|AJD81369.1|  phosphoenolpyruvate carboxylase isoform 3               292   8e-90   Egeria densa
ref|XP_008386247.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    292   8e-90   Malus domestica [apple tree]
ref|XP_007048690.1|  Phosphoenolpyruvate carboxylase 3 isoform 1        292   8e-90   
dbj|BAF80187.1|  phosphoenolpyruvate carboxylase                        292   8e-90   Aloe arborescens
ref|NP_001237602.1|  phosphoenolpyruvate carboxylase, housekeepin...    292   9e-90   Glycine max [soybeans]
ref|XP_010052683.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       291   1e-89   Eucalyptus grandis [rose gum]
sp|Q9AU12.1|CAPP_PHAVU  RecName: Full=Phosphoenolpyruvate carboxy...    291   1e-89   Phaseolus vulgaris [French bean]
gb|AAY28731.1|  phosphoenolpyruvate carboxylase                         291   1e-89   Alternanthera sessilis
ref|XP_009334045.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    291   1e-89   Pyrus x bretschneideri [bai li]
ref|NP_001105503.1|  phosphoenolpyruvate carboxylase                    291   1e-89   Zea mays [maize]
ref|XP_002451855.1|  hypothetical protein SORBIDRAFT_04g008720          291   1e-89   Sorghum bicolor [broomcorn]
ref|XP_006659319.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    291   1e-89   Oryza brachyantha
dbj|BAJ87123.1|  predicted protein                                      291   1e-89   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P29195.1|CAPP1_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    291   1e-89   Sorghum bicolor [broomcorn]
gb|AAG00180.1|AF271995_1  phosphoenolpyruvate carboxylase               291   2e-89   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046417.1|  Os02g0244700                                       291   2e-89   
gb|EEC72817.1|  hypothetical protein OsI_06526                          291   2e-89   Oryza sativa Indica Group [Indian rice]
sp|Q01647.1|CAPP1_FLAPR  RecName: Full=Phosphoenolpyruvate carbox...    291   2e-89   Flaveria pringlei
gb|EMS68413.1|  Phosphoenolpyruvate carboxylase 1                       285   2e-89   Triticum urartu
gb|AAP06951.1|  phosphoenolpyruvate carboxylase                         291   2e-89   Echinochloa crus-galli [barnyard grass]
ref|NP_001061646.1|  Os08g0366000                                       291   2e-89   
gb|AAO15570.1|AF459644_1  phosphoenolpyruvate carboxylase               291   2e-89   Lupinus albus
ref|NP_001044301.1|  Os01g0758300                                       290   2e-89   
ref|XP_006647114.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    291   2e-89   Oryza brachyantha
ref|XP_007132856.1|  hypothetical protein PHAVU_011G130400g             291   2e-89   Phaseolus vulgaris [French bean]
gb|AAU07997.1|  phosphoenolpyruvate carboxylase 2                       291   2e-89   Lupinus albus
ref|XP_006644735.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    291   2e-89   Oryza brachyantha
gb|ABY56044.1|  phosphoenolpyruvate carboxylase                         291   2e-89   Malus domestica [apple tree]
gb|ABG20461.1|  phosphoenolpyruvate carboxylase                         288   2e-89   Suaeda eltonica
gb|EEE55407.1|  hypothetical protein OsJ_03516                          291   3e-89   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010689827.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       290   3e-89   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA09807.1|  ppc2                                                   290   3e-89   Solanum tuberosum [potatoes]
prf||1801241A  phosphoenolpyruvate carboxylase                          290   3e-89
ref|XP_002458521.1|  hypothetical protein SORBIDRAFT_03g035090          290   3e-89   
gb|ABG01962.1|  phosphoenolpyruvate carboxylase                         290   3e-89   Sesuvium portulacastrum [sea-purslane]
ref|XP_003527207.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    290   4e-89   Glycine max [soybeans]
ref|XP_009404506.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    290   4e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN48472.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    290   4e-89   Glycine soja [wild soybean]
ref|XP_009340037.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    290   4e-89   Pyrus x bretschneideri [bai li]
gb|AEG78834.1|  phosphoenolpyruvate carboxylase                         290   5e-89   Dendrobium officinale
ref|XP_008367955.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    290   6e-89   
ref|XP_002302820.2|  hypothetical protein POPTR_0002s22720g             290   6e-89   
ref|XP_004505496.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    289   7e-89   Cicer arietinum [garbanzo]
ref|XP_010925637.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    289   7e-89   
ref|XP_011012152.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    289   7e-89   Populus euphratica
ref|XP_003571949.1|  PREDICTED: phosphoenolpyruvate carboxylase 1       289   7e-89   Brachypodium distachyon [annual false brome]
ref|XP_006348299.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    289   7e-89   
emb|CAC86034.1|  phosphoenolpyruvate carboxylase 2                      289   7e-89   Solanum lycopersicum
ref|XP_004294066.1|  PREDICTED: phosphoenolpyruvate carboxylase 2       289   8e-89   Fragaria vesca subsp. vesca
emb|CAB65171.1|  phosphoenolpyruvate carboxylase 2                      289   8e-89   Solanum lycopersicum var. cerasiforme [cherry tomato]
ref|XP_010324389.1|  PREDICTED: phosphoenolpyruvate carboxylase         289   8e-89   
ref|NP_001267742.1|  phosphoenolpyruvate carboxylase 1                  289   8e-89   
ref|XP_008812088.1|  PREDICTED: SCAR-like protein 2                     295   1e-88   
ref|XP_002444204.1|  hypothetical protein SORBIDRAFT_07g014960          289   1e-88   
gb|KJB48959.1|  hypothetical protein B456_008G095300                    288   1e-88   
gb|EMT25785.1|  Phosphoenolpyruvate carboxylase 1                       286   2e-88   
sp|P10490.1|CAPP1_MESCR  RecName: Full=Phosphoenolpyruvate carbox...    288   2e-88   
ref|XP_010279120.1|  PREDICTED: phosphoenolpyruvate carboxylase, ...    288   2e-88   
gb|KHG11000.1|  Phosphoenolpyruvate carboxylase, housekeeping iso...    288   2e-88   
gb|ADO15315.1|  C4 photosynthetic phosphoenolpyruvate                   288   2e-88   
ref|XP_008781416.1|  PREDICTED: LOW QUALITY PROTEIN: SCAR-like pr...    293   2e-88   
gb|ABG20460.1|  phosphoenolpyruvate carboxylase                         286   2e-88   
emb|CAA07610.1|  phospoenolpyruvate carboxylase                         288   2e-88   
ref|XP_008676434.1|  PREDICTED: uncharacterized protein LOC100191...    288   2e-88   
dbj|BAC19851.1|  phosphoenolpyruvate carboxylase                        288   3e-88   
gb|AAU07999.1|  phosphoenolpyruvate carboxylase 4                       288   3e-88   
gb|EPS65212.1|  hypothetical protein M569_09565                         270   4e-88   
emb|CAA45504.1|  phosphoenolpyruvate carboxylase                        287   4e-88   
ref|XP_009380945.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    287   5e-88   
ref|XP_004297535.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    287   5e-88   
emb|CAA60626.1|  phosphoenolpyruvate-carboxylase                        287   6e-88   
gb|AAO25631.1|  phosphoenolpyruvate carboxylase                         286   7e-88   
emb|CAA60627.1|  phosphoenolpyruvate-carboxylase                        286   8e-88   
ref|XP_003563811.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    286   9e-88   
gb|AAD31452.1|AF135371_1  phosphoenol pyruvate carboxylase              286   9e-88   
ref|XP_003597124.1|  Phosphoenolpyruvate carboxylase                    286   1e-87   
gb|EYU26325.1|  hypothetical protein MIMGU_mgv1a000844mg                286   1e-87   
gb|AHF21553.1|  phosphoenolpyruvate carboxylase                         286   2e-87   
dbj|BAJ94338.1|  predicted protein                                      285   2e-87   
ref|XP_003543306.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    285   2e-87   
ref|XP_010232351.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoenolp...    285   2e-87   
sp|Q43299.1|CAPP_AMAHP  RecName: Full=Phosphoenolpyruvate carboxy...    285   4e-87   
gb|AIR93775.1|  phosphoenolpyruvate carboxylase                         284   6e-87   
gb|AAY28729.1|  phosphoenolpyruvate carboxylase                         284   8e-87   
emb|CAC83481.1|  phosphoenolpyruvate carboxylase                        283   1e-86   
emb|CAC83482.1|  phosphoenolpyruvate carboxylase                        283   1e-86   
gb|ABG20459.1|  phosphoenolpyruvate carboxylase                         283   2e-86   
emb|CAM83972.2|  phosphoenolpyruvate carboxylase                        281   4e-86   
gb|ABR24265.1|  PhtY                                                    281   9e-86   
emb|CAA62747.1|  phosphoenolpyruvate carboxylase                        280   2e-85   
ref|NP_001267758.1|  phosphoenolpyruvate carboxylase 1-like             280   2e-85   
ref|XP_004487157.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    278   1e-84   
dbj|BAI78342.1|  phosphoenolpyruvate carboxylase                        276   6e-84   
gb|AAM95946.1|  phosphoenolpyruvate carboxylase                         275   9e-84   
ref|XP_002513286.1|  2-alkenal reductase, putative                      259   1e-83   
gb|ADV92634.1|  phosphoenolpyruvate carboxylase                         275   1e-83   
ref|XP_002985372.1|  hypothetical protein SELMODRAFT_122213             274   2e-83   
ref|XP_002979664.1|  hypothetical protein SELMODRAFT_111216             274   2e-83   
ref|XP_004489030.1|  PREDICTED: phosphoenolpyruvate carboxylase-like    274   3e-83   
ref|XP_002990195.1|  hypothetical protein SELMODRAFT_447920             273   5e-83   
ref|XP_002992495.1|  hypothetical protein SELMODRAFT_269944             273   6e-83   
emb|CAC86364.1|  putative phosphoenolpyruvate carboxylase               261   7e-83   
emb|CCB84879.1|  phosphoenolpyruvate carboxylase                        271   1e-82   
ref|XP_001782799.1|  predicted protein                                  271   3e-82   
gb|AAG42288.1|  phosphoenolpyruvate carboxylase                         271   3e-82   
gb|AAX98688.3|  C4 phosphoenolpyruvate carboxylase                      271   6e-82   
ref|XP_001766239.1|  predicted protein                                  270   1e-81   
ref|XP_001773964.1|  predicted protein                                  269   2e-81   
emb|CCA60995.1|  phosphoenolpyruvate carboxylase                        267   9e-81   
emb|CCA60994.1|  phosphoenolpyruvate carboxylase                        265   1e-80   
emb|CAA33663.1|  P-pyruvate carboxylase                                 266   2e-80   
gb|ACJ38542.1|  phosphoenolpyruvate carboxylase                         266   2e-80   
emb|CAD60555.1|  phosphoenolpyruvate carboxylase                        266   2e-80   
emb|CAA27270.1|  PEPCase                                                266   2e-80   
ref|NP_001154820.1|  uncharacterized protein LOC100191762               266   2e-80   
gb|ADW27477.1|  phosphoenolpyruvate carboxylase                         266   2e-80   
emb|CAC86366.1|  putative phosphoenolpyruvate carboxylase               254   2e-80   
ref|XP_001760595.1|  predicted protein                                  265   4e-80   
dbj|BAK09196.1|  phosphoenolpyruvate carboxylase                        265   6e-80   
ref|XP_001774499.1|  predicted protein                                  265   7e-80   
dbj|BAK09195.1|  phosphoenolpyruvate carboxylase                        265   7e-80   
ref|NP_001042358.1|  Os01g0208700                                       265   7e-80   
gb|EAY72974.1|  hypothetical protein OsI_00846                          265   8e-80   
ref|XP_006643893.1|  PREDICTED: phosphoenolpyruvate carboxylase 1...    265   1e-79   
emb|CBT21623.1|  C4 phosphoenolpyruvate carboxylase                     264   1e-79   
emb|CAC86371.1|  putative phosphoenolpyruvate carboxylase               251   2e-79   
emb|CAC85930.1|  putative phosphoenolpyruvate carboxylase               264   2e-79   
dbj|BAK09198.1|  phosphoenolpyruvate carboxylase                        264   2e-79   
dbj|BAK09197.1|  phosphoenolpyruvate carboxylase                        264   2e-79   
ref|NP_001105418.1|  phosphoenolpyruvate carboxylase 1                  264   2e-79   
emb|CAC08829.1|  putative C4 phosphoenolpyruvate carboxylase            263   4e-79   
gb|AAN15222.1|  putative C4 phosphoenolpyruvate carboxylase             263   4e-79   
emb|CCA60991.1|  phosphoenolpyruvate carboxylase                        261   4e-79   
emb|CAC86369.1|  putative phosphoenolpyruvate carboxylase               251   4e-79   
emb|CAC09415.1|  putative C4 Phosphoenolpyruvate carboxylase            249   1e-78   
emb|CAC86357.1|  putative phosphoenolpyruvate carboxylase               249   2e-78   
ref|XP_001757859.1|  predicted protein                                  260   4e-78   
emb|CBT21624.1|  phosphoenolpyruvate carboxylase                        256   4e-78   
emb|CBY89214.1|  phosphoenolpyruvate carboxylase                        256   7e-78   
emb|CBV65831.1|  phosphoenolpyruvate carboxylase                        255   7e-78   
emb|CAC86367.1|  putative phosphoenolpyruvate carboxylase               247   8e-78   
emb|CAC86386.1|  putative phosphoenolpyruvate carboxylase               248   8e-78   
gb|EMT14603.1|  Phosphoenolpyruvate carboxylase 1                       259   9e-78   
emb|CAC86365.1|  putative phosphoenolpyruvate carboxylase               247   9e-78   
emb|CAC86385.1|  phosphoenolpyruvate carboxylase                        248   1e-77   
emb|CDM82240.1|  unnamed protein product                                259   1e-77   
emb|CAC86356.1|  putative phosphoenolpyruvate carboxylase               247   1e-77   
emb|CBR26851.1|  phosphoenolpyruvate carboxylase                        256   1e-77   
sp|P15804.2|CAPP3_SORBI  RecName: Full=Phosphoenolpyruvate carbox...    258   2e-77   
ref|XP_002438521.1|  hypothetical protein SORBIDRAFT_10g021330          258   2e-77   
emb|CAC86360.1|  putative phosphoenolpyruvate carboxylase               246   3e-77   
dbj|BAJ85848.1|  predicted protein                                      256   4e-77   
emb|CAC86361.1|  putative phosphoenolpyruvate carboxylase               245   4e-77   
dbj|BAJ90026.1|  predicted protein                                      256   4e-77   
emb|CAC86358.1|  putative phosphoenolpyruvate carboxylase               245   8e-77   
emb|CBR26850.1|  phosphoenolpyruvate carboxylase                        252   9e-77   
dbj|BAJ96977.1|  predicted protein                                      256   1e-76   
emb|CBL93742.1|  phosphoenolpyruvate carboxylase                        254   1e-76   
emb|CAM83970.2|  phosphoenolpyruvate carboxylase                        254   1e-76   
emb|CBT21625.1|  phosphoenolpyruvate carboxylase                        253   2e-76   
emb|CAC86387.1|  putative phosphoenolpyruvate carboxylase               243   8e-76   
emb|CAC86370.1|  putative phosphoenolpyruvate carboxylase               241   3e-75   
gb|EEE56642.1|  hypothetical protein OsJ_06051                          251   6e-75   
ref|XP_003565329.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    251   8e-75   
ref|XP_004968594.1|  PREDICTED: phosphoenolpyruvate carboxylase 2...    249   3e-74   
emb|CAC86368.1|  putative phosphoenolpyruvate carboxylase               237   8e-74   
emb|CAJ86550.1|  phosphoenolpyrovate carboxylase                        238   2e-70   
emb|CAC86359.1|  putative phosphoenolpyruvate carboxylase               225   3e-69   
ref|XP_007048691.1|  Phosphoenolpyruvate carboxylase 1 isoform 2        234   3e-69   
emb|CBV65830.1|  phosphoenolpyruvate carboxylase                        231   1e-68   
gb|AAW29038.1|  phosphoenolpyruvate carboxylase                         206   3e-65   
gb|AAW29041.1|  phosphoenolpyruvate carboxylase                         206   3e-65   
gb|AAW29048.1|  phosphoenolpyruvate carboxylase                         206   3e-65   
dbj|BAA05395.1|  phosphoenolpyruvate carboxylase                        205   6e-65   
gb|AAW29049.1|  phosphoenolpyruvate carboxylase                         205   1e-64   
gb|EMS62961.1|  SCAR-like protein 2                                     225   2e-64   
gb|AAW29043.1|  phosphoenolpyruvate carboxylase                         204   2e-64   
gb|AAW29042.1|  phosphoenolpyruvate carboxylase                         203   5e-64   
gb|AAW29036.1|  phosphoenolpyruvate carboxylase                         203   7e-64   
gb|AAW29056.1|  phosphoenolpyruvate carboxylase                         202   9e-64   
gb|AAW29051.1|  phosphoenolpyruvate carboxylase                         201   3e-63   
gb|AAW29060.1|  phosphoenolpyruvate carboxylase                         201   3e-63   
dbj|BAA05397.1|  phosphoenolpyruvate carboxylase                        200   4e-63   
gb|AAW29046.1|  phosphoenolpyruvate carboxylase                         201   4e-63   
gb|AAW29057.1|  phosphoenolpyruvate carboxylase                         199   2e-62   
gb|AAW29052.1|  phosphoenolpyruvate carboxylase                         197   1e-61   
gb|AAW29065.1|  phosphoenolpyruvate carboxylase                         196   4e-61   
gb|AAW29058.1|  phosphoenolpyruvate carboxylase                         192   6e-60   
gb|AAW29040.1|  phosphoenolpyruvate carboxylase                         192   1e-59   
gb|AAW29059.1|  phosphoenolpyruvate carboxylase                         190   5e-59   
gb|AAW29037.1|  phosphoenolpyruvate carboxylase                         185   2e-57   
pir||PC2170  phosphoenolpyruvate carboxykinase (diphosphate) (EC ...    185   9e-54
emb|CCA60992.1|  phosphoenolpyruvate carboxylase                        182   2e-53   
dbj|BAB89366.1|  phosphoenolpyruvate carboxylase                        185   7e-52   
emb|CBL58439.1|  phosphoenol pyruvate carboxykinase                     168   1e-50   
emb|CBL58438.1|  phosphoenol pyruvate carboxykinase                     167   3e-50   
ref|XP_003055786.1|  predicted protein                                  173   7e-47   
ref|XP_011401423.1|  Phosphoenolpyruvate carboxylase 1                  172   2e-46   
emb|CAB81955.1|  phosphoenolpyruvate carboxylase                        166   2e-46   
ref|XP_007511037.1|  phosphoenolpyruvate carboxylase                    172   3e-46   
gb|ABB55689.1|  phosphoenolpyruvate carboxylase                         156   5e-46   
gb|ABB55697.1|  phosphoenolpyruvate carboxylase                         155   9e-46   
gb|ABB55629.1|  phosphoenolpyruvate carboxylase                         155   1e-45   
ref|XP_005844287.1|  hypothetical protein CHLNCDRAFT_37051              170   1e-45   
emb|CDY32330.1|  BnaC01g36490D                                          159   1e-45   
gb|AGE02926.1|  phosphoenolpyruvate carboxylase                         155   2e-45   
emb|CCA60993.1|  phosphoenolpyruvate carboxylase                        167   2e-45   
gb|ABB55649.1|  phosphoenolpyruvate carboxylase                         155   2e-45   
gb|ABB55757.1|  phosphoenolpyruvate carboxylase                         154   2e-45   
gb|AAL10621.1|  phosphoenolpyruvate carboxylase                         154   2e-45   
gb|ABB55759.1|  phosphoenolpyruvate carboxylase                         154   2e-45   
gb|ABB55652.1|  phosphoenolpyruvate carboxylase                         154   2e-45   
gb|AAL10608.1|  phosphoenolpyruvate carboxylase                         154   2e-45   
gb|ABB55740.1|  phosphoenolpyruvate carboxylase                         154   2e-45   
gb|AGE02935.1|  phosphoenolpyruvate carboxylase                         154   3e-45   
gb|ABB55682.1|  phosphoenolpyruvate carboxylase                         154   3e-45   
gb|ABB55640.1|  phosphoenolpyruvate carboxylase                         154   3e-45   
gb|AAL10646.1|  phosphoenolpyruvate carboxylase                         154   3e-45   
gb|ABB55646.1|  phosphoenolpyruvate carboxylase                         154   4e-45   
gb|ABB55702.1|  phosphoenolpyruvate carboxylase                         154   4e-45   
gb|ABB55636.1|  phosphoenolpyruvate carboxylase                         154   4e-45   
gb|ABB55753.1|  phosphoenolpyruvate carboxylase                         154   4e-45   
gb|ABB55647.1|  phosphoenolpyruvate carboxylase                         154   4e-45   
gb|ABB55692.1|  phosphoenolpyruvate carboxylase                         154   4e-45   
gb|AAL10638.1|  phosphoenolpyruvate carboxylase                         154   4e-45   
gb|AAL10626.1|  phosphoenolpyruvate carboxylase                         153   5e-45   
gb|ABB55675.1|  phosphoenolpyruvate carboxylase                         153   5e-45   
gb|ABB55653.1|  phosphoenolpyruvate carboxylase                         153   5e-45   
gb|AAO32324.1|  phosphoenolpyruvate carboxylase PepC-small              153   5e-45   
gb|ABB55781.1|  phosphoenolpyruvate carboxylase                         153   5e-45   
ref|XP_002949515.1|  hypothetical protein VOLCADRAFT_59445              168   6e-45   
gb|ABB55690.1|  phosphoenolpyruvate carboxylase                         153   6e-45   
gb|ABB55731.1|  phosphoenolpyruvate carboxylase                         153   6e-45   
gb|ABB55746.1|  phosphoenolpyruvate carboxylase                         153   6e-45   
gb|AAL10649.1|  phosphoenolpyruvate carboxylase                         153   6e-45   
gb|ABB55727.1|  phosphoenolpyruvate carboxylase                         153   7e-45   
gb|ABB55691.1|  phosphoenolpyruvate carboxylase                         153   7e-45   
gb|ABB55771.1|  phosphoenolpyruvate carboxylase                         153   7e-45   
gb|AAL71972.1|  phosphoenolpyruvate carboxylase                         153   7e-45   
gb|ABB55650.1|  phosphoenolpyruvate carboxylase                         153   7e-45   
gb|ABB55683.1|  phosphoenolpyruvate carboxylase                         153   8e-45   
gb|ABB55710.1|  phosphoenolpyruvate carboxylase                         153   8e-45   
ref|XP_002499417.1|  phosphoenolpyruvate carboxylase                    167   8e-45   
gb|ABB55688.1|  phosphoenolpyruvate carboxylase                         153   8e-45   
sp|P81831.2|CAPP1_CHLRE  RecName: Full=Phosphoenolpyruvate carbox...    167   8e-45   
gb|ABB55794.1|  phosphoenolpyruvate carboxylase                         153   9e-45   
gb|ABB55693.1|  phosphoenolpyruvate carboxylase                         152   9e-45   
gb|ABB55637.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|AAL10632.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|ABB55779.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|AAL71960.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|ABB55659.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|ABB55749.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|ABB55656.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|ABB55791.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|ABB55627.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
gb|ABB55635.1|  phosphoenolpyruvate carboxylase                         152   1e-44   
ref|XP_005652003.1|  PEPCase 1                                          166   2e-44   
gb|AAL71915.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|ABB55628.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
ref|XP_003082445.1|  phosphoenolpyruvate carboxylase 2; LaPEPC2 (...    167   2e-44   
gb|AAL10648.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|ABB55661.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
emb|CEF99981.1|  Phosphoenolpyruvate carboxylase                        166   2e-44   
gb|AGE02921.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|AAL71931.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|AAL71957.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|AAL71958.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|AAL71926.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|AAL10611.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|AAL10639.1|  phosphoenolpyruvate carboxylase                         152   2e-44   
gb|ABB55638.1|  phosphoenolpyruvate carboxylase                         152   2e-44   



>emb|CDP00977.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|EMT32045.1| Phosphoenolpyruvate carboxylase 1 [Aegilops tauschii]
Length=330

 Score =   294 bits (753),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  220  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>emb|CAB59571.1| phosphoenolpyruvate carboxylase [Vanilla planifolia]
Length=335

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEAL RE
Sbjct  146  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALHRE  205

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKN+GINER+PYNA
Sbjct  206  IQAAFRTDEIRRIPPTPQDEMRAGMSYFHETIWKGVPQFLRRVDTALKNLGINERLPYNA  265

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  266  PLIQFSSWMGGDRDGNPRVTPEVTRDV  292



>gb|AAZ06136.1| phosphoenolpyruvate carboxylase [Brassica napus]
Length=526

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  27   VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  86

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  87   IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  146

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  147  PLIQFSSWMGGDRDGNPRVTPEVTRDV  173



>ref|XP_007214986.1| hypothetical protein PRUPE_ppa002020mg [Prunus persica]
 gb|EMJ16185.1| hypothetical protein PRUPE_ppa002020mg [Prunus persica]
Length=728

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+R+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARVRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>dbj|BAD27731.1| phosphoenolpyruvate carboxylase-like [Oryza sativa Japonica Group]
Length=452

 Score =   290 bits (743),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  220  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>ref|XP_006411525.1| hypothetical protein EUTSA_v10016192mg [Eutrema salsugineum]
 gb|ESQ52978.1| hypothetical protein EUTSA_v10016192mg [Eutrema salsugineum]
Length=732

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  148  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  207

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  208  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  267

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  268  PLIQFSSWMGGDRDGNPRVTPEVTRDV  294



>dbj|BAJ33978.1| unnamed protein product [Thellungiella halophila]
Length=740

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>emb|CDX75798.1| BnaC03g38810D [Brassica napus]
Length=712

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  123  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  182

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  183  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNA  242

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  243  PLIQFSSWMGGDRDGNPRVTPEVTRDV  269



>ref|XP_010924612.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Elaeis guineensis]
Length=966

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009603289.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
Length=964

 Score =   301 bits (770),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+RDCL QLY KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARVRDCLTQLYAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>ref|XP_009795584.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana sylvestris]
Length=964

 Score =   300 bits (769),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+RDCL QLY KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARVRDCLTQLYAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>emb|CAA62469.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
Length=965

 Score =   300 bits (769),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDA+KN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDAIKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|NP_001274942.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
 sp|P29196.2|CAPP_SOLTU RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Solanum tuberosum]
 emb|CAA47437.1| phosphoenolpyruvate carboxylase [Solanum tuberosum]
Length=965

 Score =   300 bits (769),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDA+KN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDAIKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_011098224.1| PREDICTED: phosphoenolpyruvate carboxylase [Sesamum indicum]
Length=964

 Score =   300 bits (769),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERIPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|ABR29878.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=965

 Score =   300 bits (769),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006358941.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=965

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDA+KN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDAIKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_004243288.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum lycopersicum]
Length=964

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIRDC+ QLY KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCMTQLYAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>emb|CBI20195.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   300 bits (767),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|KJB82054.1| hypothetical protein B456_013G173500 [Gossypium raimondii]
Length=750

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  162  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALGRE  221

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHET+WKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  222  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETVWKGVPKFLRRVDTALKNIGINERVPYNA  281

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  282  PLIQFSSWMGGDRDGNPRVTPEVTRDV  308



>ref|XP_006348868.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Solanum tuberosum]
Length=964

 Score =   300 bits (768),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIRDC+ QLY KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCMTQLYAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>gb|KDP32538.1| hypothetical protein JCGZ_14741 [Jatropha curcas]
Length=957

 Score =   300 bits (768),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  148  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  207

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKN+GINERVPYNA
Sbjct  208  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNVGINERVPYNA  267

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  268  PLIQFSSWMGGDRDGNPRVTPEVTRDV  294



>ref|XP_002518037.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
 gb|EEF44555.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
Length=965

 Score =   300 bits (768),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|KJB27013.1| hypothetical protein B456_004G272100 [Gossypium raimondii]
Length=751

 Score =   296 bits (757),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDI+PDDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYGKDISPDDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  220  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>ref|XP_010060690.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Eucalyptus grandis]
 gb|KCW67501.1| hypothetical protein EUGRSUZ_F01229 [Eucalyptus grandis]
Length=965

 Score =   300 bits (768),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>emb|CDP06006.1| unnamed protein product [Coffea canephora]
Length=965

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_002285441.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
Length=963

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009357178.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Pyrus x bretschneideri]
Length=967

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|EPS69468.1| hypothetical protein M569_05291 [Genlisea aurea]
Length=965

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQE+DEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQEVDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERIPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|NP_001267517.1| phosphoenolpyruvate carboxylase, housekeeping isozyme-like [Cucumis 
sativus]
 ref|XP_004165409.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Cucumis sativus]
 gb|AFS33790.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
 gb|KGN55071.1| hypothetical protein Csa_4G627210 [Cucumis sativus]
Length=965

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLVQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009598007.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
Length=966

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_008229092.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Prunus mume]
Length=966

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+R+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARVRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AJP17168.1| phosphoenolpyruvate carboxylase 2 [Prunus sibirica]
Length=966

 Score =   299 bits (766),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+R+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARVRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>dbj|BAB89367.1| phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=820

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQS+RRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  13   VFDALKNQTVDLVFTAHPTQSIRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  72

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPY+A
Sbjct  73   IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYSA  132

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  133  PLIQFSSWMGGDRDGNPRVTPEVTRDV  159



>ref|XP_008342775.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Malus domestica]
 ref|XP_008368623.1| PREDICTED: phosphoenolpyruvate carboxylase [Malus domestica]
Length=967

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+R+CL QLY KDITPDDKQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARVRNCLTQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|ADZ05827.1| phosphoenolpyruvate carboxylase [Citrus maxima]
Length=868

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  57   IFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  116

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  117  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  176

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  177  PLIQFSSWMGGDRDGNPRVTPEVTRDV  203



>ref|XP_008463734.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Cucumis melo]
Length=965

 Score =   299 bits (766),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLVQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>emb|CDX82457.1| BnaA03g33640D [Brassica napus]
Length=774

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  123  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  182

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  183  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNA  242

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  243  PLIQFSSWMGGDRDGNPRVTPEVTRDV  269



>gb|KDO44636.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
Length=868

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  57   IFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  116

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  117  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  176

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  177  PLIQFSSWMGGDRDGNPRVTPEVTRDV  203



>emb|CDX97618.1| BnaA05g24610D [Brassica napus]
Length=776

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  123  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  182

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  183  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNA  242

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  243  PLIQFSSWMGGDRDGNPRVTPEVTRDV  269



>gb|AJD81370.1| phosphoenolpyruvate carboxylase isoform 4 [Egeria densa]
Length=880

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLV TAHPTQS+RRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  71   VFDALKSQTVDLVFTAHPTQSIRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  130

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  131  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  190

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  191  PLIQFSSWMGGDRDGNPRVTPEVTRDV  217



>ref|XP_004251893.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
 ref|XP_010313917.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
Length=965

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDA+KN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDAIKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|AFN70424.1| phosphoenolpyruvate carboxylase [Manihot esculenta]
Length=965

 Score =   299 bits (765),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERIPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_007021730.1| Phosphoenolpyruvate carboxylase 3 isoform 3 [Theobroma cacao]
 gb|EOY13255.1| Phosphoenolpyruvate carboxylase 3 isoform 3 [Theobroma cacao]
Length=865

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  56   VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  115

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHET+WKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  116  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETVWKGVPKFLRRVDTALKNIGINERVPYNA  175

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  176  PLIQFSSWMGGDRDGNPRVTPEVTRDV  202



>gb|AFN70425.1| phosphoenolpyruvate carboxylase [Manihot esculenta subsp. flabellifolia]
Length=965

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERIPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>emb|CAB65170.1| phosphoenolpyruvate carboxylase 1 [Solanum lycopersicum var. 
cerasiforme]
Length=964

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDA+KN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDAIKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>sp|P16097.1|CAPP2_MESCR RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2 [Mesembryanthemum crystallinum]
 emb|CAA32728.2| phosphoenolpyruvate carboxylase [Mesembryanthemum crystallinum]
Length=960

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  149  IFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  208

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  209  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  268

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  269  PLIQFSSWMGGDRDGNPRVTPEVTRDV  295



>emb|CDY25721.1| BnaC03g69540D [Brassica napus]
Length=891

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|NP_188112.1| phosphoenolpyruvate carboxylase 3 [Arabidopsis thaliana]
 sp|Q84VW9.2|CAPP3_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 3; Short=AtPPC3; 
Short=PEPC 3; Short=PEPCase 3 [Arabidopsis thaliana]
 gb|AAC24594.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 emb|CAA10486.1| phospho enole pyruvate carboxylase [Arabidopsis thaliana]
 dbj|BAA97057.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE75592.1| phosphoenolpyruvate carboxylase 3 [Arabidopsis thaliana]
Length=968

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>sp|Q9FV65.1|CAPPC_FLATR RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2; Short=ppcC [Flaveria trinervia]
 gb|AAG17619.1|AF248080_1 phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=967

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEAL RE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALHRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010502354.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Camelina sativa]
Length=968

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_010465426.1| PREDICTED: phosphoenolpyruvate carboxylase 3-like [Camelina sativa]
Length=968

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_006370158.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
 gb|ERP66727.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
Length=968

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TV+LV TAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  159  VFDALKNQTVELVFTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  219  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>gb|KFK38845.1| phosphoenolpyruvate carboxylase [Arabis alpina]
Length=968

 Score =   298 bits (764),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_009416509.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   298 bits (763),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR CL QLY KDITPDDKQELDEALQRE
Sbjct  154  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRTCLTQLYAKDITPDDKQELDEALQRE  213

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  214  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  273

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  274  PLIQFSSWMGGDRDGNPRVTPEVTRDV  300



>gb|KJB13196.1| hypothetical protein B456_002G061400 [Gossypium raimondii]
Length=969

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHET+WKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  220  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETVWKGVPKFLRRVDTALKNIGINERVPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>emb|CDY45929.1| BnaC06g09980D [Brassica napus]
Length=838

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALK+ TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKSQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|AAK58636.1|AF271162_1 phosphoenolpyruvate carboxylase isoform 2 [Hydrilla verticillata]
Length=968

 Score =   298 bits (763),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH+RIR+CLAQLY KD+TPDDKQELDEALQRE
Sbjct  159  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHSRIRNCLAQLYAKDVTPDDKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTAL+NIGINERVPYNA
Sbjct  219  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALRNIGINERVPYNA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>gb|KHG02548.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Gossypium 
arboreum]
Length=969

 Score =   298 bits (763),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHET+WKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  220  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETVWKGVPKFLRRVDTALKNIGINERVPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>ref|XP_002882904.1| ATPPC3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59163.1| ATPPC3 [Arabidopsis lyrata subsp. lyrata]
Length=968

 Score =   298 bits (763),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_010920051.1| PREDICTED: LOW QUALITY PROTEIN: phosphoenolpyruvate carboxylase, 
housekeeping isozyme-like [Elaeis guineensis]
Length=966

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGISERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|KDP36288.1| hypothetical protein JCGZ_09795 [Jatropha curcas]
Length=965

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAK58635.2|AF271161_1 phosphoenolpyruvate carboxylase isoform 1 [Hydrilla verticillata]
Length=970

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH+RIR+CLAQLY KD+TPDDKQELDEALQRE
Sbjct  161  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHSRIRNCLAQLYAKDVTPDDKQELDEALQRE  220

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTAL+NIGINERVPYNA
Sbjct  221  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALRNIGINERVPYNA  280

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  281  PLIQFSSWMGGDRDGNPRVTPEVTRDV  307



>ref|XP_009766373.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=966

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|ABU41519.1| phosphoenolpyruvate carboxylase [Jatropha curcas]
Length=965

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006392801.1| hypothetical protein EUTSA_v10011967mg, partial [Eutrema salsugineum]
 gb|ESQ30087.1| hypothetical protein EUTSA_v10011967mg, partial [Eutrema salsugineum]
Length=935

 Score =   297 bits (761),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_009783765.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
 ref|XP_009783766.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana sylvestris]
Length=964

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYTKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006407030.1| hypothetical protein EUTSA_v10019997mg [Eutrema salsugineum]
 dbj|BAJ34436.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48483.1| hypothetical protein EUTSA_v10019997mg [Eutrema salsugineum]
Length=968

 Score =   298 bits (763),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|AAM14596.1|AF494191_1 phosphoenolpyruvate carboxylase FB966 [Flaveria brownii]
Length=966

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009762944.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana sylvestris]
Length=964

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQS+RRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSIRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPY+A
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYSA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_008813763.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X2 
[Phoenix dactylifera]
Length=866

 Score =   296 bits (758),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  56   IFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  115

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMR GMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  116  IQAAFRTDEIRRTPPTPQDEMRFGMSYFHETIWKGVPKFLRRVDTALKNIGISERVPYNA  175

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  176  PLIQFSSWMGGDRDGNPRVTPEVTRDV  202



>ref|XP_006442514.1| hypothetical protein CICLE_v10018719mg [Citrus clementina]
 gb|ESR55754.1| hypothetical protein CICLE_v10018719mg [Citrus clementina]
Length=969

 Score =   298 bits (762),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  158  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  217

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  218  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  277

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  278  PLIQFSSWMGGDRDGNPRVTPEVTRDV  304



>ref|XP_009607156.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
 ref|XP_009607157.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Nicotiana tomentosiformis]
Length=964

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQS+RRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSIRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPY+A
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYSA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_007021728.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 ref|XP_007021729.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOY13253.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOY13254.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
Length=972

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  163  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  222

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHET+WKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  223  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETVWKGVPKFLRRVDTALKNIGINERVPYNA  282

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  283  PLIQFSSWMGGDRDGNPRVTPEVTRDV  309



>dbj|BAH19953.1| AT1G53310 [Arabidopsis thaliana]
Length=967

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_006487452.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Citrus sinensis]
 ref|XP_006487453.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Citrus sinensis]
 ref|XP_006487454.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X3 [Citrus sinensis]
 gb|KDO44634.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
 gb|KDO44635.1| hypothetical protein CISIN_1g002089mg [Citrus sinensis]
Length=969

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  158  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  217

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  218  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  277

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  278  PLIQFSSWMGGDRDGNPRVTPEVTRDV  304



>ref|XP_006306679.1| hypothetical protein CARUB_v10008196mg [Capsella rubella]
 gb|EOA39577.1| hypothetical protein CARUB_v10008196mg [Capsella rubella]
Length=967

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|NP_175738.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 ref|NP_001031178.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 ref|NP_001031179.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 sp|Q9MAH0.1|CAPP1_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=AtPPC1; 
Short=PEPC 1; Short=PEPCase 1; AltName: Full=107-kDa PEPC 
polypeptide [Arabidopsis thaliana]
 gb|AAF69546.1|AC008007_21 F12M16.21 [Arabidopsis thaliana]
 gb|AAL09748.1| At1g53310/F12M16_21 [Arabidopsis thaliana]
 gb|AAN18213.1| At1g53310/F12M16_21 [Arabidopsis thaliana]
 emb|CAD58725.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
 gb|AEE32921.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 gb|AEE32922.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
 gb|AEE32923.1| phosphoenolpyruvate carboxylase 1 [Arabidopsis thaliana]
Length=967

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|NP_001275821.1| phosphoenolpyruvate carboxylase [Citrus sinensis]
 gb|ABK54024.2| phosphoenolpyruvate carboxylase [Citrus sinensis]
Length=967

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  158  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  217

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  218  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  277

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  278  PLIQFSSWMGGDRDGNPRVTPEVTRDV  304



>dbj|BAJ34480.1| unnamed protein product [Thellungiella halophila]
Length=967

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_002894435.1| ATPPC1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70694.1| ATPPC1 [Arabidopsis lyrata subsp. lyrata]
Length=967

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>emb|CAA88829.1| phosphoenolpyruvate carboxylase [Flaveria pringlei]
Length=966

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010479886.1| PREDICTED: phosphoenolpyruvate carboxylase 1 [Camelina sativa]
Length=967

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIQERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>pdb|3ZGB|A Chain A, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|3ZGB|B Chain B, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
Length=972

 Score =   298 bits (762),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  162  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  221

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  222  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  281

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  282  PLIQFSSWMGGDRDGNPRVTPEVTRDV  308



>ref|XP_010500970.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X1 
[Camelina sativa]
 ref|XP_010500971.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X2 
[Camelina sativa]
 ref|XP_010500972.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X3 
[Camelina sativa]
 ref|XP_010462211.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X1 
[Camelina sativa]
 ref|XP_010462212.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X2 
[Camelina sativa]
 ref|XP_010462213.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like isoform X3 
[Camelina sativa]
Length=967

 Score =   298 bits (762),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIQERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|AJD81371.1| phosphoenolpyruvate carboxylase isoform 5, partial [Egeria densa]
Length=967

 Score =   298 bits (762),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLV TAHPTQS+RRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  158  VFDALKSQTVDLVFTAHPTQSIRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  217

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  218  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  277

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  278  PLIQFSSWMGGDRDGNPRVTPEVTRDV  304



>gb|EYU45020.1| hypothetical protein MIMGU_mgv1a000847mg [Erythranthe guttata]
Length=963

 Score =   297 bits (761),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_002530381.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
 gb|EEF32001.1| Phosphoenolpyruvate carboxylase, putative [Ricinus communis]
Length=965

 Score =   297 bits (761),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009106983.1| PREDICTED: phosphoenolpyruvate carboxylase 1 [Brassica rapa]
 emb|CDY02513.1| BnaA08g01200D [Brassica napus]
Length=964

 Score =   297 bits (761),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>emb|CAA11415.1| phosphoenolpyruvate carboxylase [Brassica juncea]
Length=964

 Score =   297 bits (761),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|AAM14597.1|AF494192_1 phosphoenolpyruvate carboxylase FPUB966 [Flaveria pubescens]
Length=966

 Score =   297 bits (761),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|EEC83482.1| hypothetical protein OsI_28999 [Oryza sativa Indica Group]
Length=684

 Score =   292 bits (747),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  155  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGI+ERVPYNA
Sbjct  215  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRLDTALKNIGIDERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>emb|CAC28225.1| phosphoenolpyruvate carboxylase [Sesbania rostrata]
Length=961

 Score =   297 bits (761),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH R+R+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRVRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>sp|P51062.1|CAPP_PEA RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Pisum sativum]
 dbj|BAA10902.1| phosphoenolpyruvate carboxylase [Pisum sativum]
Length=967

 Score =   297 bits (761),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+R+CL+QLY KDITPDDKQELDE+LQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARVRNCLSQLYAKDITPDDKQELDESLQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>ref|XP_009604678.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
 ref|XP_009604679.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
 ref|XP_009604680.1| PREDICTED: phosphoenolpyruvate carboxylase [Nicotiana tomentosiformis]
Length=964

 Score =   297 bits (761),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010413019.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Camelina sativa]
Length=894

 Score =   296 bits (758),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|ABR29876.1| phosphoenolpyruvate carboxylase [Ricinus communis]
Length=965

 Score =   297 bits (761),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AJD81368.1| phosphoenolpyruvate carboxylase isoform 2 [Egeria densa]
Length=968

 Score =   297 bits (761),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQS+RRSLLQKHARIRDCLAQLY KDIT DDKQELDEALQRE
Sbjct  159  VFDALKSQTVDLVLTAHPTQSIRRSLLQKHARIRDCLAQLYAKDITQDDKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINERVPYNA
Sbjct  219  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRLDTALKNIGINERVPYNA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>gb|KDO63366.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=753

 Score =   293 bits (750),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR+PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRSPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVT EVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTSEVTRDV  302



>ref|XP_011029569.1| PREDICTED: phosphoenolpyruvate carboxylase [Populus euphratica]
Length=966

 Score =   297 bits (761),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+R+CLAQLY KDITP++KQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARLRNCLAQLYAKDITPNEKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_006306678.1| hypothetical protein CARUB_v10008196mg, partial [Capsella rubella]
 gb|EOA39576.1| hypothetical protein CARUB_v10008196mg, partial [Capsella rubella]
Length=996

 Score =   298 bits (762),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  186  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  245

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  246  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  305

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  306  PLIQFSSWMGGDRDGNPRVTPEVTRDV  332



>ref|XP_003596385.1| Phosphoenolpyruvate-carboxylase [Medicago truncatula]
 gb|AES66636.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   297 bits (761),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH R+R+CL+QLY KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRVRNCLSQLYAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>gb|KEH19560.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=873

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWMGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAD22994.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=941

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>sp|Q02735.1|CAPP_MEDSA RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Medicago sativa]
 gb|AAB46618.1| phosphoenolpyruvate carboxylase [Medicago sativa]
 gb|AAB41903.1| phosphoenolpyruvate carboxylase [Medicago sativa]
Length=966

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH R+R+CL+QLY KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRVRNCLSQLYAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>ref|XP_004303182.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466957.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Fragaria vesca 
subsp. vesca]
Length=961

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFD LKN T+DLVLTAHPTQSVRRSLLQKHAR+R+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDELKNQTIDLVLTAHPTQSVRRSLLQKHARVRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006360045.1| PREDICTED: phosphoenolpyruvate carboxylase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360046.1| PREDICTED: phosphoenolpyruvate carboxylase-like isoform X2 [Solanum 
tuberosum]
Length=964

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPQFLRRVDTALKNIGINERLPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_002316861.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
 gb|EEE97473.1| phosphoenolpyruvate carboxylase family protein [Populus trichocarpa]
Length=966

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHAR+R+CLAQLY KDITP++KQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARLRNCLAQLYAKDITPNEKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>emb|CAD58726.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=963

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010277028.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Nelumbo nucifera]
Length=964

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQL  KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLNAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKG+P+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGIPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>ref|XP_008793018.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Phoenix dactylifera]
Length=966

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPP PQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPAPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>dbj|BAA03094.1| phosphoenolpyruvate carboxylase [Brassica napus]
 prf||2013218A phosphoenolpyruvate carboxylase
Length=964

 Score =   297 bits (760),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006411524.1| hypothetical protein EUTSA_v10016192mg [Eutrema salsugineum]
 gb|ESQ52977.1| hypothetical protein EUTSA_v10016192mg [Eutrema salsugineum]
Length=956

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  148  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  207

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  208  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  267

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  268  PLIQFSSWMGGDRDGNPRVTPEVTRDV  294



>ref|XP_009142075.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Brassica rapa]
Length=964

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>emb|CDX98516.1| BnaC05g38590D [Brassica napus]
Length=933

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  123  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  182

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  183  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNA  242

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  243  PLIQFSSWMGGDRDGNPRVTPEVTRDV  269



>emb|CDY51508.1| BnaC04g02430D [Brassica napus]
Length=964

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|EMS60171.1| Phosphoenolpyruvate carboxylase 2 [Triticum urartu]
Length=956

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  177  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  236

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  237  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  296

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  297  PLIQFSSWMGGDRDGNPRVTPEVTRDV  323



>ref|NP_850373.4| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 ref|NP_850372.4| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 sp|Q5GM68.2|CAPP2_ARATH RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=AtPPC2; 
Short=PEPC 2; Short=PEPCase 2 [Arabidopsis thaliana]
 gb|AEC10145.1| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
 gb|AEC10146.1| phosphoenolpyruvate carboxylase 2 [Arabidopsis thaliana]
Length=963

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009142853.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Brassica rapa]
 ref|XP_009142854.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Brassica rapa]
Length=964

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|KFK37112.1| hypothetical protein AALP_AA4G214300 [Arabis alpina]
Length=963

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_008813762.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X1 
[Phoenix dactylifera]
Length=966

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMR GMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRFGMSYFHETIWKGVPKFLRRVDTALKNIGISERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010552117.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Tarenaya hassleriana]
 ref|XP_010552118.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Tarenaya hassleriana]
Length=967

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQS+RRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFDALKNQTVDLVFTAHPTQSIRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALK+IGINER+PYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKSIGINERLPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>emb|CDY47982.1| BnaA04g24600D [Brassica napus]
Length=972

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAP43628.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=963

 Score =   296 bits (759),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_002881863.1| phosphoenolpyruvate carboxylase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58122.1| phosphoenolpyruvate carboxylase [Arabidopsis lyrata subsp. lyrata]
Length=963

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010508551.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Camelina sativa]
Length=963

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006293629.1| hypothetical protein CARUB_v10022582mg [Capsella rubella]
 gb|EOA26527.1| hypothetical protein CARUB_v10022582mg [Capsella rubella]
Length=963

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_007149740.1| hypothetical protein PHAVU_005G095300g [Phaseolus vulgaris]
 gb|ESW21734.1| hypothetical protein PHAVU_005G095300g [Phaseolus vulgaris]
Length=966

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PVIQFSSWMGGDRDGNPRVTPEVTRDV  303



>emb|CDY55389.1| BnaA05g34260D [Brassica napus]
Length=975

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006852422.1| hypothetical protein AMTR_s00021p00059810 [Amborella trichopoda]
 gb|ERN13889.1| hypothetical protein AMTR_s00021p00059810 [Amborella trichopoda]
Length=965

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQS+RRSLLQKHARIR+CL QLY KDITPD+KQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSIRRSLLQKHARIRNCLTQLYAKDITPDEKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009146304.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
 ref|XP_009146305.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
Length=967

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>emb|CBI21984.3| unnamed protein product [Vitis vinifera]
Length=944

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>dbj|BAJ97144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=972

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  163  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  222

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  223  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  282

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  283  PLIQFSSWMGGDRDGNPRVTPEVTRDV  309



>gb|ABV80356.1| phosphoenolpyruvate carboxylase [Gossypium hirsutum]
Length=971

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  162  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  221

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHET+WKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  222  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETVWKGVPKFLRRVDTALKNIGINERVPYNA  281

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRV PEVTRDV
Sbjct  282  PLIQFSSWMGGDRDGNPRVAPEVTRDV  308



>ref|XP_003577980.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Brachypodium distachyon]
Length=968

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  159  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  219  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>gb|EMT08272.1| Phosphoenolpyruvate carboxylase 2 [Aegilops tauschii]
Length=972

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  163  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  222

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  223  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  282

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  283  PLIQFSSWMGGDRDGNPRVTPEVTRDV  309



>ref|XP_006296907.1| hypothetical protein CARUB_v10012899mg [Capsella rubella]
 gb|EOA29805.1| hypothetical protein CARUB_v10012899mg [Capsella rubella]
Length=968

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>dbj|BAJ85327.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06909.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=972

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  163  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  222

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  223  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  282

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  283  PLIQFSSWMGGDRDGNPRVTPEVTRDV  309



>ref|XP_002280569.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
 ref|XP_010657037.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Vitis vinifera]
 emb|CAN77927.1| hypothetical protein VITISV_018739 [Vitis vinifera]
Length=965

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|KJB33217.1| hypothetical protein B456_006G001300 [Gossypium raimondii]
Length=965

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRNPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_004970018.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X1 [Setaria italica]
 ref|XP_004970019.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Setaria italica]
Length=969

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQ+VRRSLLQKH RIR+CL+QLY KDITPD+KQELDEALQRE
Sbjct  159  VFDALKNQTVDLVLTAHPTQAVRRSLLQKHGRIRNCLSQLYAKDITPDEKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  219  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>ref|XP_004248242.1| PREDICTED: phosphoenolpyruvate carboxylase [Solanum lycopersicum]
Length=964

 Score =   296 bits (757),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF+ALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFEALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PVIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|KHG25331.1| Phosphoenolpyruvate carboxylase 2 [Gossypium arboreum]
Length=965

 Score =   296 bits (757),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRNPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|KEH19559.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=967

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWMGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>emb|CDY14847.1| BnaC04g48440D [Brassica napus]
Length=964

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN T+DLVLTAHPTQSVRRSLLQK  RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTLDLVLTAHPTQSVRRSLLQKFGRIRDCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|NP_001267665.1| phosphoenolpyruvate carboxylase 2-like [Cucumis sativus]
 ref|XP_004155470.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Cucumis sativus]
 gb|AFS33791.1| phosphoenolpyruvate carboxylase protein [Cucumis sativus]
 gb|KGN43627.1| Phosphoenolpyruvate carboxylase 1 [Cucumis sativus]
Length=965

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_008455304.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Cucumis melo]
Length=965

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|ABY87944.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=968

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH R+R+CL QLY KDITPDDKQELDEALQRE
Sbjct  159  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRVRNCLTQLYAKDITPDDKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR+PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  219  IQAAFRTDEIRRSPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>ref|NP_001237394.1| phosphoenolpyruvate carboxylase [Glycine max]
 gb|AAS67006.1| Phosphoenolpyruvate carboxylase [Glycine max]
 gb|KHN27941.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPQFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PVIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|KHG25857.1| Phosphoenolpyruvate carboxylase 2 [Gossypium arboreum]
Length=969

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDI+PDDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYGKDISPDDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  220  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>ref|XP_011100202.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Sesamum indicum]
Length=966

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIRDCL QL  KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLTQLNAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIRRNPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>ref|XP_010915515.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Elaeis guineensis]
Length=965

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKHARIR+CLAQL  KDITPD+KQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHARIRNCLAQLNAKDITPDEKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAB80714.1| phosphoenolpyruvate carboxylase 1 [Gossypium hirsutum]
Length=965

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRNPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_004516076.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Cicer arietinum]
Length=967

 Score =   295 bits (756),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CLA LY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLAHLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWMGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|KJB27012.1| hypothetical protein B456_004G272100 [Gossypium raimondii]
Length=969

 Score =   295 bits (756),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDI+PDDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYGKDISPDDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  220  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>ref|XP_010108239.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Morus 
notabilis]
 gb|EXC18479.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Morus 
notabilis]
Length=1376

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009406237.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   295 bits (755),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN T+DLV TAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDE+LQRE
Sbjct  154  VFDALKNQTIDLVFTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDESLQRE  213

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  214  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  273

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  274  PLIQFSSWMGGDRDGNPRVTPEVTRDV  300



>gb|KJB82053.1| hypothetical protein B456_013G173500 [Gossypium raimondii]
Length=964

 Score =   295 bits (755),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  162  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALGRE  221

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHET+WKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  222  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETVWKGVPKFLRRVDTALKNIGINERVPYNA  281

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  282  PLIQFSSWMGGDRDGNPRVTPEVTRDV  308



>gb|KHN36697.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   295 bits (755),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPQFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PVIQFSSWMGGDRDGNPRVTPEVTRDV  303



>emb|CAA09588.1| phosphoenolpyruvate-carboxylase [Vicia faba]
Length=966

 Score =   295 bits (755),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL+ LY KDITPDDKQELDE+LQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLSHLYAKDITPDDKQELDESLQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKN+GINERVPYNA
Sbjct  215  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNVGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>gb|AAO42888.1| At3g14940 [Arabidopsis thaliana]
 dbj|BAE99551.1| phosphoenolpyruvate carboxylase [Arabidopsis thaliana]
Length=968

 Score =   295 bits (755),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYF ETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFRETIWKGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>sp|Q9FV66.1|CAPPB_FLATR RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=PEPC 1; 
Short=PEPCase 1; Short=ppcB [Flaveria trinervia]
 gb|AAG17618.1|AF248079_1 phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=965

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>tpg|DAA61011.1| TPA: phosphoenolpyruvate carboxylase4 [Zea mays]
Length=967

 Score =   295 bits (755),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  158  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  217

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  218  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  277

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  278  PLIQFSSWMGGDRDGNPRVTPEVTRDV  304



>emb|CAA11414.1| phosphoenolpyrovate carboxylase [Brassica juncea]
Length=964

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHP QSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPPQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>dbj|BAC20364.1| phosphoenolpyruvate carboxylase [Lotus japonicus]
Length=961

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+ L+QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNSLSQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_007133202.1| hypothetical protein PHAVU_011G160200g [Phaseolus vulgaris]
 gb|ESW05196.1| hypothetical protein PHAVU_011G160200g [Phaseolus vulgaris]
Length=967

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFD LKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDELKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPEFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|ACO48251.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=969

 Score =   295 bits (754),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL+QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLSQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRR+DTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWMGVPKFLRRLDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009135413.1| PREDICTED: phosphoenolpyruvate carboxylase 3 [Brassica rapa]
Length=967

 Score =   295 bits (754),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDK ELDE+LQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKHELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|NP_001105438.1| phosphoenolpyruvate carboxylase 2 [Zea mays]
 sp|P51059.1|CAPP2_MAIZE RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2 [Zea mays]
 emb|CAA43709.1| phosphoenolpyruvate carboxylase [Zea mays]
Length=967

 Score =   295 bits (754),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  158  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  217

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  218  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  277

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  278  PLIQFSSWMGGDRDGNPRVTPEVTRDV  304



>ref|XP_006582125.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
isoform X2 [Glycine max]
Length=760

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF+ALKN TVDLVLTAHPTQSVRRSLLQKH RIR+ L QLY KDITPDDKQELDEALQRE
Sbjct  156  VFNALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNNLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPTFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>emb|CAA81072.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=966

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TV+LVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  156  VFDALKNQTVELVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER PYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERFPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>sp|P30694.2|CAPPA_FLATR RecName: Full=C4 phosphoenolpyruvate carboxylase; Short=C4 PEPC; 
Short=C4 PEPCase; Short=ppcA; AltName: Full=Photosynthetic 
PEPCase [Flaveria trinervia]
 emb|CAA43601.1| phosphoenolpyruvate carboxylase [Flaveria trinervia]
Length=966

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TV+LVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  156  VFDALKNQTVELVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER PYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERFPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAY28730.1| phosphoenolpyruvate carboxylase [Alternanthera ficoidea]
Length=966

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFD LKN TVDLVLTAHPTQSVRRSLLQKH RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  157  VFDTLKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLTQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|ACC66283.1| phosphoenolpyruvate carboxylase [Suaeda glauca]
Length=966

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALK++GINERVPYNA
Sbjct  216  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKDLGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AJD81367.1| phosphoenolpyruvate carboxylase isoform 1 [Egeria densa]
Length=968

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLV TAHPTQS+RRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  159  VFDALKSQTVDLVFTAHPTQSIRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPY+A
Sbjct  219  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYSA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>gb|EYU41129.1| hypothetical protein MIMGU_mgv1a000842mg [Erythranthe guttata]
Length=966

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIRDCL QL  KDITPDDKQELDEALQRE
Sbjct  155  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRDCLTQLNAKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQA FRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  215  IQAGFRTDEIRRNPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>pdb|3ZGE|A Chain A, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|3ZGE|B Chain B, Greater Efficiency Of Photosynthetic Carbon Fixation 
Due To Single Amino Acid Substitution
 pdb|4BXC|A Chain A, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
 pdb|4BXC|B Chain B, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
 pdb|4BXH|A Chain A, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
Length=990

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TV+LVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  180  VFDALKNQTVELVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  239

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER PYNA
Sbjct  240  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERFPYNA  299

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  300  PLIQFSSWMGGDRDGNPRVTPEVTRDV  326



>emb|CAM83969.2| phosphoenolpyruvate carboxylase [Cyrtococcum patens]
Length=757

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQS+RRSLLQKHARIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  142  VFDALKNQTVDLVFTAHPTQSIRRSLLQKHARIRNCLTQLYAKDITADDKQELDEALQRE  201

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  202  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  261

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  262  PLIQFSSWMGGDRDGNPRVTPEVTRDV  288



>gb|KDO63365.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=891

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR+PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRSPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVT EVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTSEVTRDV  302



>pdb|4BXH|B Chain B, Resolving The Activation Site Of Positive Regulators 
In Plant Phosphoenolpyruvate Carboxylase
Length=990

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TV+LVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  180  VFDALKNQTVELVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  239

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER PYNA
Sbjct  240  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERFPYNA  299

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  300  PLIQFSSWMGGDRDGNPRVTPEVTRDV  326



>ref|XP_002462179.1| hypothetical protein SORBIDRAFT_02g021090 [Sorghum bicolor]
 gb|EER98700.1| hypothetical protein SORBIDRAFT_02g021090 [Sorghum bicolor]
Length=967

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  158  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  217

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  218  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  277

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  278  PLIQFSSWMGGDRDGNPRVTPEVTRDV  304



>ref|XP_010104390.1| Phosphoenolpyruvate carboxylase 2 [Morus notabilis]
 gb|EXC00235.1| Phosphoenolpyruvate carboxylase 2 [Morus notabilis]
Length=967

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QL+ KDITPDDKQELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLHAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>sp|P29194.1|CAPP2_SORBI RecName: Full=Phosphoenolpyruvate carboxylase 2; Short=PEPC 2; 
Short=PEPCase 2; AltName: Full=CP28 [Sorghum bicolor]
 emb|CAA42549.1| phosphoenolpyruvate carboxylase [Sorghum bicolor]
Length=960

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  151  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  210

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  211  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  270

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  271  PLIQFSSWMGGDRDGNPRVTPEVTRDV  297



>sp|P27154.1|CAPP_TOBAC RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Nicotiana tabacum]
 emb|CAA41758.1| phosphoenolpyruvate carboxylase [Nicotiana tabacum]
Length=964

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIRDCLAQLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVT EVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTLEVTRDV  302



>emb|CDM84220.1| unnamed protein product [Triticum aestivum]
Length=866

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPD+KQELDEALQRE
Sbjct  56   VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDEKQELDEALQRE  115

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  116  IQAAFRTDEIRRAPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIKERVPYNA  175

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  176  PLIQFSSWMGGDRDGNPRVTPEVTRDV  202



>ref|XP_007149391.1| hypothetical protein PHAVU_005G066400g [Phaseolus vulgaris]
 gb|ESW21385.1| hypothetical protein PHAVU_005G066400g [Phaseolus vulgaris]
Length=968

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL++LY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLSKLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVPRFLRRVDTAL NIGI ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAD45696.1|AF159051_1 phosphoenolpyruvate carboxylase [Picea abies]
Length=955

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL+QLY KDITPD+KQELDEAL RE
Sbjct  148  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLSQLYGKDITPDEKQELDEALLRE  207

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALK+IGINERVPYNA
Sbjct  208  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKSIGINERVPYNA  267

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  268  PLIQFSSWMGGDRDGNPRVTPEVTRDV  294



>dbj|BAC20365.1| phosphoenolpyruvate carboxylase [Lotus japonicus]
Length=967

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFD LKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDELKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAK58637.1|AF271163_1 phosphoenolpyruvate carboxylase isoform 3 [Hydrilla verticillata]
Length=970

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH+RIR+ LAQLY KD+TPDDKQELDEALQRE
Sbjct  161  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHSRIRNSLAQLYAKDVTPDDKQELDEALQRE  220

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTAL+NIGINERVPYNA
Sbjct  221  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALRNIGINERVPYNA  280

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  281  PLIQFSSWMGGDRDGNPRVTPEVTRDV  307



>ref|XP_011005507.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
 ref|XP_011005508.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
 ref|XP_011005509.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like 
[Populus euphratica]
Length=968

 Score =   294 bits (752),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKHARIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  159  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAA RTDEIRRTPP PQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  219  IQAACRTDEIRRTPPPPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>ref|XP_003527347.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Glycine max]
 gb|KHN33958.1| Phosphoenolpyruvate carboxylase 2 [Glycine soja]
Length=966

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALK+ TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKSQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKG+P+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGIPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PVIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|KHN36882.1| Phosphoenolpyruvate carboxylase [Glycine soja]
Length=967

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL+QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLSQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVPRFLRRVDTAL NIGI ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009354255.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Pyrus x bretschneideri]
 ref|XP_009348400.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Pyrus x bretschneideri]
Length=967

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKHARIR+CL QL  KDITPDDKQELDE+LQRE
Sbjct  157  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHARIRNCLTQLNAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_006593478.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X1 [Glycine 
max]
 dbj|BAC41249.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL+QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLSQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVPRFLRRVDTAL NIGI ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|ACO48250.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=966

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDD+QELDEALQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDRQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKG+P+FLRRVDTALKNIGINERVPY+A
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGIPKFLRRVDTALKNIGINERVPYSA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PVIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|NP_001236741.1| phosphoenolpyruvate carboxylase [Glycine max]
 dbj|BAA23419.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL+QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLSQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVPRFLRRVDTAL NIGI ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010553399.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Tarenaya hassleriana]
Length=961

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQK  RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  152  VFDALKNQTVDLVFTAHPTQSVRRSLLQKFGRIRNCLTQLYAKDITPDDKQELDEALQRE  211

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  212  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  271

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  272  PLIQFSSWMGGDRDGNPRVTPEVTRDV  298



>ref|XP_011082759.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Sesamum indicum]
Length=964

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL +LY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLTKLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|ABR17346.1| unknown [Picea sitchensis]
Length=963

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL+QLY KDITPD+KQELDEAL RE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLSQLYGKDITPDEKQELDEALLRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALK+IGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKSIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_007213682.1| hypothetical protein PRUPE_ppa000910mg [Prunus persica]
 gb|EMJ14881.1| hypothetical protein PRUPE_ppa000910mg [Prunus persica]
Length=965

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF+ALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQE+DEALQRE
Sbjct  156  VFEALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQEIDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVP+NA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPHNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010675388.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Beta vulgaris subsp. 
vulgaris]
Length=967

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  157  IFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPY A
Sbjct  217  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYYA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>sp|P51063.1|CAPP_PICAB RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Picea abies]
 emb|CAA55700.1| phosphoenolpyruvate carboxylase [Picea abies]
Length=963

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL+QLY KDITPD+KQELDEAL RE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLSQLYGKDITPDEKQELDEALLRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALK+IGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKSIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|NP_001241357.1| phosphoenolpyruvate carboxylase [Glycine max]
 ref|XP_006591889.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X1 [Glycine 
max]
 ref|XP_006591890.1| PREDICTED: phosphoenolpyruvate carboxylase isoform X2 [Glycine 
max]
 sp|P51061.1|CAPP2_SOYBN RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Glycine max]
 dbj|BAA03100.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL+QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLSQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVPRFLRRVDTAL NIGI ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_008226531.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Prunus mume]
Length=965

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF+ALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQE+DEALQRE
Sbjct  156  VFEALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQEIDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVP+NA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPHNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_009395707.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QL  KDITPDDKQELDEALQRE
Sbjct  154  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLTAKDITPDDKQELDEALQRE  213

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  214  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  273

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  274  PLIQFSSWMGGDRDGNPRVTPEVTRDV  300



>ref|XP_010524060.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Tarenaya hassleriana]
Length=965

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQK  RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKFGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>dbj|BAC41248.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL+QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLSQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVPRFLRRVDTAL NIGI ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPRFLRRVDTALNNIGIKERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>emb|CDP15935.1| unnamed protein product [Coffea canephora]
Length=968

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QLY KDITPD+KQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLYAKDITPDEKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            I+AAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IRAAFRTDEIRRNPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PVIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006469015.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X1 
[Citrus sinensis]
 ref|XP_006469016.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like isoform X2 
[Citrus sinensis]
Length=965

 Score =   293 bits (750),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR+PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRSPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVT EVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTSEVTRDV  302



>ref|XP_008368627.1| PREDICTED: phosphoenolpyruvate carboxylase-like [Malus domestica]
Length=875

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKHARIR+CL +L  KDITPDDKQELDE+LQRE
Sbjct  157  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHARIRNCLTKLNAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|KDO63363.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
 gb|KDO63364.1| hypothetical protein CISIN_1g002112mg [Citrus sinensis]
Length=965

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR+PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRSPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVT EVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTSEVTRDV  302



>ref|XP_006446789.1| hypothetical protein CICLE_v10014164mg [Citrus clementina]
 gb|ESR60029.1| hypothetical protein CICLE_v10014164mg [Citrus clementina]
Length=965

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR+PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRSPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVT EVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTSEVTRDV  302



>gb|EMS57465.1| Phosphoenolpyruvate carboxylase, housekeeping isozyme [Triticum 
urartu]
Length=1062

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR CL QLY KDITPD+KQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRSCLTQLYAKDITPDEKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIKERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAU07998.1| phosphoenolpyruvate carboxylase 3 [Lupinus albus]
Length=968

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKHARIR+CL+QLY KDITPDDKQELDE+LQRE
Sbjct  157  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHARIRNCLSQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEI+RTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINERVP+NA
Sbjct  217  IQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERVPHNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PVIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|ACN32213.1| phosphoenolpyruvate carboxylase [Arachis hypogaea]
Length=966

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF+ALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KD+TPDDKQELDEALQRE
Sbjct  155  VFEALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDVTPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRR+DTALKNIGINERVPYNA
Sbjct  215  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWTGVPKFLRRLDTALKNIGINERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>ref|XP_008655339.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 ref|XP_008655340.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 ref|XP_008655341.1| PREDICTED: uncharacterized protein LOC100384708 isoform X1 [Zea 
mays]
 gb|AFW85037.1| hypothetical protein ZEAMMB73_388983 [Zea mays]
 gb|AFW85038.1| hypothetical protein ZEAMMB73_388983 [Zea mays]
Length=966

 Score =   293 bits (749),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPD+KQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDEKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRAPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PIIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_006660531.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Oryza brachyantha]
Length=970

 Score =   293 bits (749),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  161  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  220

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  221  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  280

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  281  PLIQFSSWMGGDRDGNPRVTPEVTRDV  307



>emb|CAJ84247.1| phosphoenolpyruvate carboxylase [Lupinus luteus]
Length=967

 Score =   292 bits (748),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+ L QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNNLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPQFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>sp|P29193.1|CAPP1_SACHY RecName: Full=Phosphoenolpyruvate carboxylase, housekeeping isozyme; 
Short=PEPC; Short=PEPCase [Saccharum sp.]
 pir||S28614 phosphoenolpyruvate carboxylase (EC 4.1.1.31) - sugarcane hybrid 
H32-8560
 gb|AAC33164.1| phosphoenolpyruvate carboxylase [Saccharum hybrid cultivar H32-8560]
Length=966

 Score =   292 bits (748),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPD+KQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDEKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  216  IQAAFRTDEIRRAPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPE+TRDV
Sbjct  276  PIIQFSSWMGGDRDGNPRVTPEITRDV  302



>dbj|BAD36412.1| putative phosphoenolpyruvate carboxylase [Oryza sativa Japonica 
Group]
 gb|EAZ44215.1| hypothetical protein OsJ_28834 [Oryza sativa Japonica Group]
Length=972

 Score =   292 bits (748),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  163  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  222

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  223  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  282

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  283  PLIQFSSWMGGDRDGNPRVTPEVTRDV  309



>emb|CBM56258.1| C3 phosphoenolpyruvate carboxylase [Panicum bisulcatum]
Length=931

 Score =   292 bits (747),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  139  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  198

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  199  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  258

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  259  PLIQFSSWMGGDRDGNPRVTPEVTRDV  285



>ref|XP_003607582.1| Phosphoenolpyruvate carboxylase [Medicago truncatula]
 gb|AES89779.1| phosphoenolpyruvate carboxylase [Medicago truncatula]
Length=966

 Score =   292 bits (748),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH R+RDCL QLY KDITPDDKQELDE+LQRE
Sbjct  157  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHGRVRDCLTQLYAKDITPDDKQELDESLQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP+FLRR+DTALKNIGINER+PYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPKFLRRIDTALKNIGINERIPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            P+IQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PIIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_008362419.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Malus domestica]
Length=961

 Score =   292 bits (748),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKHARIR+CL +L  KDITPDDKQELDE+LQRE
Sbjct  151  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHARIRNCLTKLNAKDITPDDKQELDESLQRE  210

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  211  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  270

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  271  PLIQFSSWMGGDRDGNPRVTPEVTRDV  297



>ref|XP_009342319.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme-like, 
partial [Pyrus x bretschneideri]
Length=904

 Score =   291 bits (745),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL QLY KDITPDDKQE+DEALQRE
Sbjct  95   VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLTQLYAKDITPDDKQEIDEALQRE  154

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVP+NA
Sbjct  155  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPHNA  214

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  215  PLIQFSSWMGGDRDGNPRVTPEVTRDV  241



>ref|XP_010542308.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Tarenaya hassleriana]
Length=967

 Score =   292 bits (748),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF+ALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFEALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETI KGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  217  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETICKGVPKFLRRVDTALKNIGINERLPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_004956559.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Setaria italica]
Length=967

 Score =   292 bits (748),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ T+DLV TAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  158  VFDALKSQTIDLVFTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  217

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  218  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  277

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  278  PLIQFSSWMGGDRDGNPRVTPEVTRDV  304



>ref|XP_010527380.1| PREDICTED: phosphoenolpyruvate carboxylase 1-like [Tarenaya hassleriana]
Length=967

 Score =   292 bits (747),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF+ALKN TVDLV TAHPTQS+RRSLLQKH RIR+CLAQLY KDITPDDKQELDEALQRE
Sbjct  157  VFEALKNQTVDLVFTAHPTQSIRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQA FRTDEIRRTPP PQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER+PYNA
Sbjct  217  IQAGFRTDEIRRTPPAPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERLPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>gb|EAZ08566.1| hypothetical protein OsI_30839 [Oryza sativa Indica Group]
Length=971

 Score =   292 bits (747),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  162  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  221

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ERVPYNA
Sbjct  222  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNA  281

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  282  PLIQFSSWMGGDRDGNPRVTPEVTRDV  308



>gb|AJD81369.1| phosphoenolpyruvate carboxylase isoform 3 [Egeria densa]
Length=978

 Score =   292 bits (748),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQS+RRSLLQKHARIRD LAQLY KDIT DDKQELDEALQRE
Sbjct  169  VFDALKSQTVDLVLTAHPTQSIRRSLLQKHARIRDYLAQLYAKDITQDDKQELDEALQRE  228

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVD+ALKNIGINERVPYNA
Sbjct  229  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDSALKNIGINERVPYNA  288

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  289  PLIQFSSWMGGDRDGNPRVTPEVTRDV  315



>ref|XP_008386247.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Malus domestica]
Length=965

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QLY KDITPDDKQE+DEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLYAKDITPDDKQEIDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVP+NA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPHNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_007048690.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
 gb|EOX92847.1| Phosphoenolpyruvate carboxylase 3 isoform 1 [Theobroma cacao]
Length=965

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CL QL  KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLTQLNAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRR PPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRNPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>dbj|BAF80187.1| phosphoenolpyruvate carboxylase [Aloe arborescens]
Length=964

 Score =   292 bits (747),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            +FDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CLAQLY  DITPDDKQELDEALQRE
Sbjct  155  IFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLAQLYAHDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPP PQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINER PYNA
Sbjct  215  IQAAFRTDEIRRTPPAPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERFPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>ref|NP_001237602.1| phosphoenolpyruvate carboxylase, housekeeping isozyme [Glycine 
max]
 sp|Q02909.1|CAPP1_SOYBN RecName: Full=Phosphoenolpyruvate carboxylase, housekeeping isozyme; 
Short=PEPCase; AltName: Full=PEPC 1 [Glycine max]
 dbj|BAA01560.1| phosphoenolpyruvate carboxylase [Glycine max]
Length=967

 Score =   292 bits (747),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+ L QLY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNNLTQLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPTFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|XP_010052683.1| PREDICTED: phosphoenolpyruvate carboxylase 2 [Eucalyptus grandis]
 gb|KCW89639.1| hypothetical protein EUGRSUZ_A01915 [Eucalyptus grandis]
 gb|KCW89640.1| hypothetical protein EUGRSUZ_A01915 [Eucalyptus grandis]
Length=966

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF ALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL QL  KDITPDDKQELDEALQRE
Sbjct  156  VFSALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLTQLNAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAG+SYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGVSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>sp|Q9AU12.1|CAPP_PHAVU RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Phaseolus vulgaris]
 gb|AAK28444.1|AF288382_1 phosphoenolpyruvate carboxylase [Phaseolus vulgaris]
Length=968

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKHARIR+CL++LY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHARIRNCLSKLYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIW GVP FLRRVDTAL NIGI ERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGVPSFLRRVDTALNNIGIKERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>gb|AAY28731.1| phosphoenolpyruvate carboxylase [Alternanthera sessilis]
Length=966

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/147 (95%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VF  LKN TVDLVLTAHPTQSVRRSLLQKH RIRDCL QLY KDITPDDKQELDEALQRE
Sbjct  157  VFATLKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLTQLYAKDITPDDKQELDEALQRE  216

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  217  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  276

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  277  PLIQFSSWMGGDRDGNPRVTPEVTRDV  303



>ref|XP_009334045.1| PREDICTED: phosphoenolpyruvate carboxylase, housekeeping isozyme 
[Pyrus x bretschneideri]
Length=965

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+CL QLY KDITPDDKQE+DEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNCLTQLYAKDITPDDKQEIDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVP+NA
Sbjct  216  IQAAFRTDEIRRTAPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPHNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



>ref|NP_001105503.1| phosphoenolpyruvate carboxylase [Zea mays]
 dbj|BAA28170.1| phosphoenolpyruvate carboxylase [Zea mays]
 gb|AFW71124.1| phosphoenolpyruvate carboxylase [Zea mays]
Length=960

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  152  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  211

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  212  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  271

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  272  PLIQFSSWMGGDRDGNPRVTPEVTRDV  298



>ref|XP_002451855.1| hypothetical protein SORBIDRAFT_04g008720 [Sorghum bicolor]
 gb|EES04831.1| hypothetical protein SORBIDRAFT_04g008720 [Sorghum bicolor]
Length=960

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  152  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  211

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  212  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  271

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  272  PLIQFSSWMGGDRDGNPRVTPEVTRDV  298



>ref|XP_006659319.1| PREDICTED: phosphoenolpyruvate carboxylase 2-like [Oryza brachyantha]
Length=964

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  155  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGI+ERVPYNA
Sbjct  215  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRLDTALKNIGIDERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>dbj|BAJ87123.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=959

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  151  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  210

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  211  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  270

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  271  PLIQFSSWMGGDRDGNPRVTPEVTRDV  297



>sp|P29195.1|CAPP1_SORBI RecName: Full=Phosphoenolpyruvate carboxylase 1; Short=PEPC 1; 
Short=PEPCase 1; AltName: Full=CP21 [Sorghum bicolor]
 emb|CAA39197.1| phosphoenolpyruvate carboxylase [Sorghum bicolor]
 emb|CAA46267.1| phosphoenolpyruvate carboxylase [Sorghum bicolor]
Length=960

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  152  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  211

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  212  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  271

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  272  PLIQFSSWMGGDRDGNPRVTPEVTRDV  298



>gb|AAG00180.1|AF271995_1 phosphoenolpyruvate carboxylase [Oryza sativa Japonica Group]
Length=959

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  151  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  210

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  211  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  270

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  271  PLIQFSSWMGGDRDGNPRVTPEVTRDV  297



>ref|NP_001046417.1| Os02g0244700 [Oryza sativa Japonica Group]
 dbj|BAD27732.1| putative phosphoenolpyruvate carboxylase [Oryza sativa Japonica 
Group]
 dbj|BAF08331.1| Os02g0244700 [Oryza sativa Japonica Group]
 dbj|BAG89331.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89517.1| unnamed protein product [Oryza sativa Japonica Group]
Length=968

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  220  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>gb|EEC72817.1| hypothetical protein OsI_06526 [Oryza sativa Indica Group]
Length=968

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  160  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  219

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  220  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  279

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  280  PLIQFSSWMGGDRDGNPRVTPEVTRDV  306



>sp|Q01647.1|CAPP1_FLAPR RecName: Full=Phosphoenolpyruvate carboxylase; Short=PEPC; Short=PEPCase 
[Flaveria pringlei]
 emb|CAA45505.1| phosphoenolpyruvate carboxylase [Flaveria pringlei]
Length=967

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 143/148 (97%), Gaps = 1/148 (1%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQSVRRSLLQKH RIR+CLAQLY KDITPDDKQELDEAL RE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRIRNCLAQLYAKDITPDDKQELDEALHRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDG-NPRVTPEVTRDV  442
            PLIQFSSWMGGDRDG +PRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGKHPRVTPEVTRDV  303



>gb|EMS68413.1| Phosphoenolpyruvate carboxylase 1 [Triticum urartu]
Length=662

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQS+RRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  159  VFDALKNQTVDLVFTAHPTQSIRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  218

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGI+ER+PYNA
Sbjct  219  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERLPYNA  278

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  279  PLIQFSSWMGGDRDGNPRVTPEVTRDV  305



>gb|AAP06951.1| phosphoenolpyruvate carboxylase [Echinochloa crus-galli]
Length=961

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLV TAHPTQSVRRSLLQKH RIR+CL QLY KDIT DDKQELDEALQRE
Sbjct  153  VFDALKNQTVDLVFTAHPTQSVRRSLLQKHGRIRNCLRQLYAKDITADDKQELDEALQRE  212

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGINER+PYNA
Sbjct  213  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRIDTALKNIGINERLPYNA  272

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  273  PLIQFSSWMGGDRDGNPRVTPEVTRDV  299



>ref|NP_001061646.1| Os08g0366000 [Oryza sativa Japonica Group]
 dbj|BAC24913.1| phosphoenolpyruvate carboxylase [Oryza sativa Japonica Group]
 dbj|BAF23560.1| Os08g0366000 [Oryza sativa Japonica Group]
 gb|EAZ06753.1| hypothetical protein OsI_28997 [Oryza sativa Indica Group]
 gb|EAZ42509.1| hypothetical protein OsJ_27076 [Oryza sativa Japonica Group]
 dbj|BAG93600.1| unnamed protein product [Oryza sativa Japonica Group]
Length=964

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALK+ TVDLVLTAHPTQSVRRSLLQKH+RIR+CL QLY+KDITPDDKQELDEALQRE
Sbjct  155  VFDALKSQTVDLVLTAHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQRE  214

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRT PTPQDEMRAGMSYFHETIWKGVP+FLRR+DTALKNIGI+ERVPYNA
Sbjct  215  IQAAFRTDEIRRTQPTPQDEMRAGMSYFHETIWKGVPKFLRRLDTALKNIGIDERVPYNA  274

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  275  PLIQFSSWMGGDRDGNPRVTPEVTRDV  301



>gb|AAO15570.1|AF459644_1 phosphoenolpyruvate carboxylase [Lupinus albus]
Length=967

 Score =   291 bits (745),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +2

Query  2    VFDALKNHTVDLVLTAHPTQSVRRSLLQKHARIRDCLAQLYNKDITPDDKQELDEALQRE  181
            VFDALKN TVDLVLTAHPTQS+RRSLLQKH RIR+ L +LY KDITPDDKQELDEALQRE
Sbjct  156  VFDALKNQTVDLVLTAHPTQSIRRSLLQKHGRIRNNLTELYAKDITPDDKQELDEALQRE  215

Query  182  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPRFLRRVDTALKNIGINERVPYNA  361
            IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVP+FLRRVDTALKNIGINERVPYNA
Sbjct  216  IQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPQFLRRVDTALKNIGINERVPYNA  275

Query  362  PLIQFSSWMGGDRDGNPRVTPEVTRDV  442
            PLIQFSSWMGGDRDGNPRVTPEVTRDV
Sbjct  276  PLIQFSSWMGGDRDGNPRVTPEVTRDV  302



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557830460880